>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily. Translocation is mediated by EF-G (also called translocase). The structure of EF-G closely resembles that of the complex between EF-Tu and tRNA. This is an example of molecular mimicry; a protein domain evolved so that it mimics the shape of a tRNA molecule. EF-G in the GTP form binds to the ribosome, primarily through the interaction of its EF-Tu-like domain with the 50S subunit. The binding of EF-G to the ribosome in this manner stimulates the GTPase activity of EF-G. On GTP hydrolysis, EF-G undergoes a conformational change that forces its arm deeper into the A site on the 30S subunit. To accommodate this domain, the peptidyl-tRNA in the A site moves to the P site, carrying the mRNA and the deacylated tRNA with it. The ribosome may be prepared for these rearrangements by the initial binding of EF-G as well. The dissociation of EF-G leaves the ribosome ready to accept the next aminoacyl-tRNA into the A site. This group

Probab=99.95 E-value=4.5e-27 Score=203.17 Aligned_cols=125 Identities=27% Similarity=0.390 Sum_probs=112.3 Q ss_pred EEEEECCCCCHHHHHHHHHHHH--------HHHCC----------CCCCEECCCEEEEECCCCEEEEEECCCHHHHHHHH Q ss_conf 8986236850446777886422--------21001----------23100012149995178438888516615789998 Q gi|254780787|r 386 VTIMGHVDHGKTSLLDAIRKAD--------VAKGE----------IGGITQHIGAYQVAYQGKNITFLDTPGHAAFYEMR 447 (884) Q Consensus 386 v~v~ghvd~GKt~lld~~r~~~--------~~~~e----------~ggitq~iga~~~~~~~~~~~~iDtPGh~~f~~~r 447 (884) T Consensus 2 i~iigH~~aGKTtL~E~lL~~~g~i~~~G~V~~g~t~~D~~~~E~~RgiSi~s~~~~~~w~~~~inliDTPG~~DF~~e~ 81 (268) T cd04170 2 IALVGHSGSGKTTLAEALLYATGAIDRLGSVEDGTTVSDYDPEEIKRKMSISTSVAPLEWKGHKINLIDTPGYADFVGET 81 (268) T ss_pred EEEEECCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHCCCCEECCEEEEEECCEEEEEEECCCCHHHHHHH T ss_conf 89990899998999999999669966576545897357787889867967513557888899799998698975799999 Q ss_pred HHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHCCC Q ss_conf 666420680599998366740235777898997099415612331244332000221000013 Q gi|254780787|r 448 ARGARVTDIAVLVLAADEEIMPQAIESINHAKAADVSIIVAINKIDKLGADPQKVRMSLLKHD 510 (884) Q Consensus 448 ~rg~~~~d~~ilvv~~~~g~~~qt~e~~~~~~~~~~p~iva~nk~d~~~~~~~~~~~~~~~~~ 510 (884) T Consensus 82 ~~aL~v~D~Av~Vida~~GVe~~T~~~w~~~~~~~iP~i~fINKmDr~~ad~~~~l~~i~~~l 144 (268) T cd04170 82 RAALRAADAALVVVSAQSGVEVGTEKLWEFADEAGIPRIIFINKMDRERADFDKTLAALQEAF 144 (268) T ss_pred HHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHHHH T ss_conf 998404783999941875476879999999998599989999787878996477999999986

HHsearch alignment for GI: 254780787 and conserved domain: cd04170