>cd04128 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was first identified in the fission yeast S. pombe, where it regulates septum formation in the septation initiation network (SIN) through the cdc7 protein kinase. Spg1p is an essential gene that localizes to the spindle pole bodies. When GTP-bound, it binds cdc7 and causes it to translocate to spindle poles. Sid4p (septation initiation defective) is required for localization of Spg1p to the spindle pole body, and the ability of Spg1p to promote septum formation from any point in the cell cycle depends on Sid4p. Spg1p is negatively regulated by Byr4 and cdc16, which form a two-component GTPase activating protein (GAP) for Spg1p. The existence of a SIN-related pathway in plants has been proposed. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are

Probab=99.19 E-value=2.6e-10 Score=88.49 Aligned_cols=151 Identities=16% Similarity=0.209 Sum_probs=96.4 Q ss_pred EEEEECCCCCHHHHHHHHHHHHH-HHCCC-CCCEECCCEEEEECCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEEEC Q ss_conf 89862368504467778864222-10012-31000121499951784388885166157899986664206805999983 Q gi|254780787|r 386 VTIMGHVDHGKTSLLDAIRKADV-AKGEI-GGITQHIGAYQVAYQGKNITFLDTPGHAAFYEMRARGARVTDIAVLVLAA 463 (884) Q Consensus 386 v~v~ghvd~GKt~lld~~r~~~~-~~~e~-ggitq~iga~~~~~~~~~~~~iDtPGh~~f~~~r~rg~~~~d~~ilvv~~ 463 (884) T Consensus 3 ivlvGd~~VGKTsLi~rf~~~~F~~~y~~Tig~d~~~k~i~v~~~~v~l~iwDtaGqe~f~~~~~~y~~~a~~~ilvfDi 82 (182) T cd04128 3 IGLLGDAQIGKTSLMVKYVEGEFDEDYIQTLGVNFMEKTISIRGTEITFSIWDLGGQREFINMLPLVCNDAVAILFMFDL 82 (182) T ss_pred EEEECCCCCCHHHHHHHHHCCCCCCCCCCCCEEEEEEEEEEECCEEEEEEEEECCCCHHHHHHHHHHHCCCCEEEEEEEC T ss_conf 99999999898999999953999999888733898999999999999999986776487899999986478789999978 Q ss_pred CCCCCHHHHHHHHH----HHH--CCCCEEEECCCCCCCCCCCCHHHHHHHC-CCCCCCCCCCCCEEEEEEECCCCCCCCC Q ss_conf 66740235777898----997--0994156123312443320002210000-1320001234740363110024774112 Q gi|254780787|r 464 DEEIMPQAIESINH----AKA--ADVSIIVAINKIDKLGADPQKVRMSLLK-HDVFVESMGGDILDVEISAKNNLNLDKL 536 (884) Q Consensus 464 ~~g~~~qt~e~~~~----~~~--~~~p~iva~nk~d~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 536 (884) T Consensus 83 t~---~~Sf~~~~~w~~~i~~~~~~~~~ilVGnK~DL~~~~~~~~~~~~~~~~~~~a~~~--~~~f~etSAk~~~nV~e~ 157 (182) T cd04128 83 TR---KSTLNSIKEWYRQARGFNKTAIPILVGTKYDLFADLPPEEQEEITKQARKYAKAM--KAPLIFCSTSHSINVQKI 157 (182) T ss_pred CC---HHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCHHEEHHHHHHHHHHHHC--CCEEEEEECCCCCCHHHH T ss_conf 99---8999989999999997689998899998663556556223102489999999984--998999947999798999 Q ss_pred CCCHH Q ss_conf 21000 Q gi|254780787|r 537 LDAIL 541 (884) Q Consensus 537 ~~~~~ 541 (884) T Consensus 158 F~~i~ 162 (182) T cd04128 158 FKIVL 162 (182) T ss_pred HHHHH T ss_conf 99999

HHsearch alignment for GI: 254780787 and conserved domain: cd04128