>cd04175 Rap1 Rap1 subgroup. The Rap1 subgroup is part of the Rap subfamily of the Ras family. It can be further divided into the Rap1a and Rap1b isoforms. In humans, Rap1a and Rap1b share 95% sequence homology, but are products of two different genes located on chromosomes 1 and 12, respectively. Rap1a is sometimes called smg p21 or Krev1 in the older literature. Rap1 proteins are believed to perform different cellular functions, depending on the isoform, its subcellular localization, and the effector proteins it binds. For example, in rat salivary gland, neutrophils, and platelets, Rap1 localizes to secretory granules and is believed to regulate exocytosis or the formation of secretory granules. Rap1 has also been shown to localize in the Golgi of rat fibroblasts, zymogen granules, plasma membrane, and the microsomal membrane of pancreatic acini, as well as in the endocytic compartment of skeletal muscle cells and fibroblasts. High expression of Rap1 has been observed in the n

Probab=99.09 E-value=5.4e-10 Score=86.31 Aligned_cols=146 Identities=19% Similarity=0.205 Sum_probs=96.3 Q ss_pred EEEEECCCCCHHHHHHHHHHHHHHHCCCCCCEECCCEEE---EECC--CCEEEEEECCCHHHHHHHHHHHHHCCCCEEEE Q ss_conf 898623685044677788642221001231000121499---9517--84388885166157899986664206805999 Q gi|254780787|r 386 VTIMGHVDHGKTSLLDAIRKADVAKGEIGGITQHIGAYQ---VAYQ--GKNITFLDTPGHAAFYEMRARGARVTDIAVLV 460 (884) Q Consensus 386 v~v~ghvd~GKt~lld~~r~~~~~~~e~ggitq~iga~~---~~~~--~~~~~~iDtPGh~~f~~~r~rg~~~~d~~ilv 460 (884) T Consensus 4 IvllGd~~VGKTsli~r~~~~~f~~~y----~pTi~~~~~k~i~~~~~~~~l~iwDtaG~e~~~~l~~~y~~~a~~~ilv 79 (164) T cd04175 4 LVVLGSGGVGKSALTVQFVQGIFVEKY----DPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFTAMRDLYMKNGQGFVLV 79 (164) T ss_pred EEEECCCCCCHHHHHHHHHHCCCCCCC----CCCEEEEEEEEEEECCEEEEEEECCCCCCHHHHHHHHHHHCCCCEEEEE T ss_conf 999899997599999999709288656----8840468999999999999998514775432456788873578689999 Q ss_pred EECCCCCCHHHHHHHH-HH-H---HCCCCEEEECCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCEEEEEEECCCCCCCC Q ss_conf 9836674023577789-89-9---70994156123312443320002210000132000123474036311002477411 Q gi|254780787|r 461 LAADEEIMPQAIESIN-HA-K---AADVSIIVAINKIDKLGADPQKVRMSLLKHDVFVESMGGDILDVEISAKNNLNLDK 535 (884) Q Consensus 461 v~~~~g~~~qt~e~~~-~~-~---~~~~p~iva~nk~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 535 (884) T Consensus 80 ydvt~~~Sf~~~~~~~~~i~~~~~~~~~piilvgNK~DL~~~r--~V~~~~~~--~~a~~~--~~~~~E~SAk~~~nV~~ 153 (164) T cd04175 80 YSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDLEDER--VVGKEQGQ--NLARQW--GCAFLETSAKAKINVNE 153 (164) T ss_pred EECCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHCC--CCCHHHHH--HHHHHC--CCEEEEECCCCCCCHHH T ss_conf 6078777899999999999986289996399852145722206--89999999--999985--99999966898817899 Q ss_pred CCCCHH Q ss_conf 221000 Q gi|254780787|r 536 LLDAIL 541 (884) Q Consensus 536 ~~~~~~ 541 (884) T Consensus 154 ~F~~l~ 159 (164) T cd04175 154 IFYDLV 159 (164) T ss_pred HHHHHH T ss_conf 999999

HHsearch alignment for GI: 254780787 and conserved domain: cd04175