>cd04154 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are members of the Arf family that bind GDP and GTP with very low affinity. Unlike most Arf family proteins, Arl2 is not myristoylated at its N-terminal helix. The protein PDE-delta, first identified in photoreceptor rod cells, binds specifically to Arl2 and is structurally very similar to RhoGDI. Despite the high structural similarity between Arl2 and Rho proteins and between PDE-delta and RhoGDI, the interactions between the GTPases and their effectors are very different. In its GTP bound form, Arl2 interacts with the protein Binder of Arl2 (BART), and the complex is believed to play a role in mitochondrial adenine nucleotide transport. In its GDP bound form, Arl2 interacts with tubulin- folding Cofactor D; this interaction is believed to play a role in regulation of microtubule dynamics that impact the cytoskeleton, cell division, and cytokinesis.

Probab=99.58 E-value=2.1e-14 Score=116.46 Aligned_cols=156 Identities=19% Similarity=0.230 Sum_probs=110.2 Q ss_pred CCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCCCEECCCE--EEEECCCCEEEEEECCCHHHHHHHHHHHHHCCC Q ss_conf 012553038986236850446777886422210012310001214--999517843888851661578999866642068 Q gi|254780787|r 378 DLDIRPPVVTIMGHVDHGKTSLLDAIRKADVAKGEIGGITQHIGA--YQVAYQGKNITFLDTPGHAAFYEMRARGARVTD 455 (884) Q Consensus 378 ~~~~R~pvv~v~ghvd~GKt~lld~~r~~~~~~~e~ggitq~iga--~~~~~~~~~~~~iDtPGh~~f~~~r~rg~~~~d 455 (884) T Consensus 9 ~~~~~~~KililG~~~sGKTsll~~l~~~~~~-----~~~pT~G~~~~~~~~~~~~l~iwD~~G~e~~~~~~~~y~~~a~ 83 (173) T cd04154 9 KLKEREMRILILGLDNAGKTTILKKLLGEDID-----TISPTLGFQIKTLEYEGYKLNIWDVGGQKTLRPYWRNYFESTD 83 (173) T ss_pred HCCCCCEEEEEECCCCCCHHHHHHHHCCCCCC-----CCCCCCCEEEEEEEECCEEEEEEECCCCCCCCHHHHHHHCCCC T ss_conf 54457318999989997889999998399989-----7267057778999989999999966886020058999722665 Q ss_pred CEEEEEECCCCCC-HHHHHH----HHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCEEEEEEECCC Q ss_conf 0599998366740-235777----89899709941561233124433200022100001320001234740363110024 Q gi|254780787|r 456 IAVLVLAADEEIM-PQAIES----INHAKAADVSIIVAINKIDKLGADPQKVRMSLLKHDVFVESMGGDILDVEISAKNN 530 (884) Q Consensus 456 ~~ilvv~~~~g~~-~qt~e~----~~~~~~~~~p~iva~nk~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 530 (884) T Consensus 84 ~ii~VvD~td~~~~~~~~~~l~~ll~~~~~~~~pili~~NK~Dl~~~~~~~ei~~~l~l---~~~~~~~~~~~~~SAktG 160 (173) T cd04154 84 ALIWVVDSSDRLRLDDCKRELKELLQEERLAGATLLILANKQDLPGALSEEEIREALEL---DKISSHHWRIQPCSAVTG 160 (173) T ss_pred EEEEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCHHHHHHHHHH---HHCCCCCCEEEEEECCCC T ss_conf 38999855657889999999999986354159847999876567778899999999868---744579829999889669 Q ss_pred CCCCCCCCCHH Q ss_conf 77411221000 Q gi|254780787|r 531 LNLDKLLDAIL 541 (884) Q Consensus 531 ~~~~~~~~~~~ 541 (884) T Consensus 161 ~gI~e~f~wL~ 171 (173) T cd04154 161 EGLLQGIDWLV 171 (173) T ss_pred CCHHHHHHHHH T ss_conf 29899999986

HHsearch alignment for GI: 254780787 and conserved domain: cd04154