RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780787|ref|YP_003065200.1| translation initiation factor IF-2 [Candidatus Liberibacter asiaticus str. psy62] (884 letters) >gnl|CDD|30878 COG0532, InfB, Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis]. Length = 509 Score = 594 bits (1532), Expect = e-170 Identities = 266/509 (52%), Positives = 359/509 (70%), Gaps = 5/509 (0%) Query: 379 LDIRPPVVTIMGHVDHGKTSLLDAIRKADVAKGEIGGITQHIGAYQVAY---QGKNITFL 435 L++RPPVVTIMGHVDHGKT+LLD IRK +VA GE GGITQHIGAYQV + ITF+ Sbjct: 1 LELRPPVVTIMGHVDHGKTTLLDKIRKTNVAAGEAGGITQHIGAYQVPLDVIKIPGITFI 60 Query: 436 DTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADVSIIVAINKIDKL 495 DTPGH AF MRARGA VTDIA+LV+AAD+ +MPQ IE+INHAKAA V I+VAINKIDK Sbjct: 61 DTPGHEAFTAMRARGASVTDIAILVVAADDGVMPQTIEAINHAKAAGVPIVVAINKIDKP 120 Query: 496 GADPQKVRMSLLKHDVFVESMGGDILDVEISAKNNLNLDKLLDAILLQAEMLDLKTSINR 555 A+P KV+ L ++ + E GGD++ V +SAK +D+LL+ ILL AE+L+LK + Sbjct: 121 EANPDKVKQELQEYGLVPEEWGGDVIFVPVSAKTGEGIDELLELILLLAEVLELKANPEG 180 Query: 556 KAEGIVVEGKLDRGRGPVVTVLVQKGTLSKGNILVVGDQWGKIRALFNDRGQGISKAVPS 615 A G V+E KLD+G GPV TV+VQ GTL KG+I+V G ++G++R + +D G+ I +A PS Sbjct: 181 PARGTVIEVKLDKGLGPVATVIVQDGTLKKGDIIVAGGEYGRVRTMVDDLGKPIKEAGPS 240 Query: 616 MPIEVLGLQGMPMAGDKFGVVDSESRAREIAQYRQRVTRNKSMARRLGSHSALEKLVKNA 675 P+E+LGL +P AGD F VV E +AR IA+ R + R +A + LE+L+ Sbjct: 241 KPVEILGLSEVPAAGDVFIVVKDEKKARAIAELRVVLLREAELASKK--KGELEELIAEI 298 Query: 676 NISSKMKEFPVIIKGDVQGSVEAIVDSLGALKNSEVCLSIVHSSVGAINETDVSLAKASG 735 I ++KE VI+K D QGS+EA+ SL L EV + I+H+ VG I E+DV LA AS Sbjct: 299 KIRGELKELNVILKADTQGSLEALKGSLKKLGVDEVKVRIIHAGVGGITESDVMLAAASD 358 Query: 736 AVIFGFNVRASSQARVLAIKDEIKILYYKIIYDLLDSIKDSMSELLSPEIRETFLGNAEV 795 AVI GFNVR +AR LA + +KI YY +IY L++ ++ +M +L PE +E +G AEV Sbjct: 359 AVIIGFNVRVDPEARRLAESEGVKIRYYDVIYKLIEDVEAAMKGMLEPEKKERVIGLAEV 418 Query: 796 LEVFAVTKLGNVAGCKVSEGKVERGSGVRLIRNSTVIYEGKLKTLKRFKDEVSEVHAGQD 855 VF + K+G +AGC V+EG ++RG+ VR++R+ VIYEG++++LKRFKD+V EV GQ+ Sbjct: 419 RAVFKLPKVGAIAGCMVTEGVIKRGAPVRVVRDGVVIYEGEVESLKRFKDDVKEVRKGQE 478 Query: 856 CGMAFEKYDNIQAGDMIECFSIEHIKRSL 884 CG+A E Y +I+ GD++E F +KR+L Sbjct: 479 CGIAIENYRDIKEGDILEVFEPVEVKRTL 507 >gnl|CDD|36360 KOG1145, KOG1145, KOG1145, Mitochondrial translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis]. Length = 683 Score = 551 bits (1420), Expect = e-157 Identities = 265/631 (41%), Positives = 386/631 (61%), Gaps = 32/631 (5%) Query: 277 SAMRRRQEKFRRNQQQEKREKISREIVVPETITIQELSQRMSERSADVIKFLM--KEGQI 334 +RR +R +Q K + V +T +L+ + +V + L+ Sbjct: 37 ILSQRRYLVGKRREQISKSRLKKKNFSVWNYMTAAKLAAALKCSVDEVQEALLSVGFAYN 96 Query: 335 MKPGD-----VIDADLSEIIANEFGNTVKRVLESDIEVGIFDVADSESD---LDIRPPVV 386 + D ++ E+I ++ + S E E+D L+ RPPVV Sbjct: 97 LAIADSNLDTKGILEVVELILMKYRFVLLPAETSVEEKAADVAPQPEADPKLLEPRPPVV 156 Query: 387 TIMGHVDHGKTSLLDAIRKADVAKGEIGGITQHIGAYQVAY-QGKNITFLDTPGHAAFYE 445 TIMGHVDHGKT+LLDA+RK+ VA GE GGITQHIGA+ V GK+ITFLDTPGHAAF Sbjct: 157 TIMGHVDHGKTTLLDALRKSSVAAGEAGGITQHIGAFTVTLPSGKSITFLDTPGHAAFSA 216 Query: 446 MRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADVSIIVAINKIDKLGADPQKVRMS 505 MRARGA VTDI VLV+AAD+ +MPQ +E+I HAK+A+V I+VAINKIDK GA+P+KV+ Sbjct: 217 MRARGANVTDIVVLVVAADDGVMPQTLEAIKHAKSANVPIVVAINKIDKPGANPEKVKRE 276 Query: 506 LLKHDVFVESMGGDILDVEISAKNNLNLDKLLDAILLQAEMLDLKTSINRKAEGIVVEGK 565 LL + VE +GGD+ + ISA NLD L +AILL AE++DLK AEG V+E Sbjct: 277 LLSQGIVVEDLGGDVQVIPISALTGENLDLLEEAILLLAEVMDLKADPKGPAEGWVIESS 336 Query: 566 LDRGRGPVVTVLVQKGTLSKGNILVVGDQWGKIRALFNDRGQGISKAVPSMPIEVLGLQG 625 +D+GRGPV TV+V++GTL KG++LV G W K+RALF+ G+ I +A PS P+EVLG + Sbjct: 337 VDKGRGPVATVIVKRGTLKKGSVLVAGKSWCKVRALFDHNGKPIDEATPSQPVEVLGWKD 396 Query: 626 MPMAGDKFGVVDSESRAREIAQYRQRVTRNKSMARRLGSHSALEKLVKNANISSKM---- 681 +P+AGD+ V+SE RAR++ R+ + + ++R L + A ++ + Sbjct: 397 LPIAGDEVLEVESEDRARKVLSKRKDESEQEKISRDLEDIEEQREEAAEALLAKREEGEN 456 Query: 682 -------------KEFPVIIKGDVQGSVEAIVDSLGALKNSEVCLSIVHSSVGAINETDV 728 F +IIK DVQGS EA++D+L L + +V L++VHS VG + E+D+ Sbjct: 457 IGRKTRVELHEQNPLFNIIIKCDVQGSAEAVLDALSTLNSEQVKLNVVHSGVGPVTESDL 516 Query: 729 SLAKASGAVIFGFNVRASSQARVLAIKDEIKILYYKIIYDLLDSIKDSMSELLSPEIRET 788 LA+AS A+I+GFNV+AS + LA +KI Y +IY L++ +++ +SE L P + Sbjct: 517 ELAQASDAIIYGFNVKASPSVKQLAAAKGVKIRLYNVIYRLIEDVRELLSERLPPVEEQE 576 Query: 789 FLGNAEVLEVFAVT---KLGNVAGCKVSEGKVERGSGVRLIRNSTVIYEGKLKTLKRFKD 845 +G AEVL F + K VAGC+V+ G +++ +RL+RN V++EG+L +LK K+ Sbjct: 577 VVGEAEVLATFDIREKRKRVPVAGCRVNNGVIKKSCKIRLVRNGKVVFEGELDSLKHLKE 636 Query: 846 EVSEVHAGQDCGMAFEKYD-NIQAGDMIECF 875 +V+EV G +CG+ F+ + + + GD I+C+ Sbjct: 637 DVTEVKKGHECGLTFDDGNEDFKEGDKIQCY 667 >gnl|CDD|177089 CHL00189, infB, translation initiation factor 2; Provisional. Length = 742 Score = 502 bits (1294), Expect = e-142 Identities = 266/761 (34%), Positives = 415/761 (54%), Gaps = 51/761 (6%) Query: 147 SQESSIDL--PEVCDSQQVPEQVLEDPCKEKD-LEIKDVDVGTEVESSVILSHDMGDSDS 203 S E++IDL P + + + KD L D++ + D Sbjct: 10 SSENTIDLKNPLFIKNLKHSSYKIRLESDIKDSLLNLDINKKLHEKL-----------DK 58 Query: 204 SSVVNNKFRESSSDASSNRGKSRGGAGK-----------YASVNSSKPVTRNKVGDDDKK 252 + NK + D+ + K + K + S N+SK +K Sbjct: 59 KNKKFNK-TDDLKDSKKTKLKQKKKIKKKLHIDDDYDNFFDSKNNSKQFAGPLAISLMRK 117 Query: 253 YKKVRIAVAADVDEEGGASRGRSLSAMRRRQEKFRRNQQQEKREKIS--REIVVPETITI 310 K E + + ++++K ++ + + + + I + +TI Sbjct: 118 PKP---------KTEKLKKKITVNKSTNKKKKKVLSSKDELIKYDNNKPKSISIHSPLTI 168 Query: 311 QELSQRMSERSADVIKFLMKEGQIMKPGDVIDADLSEIIANEFGNTVKRVLESDIE---V 367 QELS + ++IK L +G + +ID + +A++FG + +++I Sbjct: 169 QELSTLLCIPETEIIKSLFLKGISVTVNQIIDISIISQVADDFGINIISEEKNNINEKTS 228 Query: 368 GIFDVADSESDLDIRPPVVTIMGHVDHGKTSLLDAIRKADVAKGEIGGITQHIGAYQVAY 427 + + + + RPP+VTI+GHVDHGKT+LLD IRK +A+ E GGITQ IGAY+V + Sbjct: 229 NLDNTSAFTENSINRPPIVTILGHVDHGKTTLLDKIRKTQIAQKEAGGITQKIGAYEVEF 288 Query: 428 QGKN----ITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADV 483 + K+ I FLDTPGH AF MR+RGA VTDIA+L++AAD+ + PQ IE+IN+ +AA+V Sbjct: 289 EYKDENQKIVFLDTPGHEAFSSMRSRGANVTDIAILIIAADDGVKPQTIEAINYIQAANV 348 Query: 484 SIIVAINKIDKLGADPQKVRMSLLKHDVFVESMGGDILDVEISAKNNLNLDKLLDAILLQ 543 IIVAINKIDK A+ ++++ L K+++ E GGD + ISA N+DKLL+ ILL Sbjct: 349 PIIVAINKIDKANANTERIKQQLAKYNLIPEKWGGDTPMIPISASQGTNIDKLLETILLL 408 Query: 544 AEMLDLKTSINRKAEGIVVEGKLDRGRGPVVTVLVQKGTLSKGNILVVGDQWGKIRALFN 603 AE+ DLK + A+GI++E LD+ +GPV T+LVQ GTL G+I+V+G + KIR + N Sbjct: 409 AEIEDLKADPTQLAQGIILEAHLDKTKGPVATILVQNGTLHIGDIIVIGTSYAKIRGMIN 468 Query: 604 DRGQGISKAVPSMPIEVLGLQGMPMAGDKFGVVDSESRAREIAQYRQRVTRNKSMARRLG 663 G I+ A PS +E+ GL +P G+ F V +SE A+ +NK ++ Sbjct: 469 SLGNKINLATPSSVVEIWGLSSVPATGEHFQVFNSEKEAKLKII------KNKENNKKDT 522 Query: 664 SHSALEKLVKNANISSKMKEFPVIIKGDVQGSVEAIVDSLGALKNSEVCLSIVHSSVGAI 723 + K N K+ +IIK D QGS+EAI++S+ + +V L+I+++S+G + Sbjct: 523 TKRITLSTTKTINKKDNKKQINLIIKTDTQGSIEAIINSISQIPQKKVQLNILYASLGEV 582 Query: 724 NETDVSLAKASGAVIFGFNVRASSQARVLAIKDEIKILYYKIIYDLLDSIKDSMSELLSP 783 ETDV A + A I FN + A+ A K I I Y++IYDLL+ I+ M +LL P Sbjct: 583 TETDVEFASTTNAEILAFNTNLAPGAKKAARKLNIIIKEYQVIYDLLEYIEALMEDLLDP 642 Query: 784 EIRETFLGNAEVLEVFAVTKLGNVAGCKVSEGKVERGSGVRLIRNSTVIYEGKLKTLKRF 843 E ++ +G AEV VF + K VAGC+V+EGK+ + + +++IR + +IYEGK+ +LKR Sbjct: 643 EYKKVPIGEAEVKTVFPLAK-RFVAGCRVTEGKITKNALIKVIRENKLIYEGKITSLKRV 701 Query: 844 KDEVSEVHAGQDCGMAFEKYDNIQAGDMIECFSIEHIKRSL 884 K++V E G +CG+ E++ Q+GD I F + K+SL Sbjct: 702 KEDVEEAQEGNECGIFIEEFQLWQSGDKIHAFELIPKKKSL 742 >gnl|CDD|133287 cd01887, IF2_eIF5B, IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily. IF2/eIF5B contribute to ribosomal subunit joining and function as GTPases that are maximally activated by the presence of both ribosomal subunits. As seen in other GTPases, IF2/IF5B undergoes conformational changes between its GTP- and GDP-bound states. Eukaryotic IF2/eIF5Bs possess three characteristic segments, including a divergent N-terminal region followed by conserved central and C-terminal segments. This core region is conserved among all known eukaryotic and archaeal IF2/eIF5Bs and eubacterial IF2s. Length = 168 Score = 266 bits (682), Expect = 2e-71 Identities = 99/168 (58%), Positives = 123/168 (73%), Gaps = 4/168 (2%) Query: 384 PVVTIMGHVDHGKTSLLDAIRKADVAKGEIGGITQHIGAYQV---AYQGKNITFLDTPGH 440 PVVT+MGHVDHGKT+LLD IRK +VA GE GGITQHIGA++V + ITF+DTPGH Sbjct: 1 PVVTVMGHVDHGKTTLLDKIRKTNVAAGEAGGITQHIGAFEVPAEVLKIPGITFIDTPGH 60 Query: 441 AAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADVSIIVAINKIDKLGADPQ 500 AF MRARGA +TDIA+LV+AAD+ +MPQ IE+I AKAA+V IVA+NKIDK A+P+ Sbjct: 61 EAFTNMRARGASLTDIAILVVAADDGVMPQTIEAIKLAKAANVPFIVALNKIDKPNANPE 120 Query: 501 KVRMSLLKHDVFVES-MGGDILDVEISAKNNLNLDKLLDAILLQAEML 547 +V+ L + + E GGD+ V SAK +D LL+AILL AE L Sbjct: 121 RVKNELSELGLQGEDEWGGDVQIVPTSAKTGEGIDDLLEAILLLAEKL 168 >gnl|CDD|143801 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding domain. This domain contains a P-loop motif, also found in several other families such as pfam00071, pfam00025 and pfam00063. Elongation factor Tu consists of three structural domains, this plus two C-terminal beta barrel domains. Length = 185 Score = 168 bits (427), Expect = 8e-42 Identities = 62/184 (33%), Positives = 89/184 (48%), Gaps = 19/184 (10%) Query: 382 RPPVVTIMGHVDHGKTSLLDAIRKADVAKGEIG-----------------GITQHIGAYQ 424 R + I+GHVDHGKT+L DA+ A + G GIT I A Sbjct: 2 RHRNIGIIGHVDHGKTTLTDALLYVTGAIDKRGEVKQEGELDRLKEERERGITIKIAAVS 61 Query: 425 VAYQGKNITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADVS 484 + ++I +DTPGH F + RGA D A+LV+ A E +MPQ E + AK V Sbjct: 62 FETKKRHINIIDTPGHVDFTKEMIRGAAQADGAILVVDAVEGVMPQTREHLLLAKQLGVP 121 Query: 485 IIVAINKIDKL-GADPQKVRMSLLKHDVFVESMGGDILDV-EISAKNNLNLDKLLDAILL 542 IIV INK+D++ A+ +V + + + GG+ + V SA +D LL+A+ L Sbjct: 122 IIVFINKMDRVDDAELDEVVEEISRELLEKYGFGGETIPVIPGSALTGEGIDTLLEALDL 181 Query: 543 QAEM 546 Sbjct: 182 YLPS 185 >gnl|CDD|58093 cd03702, IF2_mtIF2_II, This family represents the domain II of bacterial Initiation Factor 2 (IF2) and its eukaryotic mitochondrial homologue mtIF2. IF2, the largest initiation factor is an essential GTP binding protein. In E. coli three natural forms of IF2 exist in the cell, IF2alpha, IF2beta1, and IF2beta2. Bacterial IF-2 is structurally and functionally related to eukaryotic mitochondrial mtIF-2.. Length = 95 Score = 132 bits (333), Expect = 6e-31 Identities = 56/95 (58%), Positives = 77/95 (81%) Query: 557 AEGIVVEGKLDRGRGPVVTVLVQKGTLSKGNILVVGDQWGKIRALFNDRGQGISKAVPSM 616 AEG+V+E KLD+GRGPV TVLVQ GTL G++LV G +GK+RA+F++ G+ + +A PS Sbjct: 1 AEGVVIESKLDKGRGPVATVLVQNGTLKVGDVLVAGTTYGKVRAMFDENGKRVKEAGPST 60 Query: 617 PIEVLGLQGMPMAGDKFGVVDSESRAREIAQYRQR 651 P+E+LGL+G+P AGDKF VV+SE A+EIA+YR+ Sbjct: 61 PVEILGLKGVPQAGDKFLVVESEKEAKEIAEYRKE 95 >gnl|CDD|133257 cd00881, GTP_translation_factor, GTP translation factor family. This family consists primarily of translation initiation, elongation, and release factors, which play specific roles in protein translation. In addition, the family includes Snu114p, a component of the U5 small nuclear riboprotein particle which is a component of the spliceosome and is involved in excision of introns, TetM, a tetracycline resistance gene that protects the ribosome from tetracycline binding, and the unusual subfamily CysN/ATPS, which has an unrelated function (ATP sulfurylase) acquired through lateral transfer of the EF1-alpha gene and development of a new function. Length = 189 Score = 122 bits (308), Expect = 4e-28 Identities = 61/183 (33%), Positives = 89/183 (48%), Gaps = 26/183 (14%) Query: 386 VTIMGHVDHGKTSLLDAI---------------RKADVAKGEI-GGITQHIGAYQVAYQG 429 V I GHVDHGKT+L + + DV K E GIT G + Sbjct: 2 VGIAGHVDHGKTTLTERLLYVTGDIERDGTVEETFLDVLKEERERGITIKSGVATFEWPD 61 Query: 430 KNITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADVSIIVAI 489 + + F+DTPGH F RG V+D A+LV+ A+E + PQ E + A+ + IIVAI Sbjct: 62 RRVNFIDTPGHEDFSSEVIRGLSVSDGAILVVDANEGVQPQTREHLRIAREGGLPIIVAI 121 Query: 490 NKIDKLG-ADPQKVRM---SLLKHDVFVESMGGDILD------VEISAKNNLNLDKLLDA 539 NKID++G D ++V LL F+ + + V SA + +++LL+A Sbjct: 122 NKIDRVGEEDLEEVLREIKELLGLIGFISTKEEGTRNGLLVPIVPGSALTGIGVEELLEA 181 Query: 540 ILL 542 I+ Sbjct: 182 IVE 184 >gnl|CDD|58092 cd03701, IF2_IF5B_II, IF2_IF5B_II: This family represents the domain II of prokaryotic Initiation Factor 2 (IF2) and its archeal and eukaryotic homologue aeIF5B. IF2, the largest initiation factor is an essential GTP binding protein. In E. coli three natural forms of IF2 exist in the cell, IF2alpha, IF2beta1, and IF2beta2. Disruption of the eIF5B gene (FUN12) in yeast causes a severe slow-growth phenotype, associated with a defect in translation. eIF5B has a function analogous to prokaryotic IF2 in mediating the joining of the 60S ribosomal subunit. The eIF5B consists of three N-terminal domains (I, II, II) connected by a long helix to domain IV. Domain I is a G domain, domain II and IV are beta-barrels and domain III has a novel alpha-beta-alpha sandwich fold. The G domain and the beta-barrel domain II display a similar structure and arrangement to the homologous domains in EF1A, eEF1A and aeIF2gamma.. Length = 95 Score = 118 bits (297), Expect = 8e-27 Identities = 50/95 (52%), Positives = 68/95 (71%) Query: 557 AEGIVVEGKLDRGRGPVVTVLVQKGTLSKGNILVVGDQWGKIRALFNDRGQGISKAVPSM 616 AEG V+E KLD+GRGPV TV+VQ GTL KG+++V G +GKIR + ++ G+ + +A PS Sbjct: 1 AEGTVIESKLDKGRGPVATVIVQNGTLKKGDVIVAGGTYGKIRTMVDENGKALLEAGPST 60 Query: 617 PIEVLGLQGMPMAGDKFGVVDSESRAREIAQYRQR 651 P+E+LGL+ +P AGD VV SE A+EI YR Sbjct: 61 PVEILGLKDVPKAGDGVLVVASEKEAKEIGSYRLV 95 >gnl|CDD|58083 cd03692, mtIF2_IVc, mtIF2_IVc: this family represents the C2 subdomain of domain IV of mitochondrial translation initiation factor 2 (mtIF2) which adopts a beta-barrel fold displaying a high degree of structural similarity with domain II of the translation elongation factor EF-Tu. The C-terminal part of mtIF2 contains the entire fMet-tRNAfmet binding site of IF-2 and is resistant to proteolysis. This C-terminal portion consists of two domains, IF2 C1 and IF2 C2. IF2 C2 been shown to contain all molecular determinants necessary and sufficient for the recognition and binding of fMet-tRNAfMet. Like IF2 from certain prokaryotes such as Thermus thermophilus, mtIF2lacks domain II which is thought to be involved in binding of E.coli IF-2 to 30S subunits.. Length = 84 Score = 116 bits (293), Expect = 3e-26 Identities = 44/84 (52%), Positives = 65/84 (77%) Query: 791 GNAEVLEVFAVTKLGNVAGCKVSEGKVERGSGVRLIRNSTVIYEGKLKTLKRFKDEVSEV 850 G AEV VF ++K+GN+AGC V++GK++R + VR++RN VIYEGK+ +LKRFKD+V EV Sbjct: 1 GEAEVRAVFKISKVGNIAGCYVTDGKIKRNAKVRVLRNGEVIYEGKISSLKRFKDDVKEV 60 Query: 851 HAGQDCGMAFEKYDNIQAGDMIEC 874 G +CG+ E +++I+ GD+IE Sbjct: 61 KKGYECGITLENFNDIKVGDIIEA 84 >gnl|CDD|36359 KOG1144, KOG1144, KOG1144, Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis]. Length = 1064 Score = 116 bits (291), Expect = 3e-26 Identities = 194/923 (21%), Positives = 351/923 (38%), Gaps = 147/923 (15%) Query: 33 QNQGANQGRARSVVVETRKRRSYVQGEEKVSVFRKSSRVIESSSDSSQDLSQAKAKGNFR 92 +N + E + + +EK S+ S +++ + K+ Sbjct: 137 ENVAPVEAAGEKEKKEKAAAKKKKEKKEKEKKKEDSAAAAAEKSVEAKEEKKEKSVTEPA 196 Query: 93 RASRSDKVSSQKNDSSFAGLSQ-GEIESRRRALHEAQVREEELR-KRLEQQSLEQPSQES 150 + + + G+ E ++R+ E Q REEE R +R E++ + +E+ Sbjct: 197 EPEKKEAKGKKAEKKKPKGVRAMQEALAKRQEEEERQKREEEERLRREEEEERRREEEEA 256 Query: 151 SIDLPEVCDSQQVPEQVLEDPCKEKDLEIKDVDVGTEVES----------SVILSHDMGD 200 + + ++ E+ + K L K + E+ + ++ GD Sbjct: 257 QEEEAKEKKKEKEKEKKERKKAEGKLLTAKQKEEAALAEAFLKQLLASGGGLPVADKDGD 316 Query: 201 SDSSSVVNNKFRESSSDASSNRGKSRGGAGKYASVNSSKPVTRN--KVGDDDKKYKKVRI 258 S + NK +++ + + G + ++ + + +V ++ + Sbjct: 317 SKKRPIYANKKKKARQKGNDRTSVEKLGEVEAKENHAGDVGSVDTEEVDLEEDSNTDEKE 376 Query: 259 AVAADVDEEGGASRGRSLSAMRRRQEKFRRNQQQEKREKISREIVVPETITIQELSQRMS 318 DVD+E G + + + + ++E +E++ +E+ E +E S++ + Sbjct: 377 GTPEDVDQEEGEEEDDWDAKVDLAIDGDDDDDEEELQEEVDKEL--KEAEEEEEDSEKPT 434 Query: 319 ERSADVIKFLMKEGQIMKPGDVIDADLSEIIANEFGNTVKRVLESDIEVGIFDVADSESD 378 E +A I K D IA KR ES Sbjct: 435 EDAA--------VKAISKVEDAATRTKRAKIA-------KRATNESAN---------EST 470 Query: 379 LDIRPPVVTIMGHVDHGKTSLLDAIRKADVAKGEIGGITQHIGA---------------- 422 ++R P+ I+GHVD GKT LLD IR +V +GE GGITQ IGA Sbjct: 471 ENLRSPICCILGHVDTGKTKLLDKIRGTNVQEGEAGGITQQIGATYFPAENIREKTKELK 530 Query: 423 --YQVAYQGKNITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKA 480 + + + +DTPGH +F +R+RG+ + D+A+LV+ + PQ IESIN + Sbjct: 531 KDAKKRLKVPGLLVIDTPGHESFTNLRSRGSSLCDLAILVVDIMHGLEPQTIESINLLRM 590 Query: 481 ADVSIIVAINKIDKLGA------DPQKVRMSLLKHDVFVE-------------------- 514 IVA+NKID+L P + K DV E Sbjct: 591 RKTPFIVALNKIDRLYGWKSCPNAPIVEALKKQKKDVQNEFKERLNNIIVEFAEQGLNAE 650 Query: 515 ------SMGGDILDVEISAKNNLNLDKLLDAILLQAE-MLDLKTSINRKAEGIVVEGKLD 567 MG + V SA + + LL ++ + + K + + + V+E K+ Sbjct: 651 LYYKNKEMGETVSIVPTSAISGEGIPDLLLLLVQLTQKTMVEKLAYVDEVQCTVLEVKVI 710 Query: 568 RGRGPVVTVLVQKGTLSKGNILVVGDQWG----KIRALFND--------RGQGIS----K 611 G G + V++ G L +G+ +VV G IRAL +G + K Sbjct: 711 EGHGTTIDVILVNGELHEGDQIVVCGLQGPIVTTIRALLTPQPLKELRVKGTYVHHKEVK 770 Query: 612 AVPSMPIEVLGLQGMPMAGDKFGVVDSESRAREIAQYRQRVTRNKSMARRLGSHSALEKL 671 A + I L+ +AG + VV E E+ A+E L Sbjct: 771 AAQGIKIAAKDLEKA-IAGTRLLVVGPEDDIEELK------------------EEAMEDL 811 Query: 672 VKNANISSKMKEFPVIIKGDVQGSVEAIVDSLGALKNSEVCLSIVHSSVGAINETDVSLA 731 ++ V ++ GS+EA+++ L +K + + +G +++ DV A Sbjct: 812 -ESVLSRIDKSGEGVYVQASTLGSLEALLEFLKTVK-----IPVSGIGIGPVHKKDVMKA 865 Query: 732 ------KASGAVIFGFNVRASSQARVLAIKDEIKILYYKIIYDLLDSIKDSMSELLSPEI 785 K A I F+V+ +AR LA + +KI IIY L D+ + E+ E Sbjct: 866 SVMLEKKKEYATILAFDVKVEREARELADEMGVKIFCADIIYHLFDAFTKYIEEIKE-EK 924 Query: 786 RETFLGNA------EVLEVFAVTKLGN-VAGCKVSEGKVERGSGVRLIRNSTVIYEGKLK 838 ++ A ++L K V G V EG ++ G+ + + + + G++ Sbjct: 925 KKESADEAVFPCVLQILPNCIFNKRDPIVLGVDVEEGILKIGTPICVPKREFIDL-GRVA 983 Query: 839 TLKRFKDEVSEVHAGQDCGMAFE 861 +++ V GQ+ + E Sbjct: 984 SIENNHKPVDYAKKGQEVAIKIE 1006 >gnl|CDD|30828 COG0480, FusA, Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis]. Length = 697 Score = 86.4 bits (214), Expect = 3e-17 Identities = 46/143 (32%), Positives = 65/143 (45%), Gaps = 19/143 (13%) Query: 386 VTIMGHVDHGKTSLLDAI--------RKADVAKG---------EIG-GITQHIGAYQVAY 427 + I+ H+D GKT+L + I + +V G E GIT A + + Sbjct: 13 IGIVAHIDAGKTTLTERILFYTGIISKIGEVHDGAATMDWMEQEQERGITITSAATTLFW 72 Query: 428 QGKN-ITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADVSII 486 +G I +DTPGH F R RV D AV+V+ A E + PQ A V I Sbjct: 73 KGDYRINLIDTPGHVDFTIEVERSLRVLDGAVVVVDAVEGVEPQTETVWRQADKYGVPRI 132 Query: 487 VAINKIDKLGADPQKVRMSLLKH 509 + +NK+D+LGAD V L + Sbjct: 133 LFVNKMDRLGADFYLVVEQLKER 155 >gnl|CDD|133371 cd04171, SelB, SelB subfamily. SelB is an elongation factor needed for the co-translational incorporation of selenocysteine. Selenocysteine is coded by a UGA stop codon in combination with a specific downstream mRNA hairpin. In bacteria, the C-terminal part of SelB recognizes this hairpin, while the N-terminal part binds GTP and tRNA in analogy with elongation factor Tu (EF-Tu). It specifically recognizes the selenocysteine charged tRNAsec, which has a UCA anticodon, in an EF-Tu like manner. This allows insertion of selenocysteine at in-frame UGA stop codons. In E. coli SelB binds GTP, selenocysteyl-tRNAsec, and a stem-loop structure immediately downstream of the UGA codon (the SECIS sequence). The absence of active SelB prevents the participation of selenocysteyl-tRNAsec in translation. Archaeal and animal mechanisms of selenocysteine incorporation are more complex. Although the SECIS elements have different secondary structures and conserved elements between archaea and eukaryotes, they do share a common feature. Unlike in E. coli, these SECIS elements are located in the 3' UTRs. This group contains bacterial SelBs, as well as, one from archaea. Length = 164 Score = 79.9 bits (198), Expect = 3e-15 Identities = 50/160 (31%), Positives = 78/160 (48%), Gaps = 12/160 (7%) Query: 390 GHVDHGKTSLLDAI--RKADVAKGEIG-GITQHIG-AYQVAYQGKNITFLDTPGHAAFYE 445 GH+DHGKT+L+ A+ + D E GIT +G AY GK + F+D PGH F + Sbjct: 7 GHIDHGKTTLIKALTGIETDRLPEEKKRGITIDLGFAYLDLPSGKRLGFIDVPGHEKFIK 66 Query: 446 MRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADV-SIIVAINKIDKLGADPQKVRM 504 GA D+ +LV+AADE IMPQ E + + + +V + K D D + Sbjct: 67 NMLAGAGGIDLVLLVVAADEGIMPQTREHLEILELLGIKRGLVVLTKADL--VDED--WL 122 Query: 505 SLLKHDVFVESMGGDILDVEI---SAKNNLNLDKLLDAIL 541 L++ ++ G + D I SA +++L + + Sbjct: 123 ELVEEEIRELLAGTFLADAPIFPVSAVTGEGIEELKEYLD 162 >gnl|CDD|35683 KOG0462, KOG0462, KOG0462, Elongation factor-type GTP-binding protein [Translation, ribosomal structure and biogenesis]. Length = 650 Score = 79.2 bits (195), Expect = 5e-15 Identities = 62/219 (28%), Positives = 97/219 (44%), Gaps = 25/219 (11%) Query: 386 VTIMGHVDHGKTSLLDAI-RKADVAKGEIG--------------GITQHIGAYQVAYQGK 430 +I+ HVDHGK++L D + IG GIT + Y+ Sbjct: 63 FSIIAHVDHGKSTLADRLLELTGTIDNNIGQEQVLDKLQVERERGITIKAQTASIFYKDG 122 Query: 431 NITFL---DTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADVSIIV 487 L DTPGH F +R D A+LV+ A + + Q + + A A ++II Sbjct: 123 QSYLLNLIDTPGHVDFSGEVSRSLAACDGALLVVDASQGVQAQTVANFYLAFEAGLAIIP 182 Query: 488 AINKIDKLGADPQKVRMSLLKHDVFVESMGGDILDVEISAKNNLNLDKLLDAILLQAEML 547 +NKID ADP++V L ++F I +SAK LN+++LL+AI+ + Sbjct: 183 VLNKIDLPSADPERVENQL--FELFDIPPAEVIY---VSAKTGLNVEELLEAIIRRVP-- 235 Query: 548 DLKTSINRKAEGIVVEGKLDRGRGPVVTVLVQKGTLSKG 586 K + ++ + + D RG + V V G + KG Sbjct: 236 PPKGIRDAPLRMLIFDSEYDEYRGVIALVRVVDGVVRKG 274 >gnl|CDD|31410 COG1217, TypA, Predicted membrane GTPase involved in stress response [Signal transduction mechanisms]. Length = 603 Score = 77.9 bits (192), Expect = 1e-14 Identities = 71/251 (28%), Positives = 103/251 (41%), Gaps = 49/251 (19%) Query: 386 VTIMGHVDHGKTSLLDAIRKAD---VAKGEIG-------------GITQHIGAYQVAYQG 429 + I+ HVDHGKT+L+DA+ K + E+ GIT V Y G Sbjct: 8 IAIIAHVDHGKTTLVDALLKQSGTFREREEVAERVMDSNDLEKERGITILAKNTAVNYNG 67 Query: 430 KNITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADVSIIVAI 489 I +DTPGHA F R + D +L++ A E MPQ + A A + IV I Sbjct: 68 TRINIVDTPGHADFGGEVERVLSMVDGVLLLVDASEGPMPQTRFVLKKALALGLKPIVVI 127 Query: 490 NKIDKLGADPQKVRMSLLKHDVFVE-SMGGDILDVEI---SAKN----------NLNLDK 535 NKID+ A P +V + D+FVE + LD I SA+N ++ Sbjct: 128 NKIDRPDARPDEVVDEV--FDLFVELGATDEQLDFPIVYASARNGTASLDPEDEADDMAP 185 Query: 536 LLDAIL---------------LQAEMLDLKTSINRKAEGIVVEGKLDRGRGPVVTVLVQK 580 L + IL +Q LD + + R G + G + + V ++ Sbjct: 186 LFETILDHVPAPKGDLDEPLQMQVTQLDYNSYVGRIGIGRIFRGTVKPNQ--QVALIKSD 243 Query: 581 GTLSKGNILVV 591 GT G I + Sbjct: 244 GTTENGRITKL 254 >gnl|CDD|133291 cd01891, TypA_BipA, TypA (tyrosine phosphorylated protein A)/BipA subfamily. BipA is a protein belonging to the ribosome-binding family of GTPases and is widely distributed in bacteria and plants. BipA was originally described as a protein that is induced in Salmonella typhimurium after exposure to bactericidal/permeability-inducing protein (a cationic antimicrobial protein produced by neutrophils), and has since been identified in E. coli as well. The properties thus far described for BipA are related to its role in the process of pathogenesis by enteropathogenic E. coli. It appears to be involved in the regulation of several processes important for infection, including rearrangements of the cytoskeleton of the host, bacterial resistance to host defense peptides, flagellum-mediated cell motility, and expression of K5 capsular genes. It has been proposed that BipA may utilize a novel mechanism to regulate the expression of target genes. In addition, BipA from enteropathogenic E. coli has been shown to be phosphorylated on a tyrosine residue, while BipA from Salmonella and from E. coli K12 strains is not phosphorylated under the conditions assayed. The phosphorylation apparently modifies the rate of nucleotide hydrolysis, with the phosphorylated form showing greatly increased GTPase activity. Length = 194 Score = 75.3 bits (186), Expect = 7e-14 Identities = 64/195 (32%), Positives = 91/195 (46%), Gaps = 40/195 (20%) Query: 380 DIRPPVVTIMGHVDHGKTSLLDAIRK---ADVAKGEIG-------------GITQHIGAY 423 DIR + I+ HVDHGKT+L+DA+ K E+ GIT I A Sbjct: 1 DIRN--IAIIAHVDHGKTTLVDALLKQSGTFRENEEVEERVMDSNDLERERGIT--ILAK 56 Query: 424 QVA--YQGKNITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAA 481 A Y+ I +DTPGHA F R + D +L++ A E MPQ + A Sbjct: 57 NTAVTYKDTKINIVDTPGHADFGGEVERVLSMVDGVLLLVDASEGPMPQTRFVLKKALEL 116 Query: 482 DVSIIVAINKIDKLGADPQKVRMSLLKHDVFVESMGG--DILDVEI---SAKN------- 529 + IV INKID+ A P++V + D+F+E +G + LD + SAKN Sbjct: 117 GLKPIVVINKIDRPDARPEEVVDEVF--DLFIE-LGATEEQLDFPVLYASAKNGWASLNL 173 Query: 530 ---NLNLDKLLDAIL 541 + +L+ L D I+ Sbjct: 174 EDPSEDLEPLFDTII 188 >gnl|CDD|30829 COG0481, LepA, Membrane GTPase LepA [Cell envelope biogenesis, outer membrane]. Length = 603 Score = 74.8 bits (184), Expect = 1e-13 Identities = 62/221 (28%), Positives = 110/221 (49%), Gaps = 31/221 (14%) Query: 388 IMGHVDHGKTSLLDAI--RKADVAKGEIG-------------GITQHIGAYQVAYQGKN- 431 I+ H+DHGK++L D + +++ E+ GIT A ++ Y+ K+ Sbjct: 14 IIAHIDHGKSTLADRLLELTGGLSEREMRAQVLDSMDIERERGITIKAQAVRLNYKAKDG 73 Query: 432 ----ITFLDTPGHAAF-YEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADVSII 486 + +DTPGH F YE+ +R + A+LV+ A + + Q + ++ A ++ II Sbjct: 74 ETYVLNLIDTPGHVDFSYEV-SRSLAACEGALLVVDASQGVEAQTLANVYLALENNLEII 132 Query: 487 VAINKIDKLGADPQKVRMSLLKHDVFVESMGGDILD-VEISAKNNLNLDKLLDAILLQAE 545 +NKID ADP++V+ + D+ G D D V +SAK + ++ +L+AI+ + Sbjct: 133 PVLNKIDLPAADPERVKQEI--EDII----GIDASDAVLVSAKTGIGIEDVLEAIV--EK 184 Query: 546 MLDLKTSINRKAEGIVVEGKLDRGRGPVVTVLVQKGTLSKG 586 + K + + ++ + D G VV V + GTL KG Sbjct: 185 IPPPKGDPDAPLKALIFDSWYDNYLGVVVLVRIFDGTLKKG 225 >gnl|CDD|33087 COG3276, SelB, Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis]. Length = 447 Score = 73.1 bits (179), Expect = 3e-13 Identities = 60/221 (27%), Positives = 97/221 (43%), Gaps = 26/221 (11%) Query: 385 VVTIMGHVDHGKTSLLDAIRKADVAKG-EIG--GITQHIGAYQVAYQGKNITFLDTPGHA 441 ++ GH+DHGKT+LL A+ + E GIT +G Y + + F+D PGH Sbjct: 2 IIGTAGHIDHGKTTLLKALTGGVTDRLPEEKKRGITIDLGFYYRKLEDGVMGFIDVPGHP 61 Query: 442 AFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADV----SIIVAINKIDKLGA 497 F G D A+LV+AADE +M Q E H D+ + I+ + K D++ Sbjct: 62 DFISNLLAGLGGIDYALLVVAADEGLMAQTGE---HLLILDLLGIKNGIIVLTKADRVDE 118 Query: 498 DPQKVRMSLLKHDVFVESMGGDILDVEISAKNNLNLDKLLDAILLQAEMLDLKTSINRKA 557 + ++ + D+ + + + SAK ++ L+ E++DL I R Sbjct: 119 ARIEQKIKQILADLSLA----NAKIFKTSAKTGRGIE------ELKNELIDLLEEIERDE 168 Query: 558 EGIVVEGKLDR-----GRGPVVTVLVQKGTLSKGNILVVGD 593 + +DR G G VVT V G + G+ L + Sbjct: 169 QKPFRIA-IDRAFTVKGVGTVVTGTVLSGEVKVGDKLYLSP 208 >gnl|CDD|133290 cd01890, LepA, LepA subfamily. LepA belongs to the GTPase family of and exhibits significant homology to the translation factors EF-G and EF-Tu, indicating its possible involvement in translation and association with the ribosome. LepA is ubiquitous in bacteria and eukaryota (e.g. yeast GUF1p), but is missing from archaea. This pattern of phyletic distribution suggests that LepA evolved through a duplication of the EF-G gene in bacteria, followed by early transfer into the eukaryotic lineage, most likely from the promitochondrial endosymbiont. Yeast GUF1p is not essential and mutant cells did not reveal any marked phenotype. Length = 179 Score = 73.3 bits (181), Expect = 3e-13 Identities = 51/175 (29%), Positives = 87/175 (49%), Gaps = 29/175 (16%) Query: 388 IMGHVDHGKTSLLDAI--RKADVAKGEIG-------------GITQHIGAYQVAYQGKN- 431 I+ H+DHGK++L D + V+K E+ GIT ++ Y+ K+ Sbjct: 5 IIAHIDHGKSTLADRLLELTGTVSKREMKEQVLDSMDLERERGITIKAQTVRLNYKAKDG 64 Query: 432 ----ITFLDTPGHAAF-YEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADVSII 486 + +DTPGH F YE+ +R + A+L++ A + + Q + + A ++ II Sbjct: 65 QEYLLNLIDTPGHVDFSYEV-SRSLAACEGALLLVDATQGVEAQTLANFYLALENNLEII 123 Query: 487 VAINKIDKLGADPQKVRMSLLKHDVFVESMGGDILDV-EISAKNNLNLDKLLDAI 540 INKID ADP++V+ + + +G D + +SAK L ++ LL+AI Sbjct: 124 PVINKIDLPSADPERVKQQI------EDVLGLDPSEAILVSAKTGLGVEDLLEAI 172 >gnl|CDD|133370 cd04170, EF-G_bact, Elongation factor G (EF-G) subfamily. Translocation is mediated by EF-G (also called translocase). The structure of EF-G closely resembles that of the complex between EF-Tu and tRNA. This is an example of molecular mimicry; a protein domain evolved so that it mimics the shape of a tRNA molecule. EF-G in the GTP form binds to the ribosome, primarily through the interaction of its EF-Tu-like domain with the 50S subunit. The binding of EF-G to the ribosome in this manner stimulates the GTPase activity of EF-G. On GTP hydrolysis, EF-G undergoes a conformational change that forces its arm deeper into the A site on the 30S subunit. To accommodate this domain, the peptidyl-tRNA in the A site moves to the P site, carrying the mRNA and the deacylated tRNA with it. The ribosome may be prepared for these rearrangements by the initial binding of EF-G as well. The dissociation of EF-G leaves the ribosome ready to accept the next aminoacyl-tRNA into the A site. This group contains only bacterial members. Length = 268 Score = 71.4 bits (176), Expect = 1e-12 Identities = 37/136 (27%), Positives = 60/136 (44%), Gaps = 20/136 (14%) Query: 386 VTIMGHVDHGKTSLLDAI--------RKADVAKG---------EIG-GITQHIGAYQVAY 427 + ++GH GKT+L +A+ R V G EI ++ + + Sbjct: 2 IALVGHSGSGKTTLAEALLYATGAIDRLGSVEDGTTVSDYDPEEIKRKMSISTSVAPLEW 61 Query: 428 QGKNITFLDTPGHAAFYEMRARGA-RVTDIAVLVLAADEEIMPQAIESINHAKAADVSII 486 +G I +DTPG+A F R A R D A++V++A + + A A + I Sbjct: 62 KGHKINLIDTPGYADFVG-ETRAALRAADAALVVVSAQSGVEVGTEKLWEFADEAGIPRI 120 Query: 487 VAINKIDKLGADPQKV 502 + INK+D+ AD K Sbjct: 121 IFINKMDRERADFDKT 136 >gnl|CDD|133367 cd04167, Snu114p, Snu114p subfamily. Snu114p is one of several proteins that make up the U5 small nuclear ribonucleoprotein (snRNP) particle. U5 is a component of the spliceosome, which catalyzes the splicing of pre-mRNA to remove introns. Snu114p is homologous to EF-2, but typically contains an additional N-terminal domain not found in Ef-2. This protein is part of the GTP translation factor family and the Ras superfamily, characterized by five G-box motifs. Length = 213 Score = 69.9 bits (172), Expect = 3e-12 Identities = 41/134 (30%), Positives = 56/134 (41%), Gaps = 24/134 (17%) Query: 386 VTIMGHVDHGKTSLLDAI------------------RKADVAKGEIG-GITQHIGAYQVA 426 V I GH+ HGKTSLLD + R D+ K E GI+ + Sbjct: 3 VAIAGHLHHGKTSLLDMLIEQTHDLTPSGKDGWKPLRYTDIRKDEQERGISIKSSPISLV 62 Query: 427 YQGKN-----ITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAA 481 +DTPGH F + A R++D VLV+ E + I HA Sbjct: 63 LPDSKGKSYLFNIIDTPGHVNFMDEVAAALRLSDGVVLVVDVVEGVTSNTERLIRHAILE 122 Query: 482 DVSIIVAINKIDKL 495 + I++ INKID+L Sbjct: 123 GLPIVLVINKIDRL 136 >gnl|CDD|35681 KOG0460, KOG0460, KOG0460, Mitochondrial translation elongation factor Tu [Translation, ribosomal structure and biogenesis]. Length = 449 Score = 69.6 bits (170), Expect = 3e-12 Identities = 72/231 (31%), Positives = 103/231 (44%), Gaps = 33/231 (14%) Query: 386 VTIMGHVDHGKTSLLDAIRKADVAKG--------EIG--------GITQHIGAYQVAYQG 429 V +GHVDHGKT+L AI K KG EI GIT I A V Y+ Sbjct: 57 VGTIGHVDHGKTTLTAAITKILAEKGGAKFKKYDEIDKAPEEKARGIT--INAAHVEYET 114 Query: 430 KNITF--LDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADV-SII 486 + D PGHA + + GA D A+LV+AA + MPQ E + A+ V I+ Sbjct: 115 AKRHYAHTDCPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTREHLLLARQVGVKHIV 174 Query: 487 VAINKIDKLGADPQKVRMSLLKHDVFVESMG--GD----ILDVEISAKNNLNLDKLLDAI 540 V INK+D + DP+ + + ++ + G GD I + A + L+AI Sbjct: 175 VFINKVDLV-DDPEMLELVEMEIRELLSEFGFDGDNTPVIRGSALCALEGRQPEIGLEAI 233 Query: 541 LLQAEMLDLKTSI-NRKAEG---IVVEGKLD-RGRGPVVTVLVQKGTLSKG 586 + +D R + + +E GRG VVT +++G L KG Sbjct: 234 EKLLDAVDSYIPTPERDLDKPFLLPIEDVFSIPGRGTVVTGRLERGVLKKG 284 Score = 31.8 bits (72), Expect = 0.95 Identities = 30/139 (21%), Positives = 66/139 (47%), Gaps = 15/139 (10%) Query: 739 FGFN------VRASSQARVLAIKDEIKILYYKIIYDLLDSIKDSMSELLSPEIRETFLGN 792 FGF+ +R S+ + + EI + + I LLD++ DS ++ + FL Sbjct: 203 FGFDGDNTPVIRGSALCALEGRQPEIGL---EAIEKLLDAV-DSYIPTPERDLDKPFLLP 258 Query: 793 AEVLEVFAVTKLGNVAGCKVSEGKVERGSGVRLIRNSTVIYEGKLKTLKRFKDEVSEVHA 852 E +VF++ G V ++ G +++G V ++ ++ + + + ++ F+ + E A Sbjct: 259 IE--DVFSIPGRGTVVTGRLERGVLKKGDEVEIVGHNKTL-KTTVTGIEMFRKSLDEAQA 315 Query: 853 GQDCGMAFE--KYDNIQAG 869 G + G K ++++ G Sbjct: 316 GDNLGALLRGIKREDVKRG 334 >gnl|CDD|133256 cd00880, Era_like, Era (E. coli Ras-like protein)-like. This family includes several distinct subfamilies (TrmE/ThdF, FeoB, YihA (EngG), Era, and EngA/YfgK) that generally show sequence conservation in the region between the Walker A and B motifs (G1 and G3 box motifs), to the exclusion of other GTPases. TrmE is ubiquitous in bacteria and is a widespread mitochondrial protein in eukaryotes, but is absent from archaea. The yeast member of TrmE family, MSS1, is involved in mitochondrial translation; bacterial members are often present in translation-related operons. FeoB represents an unusual adaptation of GTPases for high-affinity iron (II) transport. YihA (EngB) family of GTPases is typified by the E. coli YihA, which is an essential protein involved in cell division control. Era is characterized by a distinct derivative of the KH domain (the pseudo-KH domain) which is located C-terminal to the GTPase domain. EngA and its orthologs are composed of two GTPase domains and, since the sequences of the two domains are more similar to each other than to other GTPases, it is likely that an ancient gene duplication, rather than a fusion of evolutionarily distinct GTPases, gave rise to this family. Length = 163 Score = 69.3 bits (170), Expect = 4e-12 Identities = 33/168 (19%), Positives = 65/168 (38%), Gaps = 22/168 (13%) Query: 388 IMGHVDHGKTSLLDAIRKADVAK-GEIGGITQHIGAYQVAYQ-GKNITFLDTPGH----- 440 + G + GK+SLL+A+ +VA + G T Y + +DTPG Sbjct: 1 LFGRTNAGKSSLLNALLGQEVAIVSPVPGTTTDPVEYVWELGPLGPVVLIDTPGIDEAGG 60 Query: 441 ------AAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADVSIIVAINKIDK 494 + D+ + V+ AD + + + + +++ +NKID Sbjct: 61 LGREREELARRV----LERADLILFVVDADLRADEEEEKLLELLRERGKPVLLVLNKIDL 116 Query: 495 LGADPQKVRMSLLKHDVFVESMGGDILDV-EISAKNNLNLDKLLDAIL 541 L + ++ L + + L V +SA +D+L +A++ Sbjct: 117 LPEEEEE----ELLELRLLILLLLLGLPVIAVSALTGEGIDELREALI 160 >gnl|CDD|35688 KOG0467, KOG0467, KOG0467, Translation elongation factor 2/ribosome biogenesis protein RIA1 and related proteins [Translation, ribosomal structure and biogenesis]. Length = 887 Score = 68.1 bits (166), Expect = 1e-11 Identities = 38/140 (27%), Positives = 64/140 (45%), Gaps = 16/140 (11%) Query: 386 VTIMGHVDHGKTSLLDA---------------IRKADVAKGEIG-GITQHIGAYQVAYQG 429 + ++ HVDHGKTSL D+ IR D + E GIT A + ++ Sbjct: 12 ICLVAHVDHGKTSLADSLVASNGVISSRLAGKIRFLDTREDEQTRGITMKSSAISLLHKD 71 Query: 430 KNITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADVSIIVAI 489 I +D+PGH F + +R++D A++++ E + Q + A + I+ I Sbjct: 72 YLINLIDSPGHVDFSSEVSSASRLSDGALVLVDVVEGVCSQTYAVLRQAWIEGLKPILVI 131 Query: 490 NKIDKLGADPQKVRMSLLKH 509 NKID+L + + +H Sbjct: 132 NKIDRLITELKLSPQEAYEH 151 >gnl|CDD|133284 cd01884, EF_Tu, EF-Tu subfamily. This subfamily includes orthologs of translation elongation factor EF-Tu in bacteria, mitochondria, and chloroplasts. It is one of several GTP-binding translation factors found in the larger family of GTP-binding elongation factors. The eukaryotic counterpart, eukaryotic translation elongation factor 1 (eEF-1 alpha), is excluded from this family. EF-Tu is one of the most abundant proteins in bacteria, as well as, one of the most highly conserved, and in a number of species the gene is duplicated with identical function. When bound to GTP, EF-Tu can form a complex with any (correctly) aminoacylated tRNA except those for initiation and for selenocysteine, in which case EF-Tu is replaced by other factors. Transfer RNA is carried to the ribosome in these complexes for protein translation. Length = 195 Score = 67.6 bits (166), Expect = 1e-11 Identities = 49/132 (37%), Positives = 64/132 (48%), Gaps = 23/132 (17%) Query: 387 TIMGHVDHGKTSLLDAIRKADVAKG--------EIG--------GITQHIGAYQVAYQGK 430 TI GHVDHGKT+L AI K KG EI GIT I V Y+ Sbjct: 7 TI-GHVDHGKTTLTAAITKVLAKKGGAKFKKYDEIDKAPEEKARGIT--INTAHVEYETA 63 Query: 431 NITF--LDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADV-SIIV 487 N + +D PGHA + + GA D A+LV++A + MPQ E + A+ V I+V Sbjct: 64 NRHYAHVDCPGHADYIKNMITGAAQMDGAILVVSATDGPMPQTREHLLLARQVGVPYIVV 123 Query: 488 AINKIDKLGADP 499 +NK D + D Sbjct: 124 FLNKADMV-DDE 134 >gnl|CDD|133258 cd00882, Ras_like_GTPase, Ras-like GTPase superfamily. The Ras-like superfamily of small GTPases consists of several families with an extremely high degree of structural and functional similarity. The Ras superfamily is divided into at least four families in eukaryotes: the Ras, Rho, Rab, and Sar1/Arf families. This superfamily also includes proteins like the GTP translation factors, Era-like GTPases, and G-alpha chain of the heterotrimeric G proteins. Members of the Ras superfamily regulate a wide variety of cellular functions: the Ras family regulates gene expression, the Rho family regulates cytoskeletal reorganization and gene expression, the Rab and Sar1/Arf families regulate vesicle trafficking, and the Ran family regulates nucleocytoplasmic transport and microtubule organization. The GTP translation factor family regulate initiation, elongation, termination, and release in translation, and the Era-like GTPase family regulates cell division, sporulation, and DNA replication. Members of the Ras superfamily are identified by the GTP binding site, which is made up of five characteristic sequence motifs, and the switch I and switch II regions. Length = 157 Score = 67.5 bits (165), Expect = 2e-11 Identities = 33/161 (20%), Positives = 60/161 (37%), Gaps = 12/161 (7%) Query: 388 IMGHVDHGKTSLLDAIRKADVAKGEIGGITQHIGAYQVAYQGKN--ITFLDTPGHAAFYE 445 ++G GKTSLL+ + + E + + GK + DT G F Sbjct: 1 VVGDSGVGKTSLLNRLLGGEFVPEEYETTIIDFYSKTIEVDGKKVKLQIWDTAGQERFRS 60 Query: 446 MRARGARVTDIAVLVLAAD-----EEIMPQAIESINHAKAADVSIIVAINKIDKLGADPQ 500 +R R D +LV E + + + + + ++ II+ NKID Sbjct: 61 LRRLYYRGADGIILVYDVTDRESFENVKEWLLLILINKEGENIPIILVGNKIDLPEERVV 120 Query: 501 KVRMSLLKHDVFVESMGGDILDVEISAKNNLNLDKLLDAIL 541 + + +G + E SAK N+++L + + Sbjct: 121 SEEELAEQ---LAKELG--VPYFETSAKTGENVEELFEELA 156 >gnl|CDD|35689 KOG0468, KOG0468, KOG0468, U5 snRNP-specific protein [Translation, ribosomal structure and biogenesis]. Length = 971 Score = 67.0 bits (163), Expect = 2e-11 Identities = 43/170 (25%), Positives = 68/170 (40%), Gaps = 31/170 (18%) Query: 357 VKRVLESDIEVGIFDVADSESDLDI---------RPPVVTIMGHVDHGKTSLLDAI---- 403 ++ V ++ DV ++ DL+ R V ++GH+ HGKT+L+D + Sbjct: 93 IEPVRRLKFQIHERDVPETVYDLEYLAGLMDNPERIRNVGLVGHLHHGKTALMDLLVEQT 152 Query: 404 ------------RKADVAKGEIG-GITQHIGAYQVAYQGKN-----ITFLDTPGHAAFYE 445 R D E G + + + LDTPGH F + Sbjct: 153 HPDFSKNTEADLRYTDTLFYEQERGCSIKSTPVTLVLSDSKGKSYLMNILDTPGHVNFSD 212 Query: 446 MRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADVSIIVAINKIDKL 495 R++D VLV+ E +M I HA + I+V INK+D+L Sbjct: 213 ETTASLRLSDGVVLVVDVAEGVMLNTERIIKHAIQNRLPIVVVINKVDRL 262 >gnl|CDD|30399 COG0050, TufB, GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis]. Length = 394 Score = 66.8 bits (163), Expect = 2e-11 Identities = 72/238 (30%), Positives = 103/238 (43%), Gaps = 38/238 (15%) Query: 385 VVTIMGHVDHGKTSLLDAIRKADVAKGEIG----------------GITQHIGAYQVAYQ 428 V TI GHVDHGKT+L AI KG GIT I V Y+ Sbjct: 15 VGTI-GHVDHGKTTLTAAITTVLAKKGGAEAKAYDQIDNAPEEKARGIT--INTAHVEYE 71 Query: 429 GKN--ITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADV-SI 485 N +D PGHA + + GA D A+LV+AA + MPQ E I A+ V I Sbjct: 72 TANRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLARQVGVPYI 131 Query: 486 IVAINKIDKLGADPQ-------KVRMSLLKHDVFVES----MGGDILDVEISAKNNLNLD 534 +V +NK+D + D + +VR L ++ + G + +E AK ++ Sbjct: 132 VVFLNKVD-MVDDEELLELVEMEVRELLSEYGFPGDDTPIIRGSALKALEGDAKWEAKIE 190 Query: 535 KLLDAILLQAEMLDLKTSINRKAEGIVVEGKLD-RGRGPVVTVLVQKGTLSKGNILVV 591 +L+DA+ + K + VE GRG VVT V++G L G + + Sbjct: 191 ELMDAV---DSYIPTPERDIDKPFLMPVEDVFSISGRGTVVTGRVERGILKVGEEVEI 245 >gnl|CDD|133289 cd01889, SelB_euk, SelB subfamily. SelB is an elongation factor needed for the co-translational incorporation of selenocysteine. Selenocysteine is coded by a UGA stop codon in combination with a specific downstream mRNA hairpin. In bacteria, the C-terminal part of SelB recognizes this hairpin, while the N-terminal part binds GTP and tRNA in analogy with elongation factor Tu (EF-Tu). It specifically recognizes the selenocysteine charged tRNAsec, which has a UCA anticodon, in an EF-Tu like manner. This allows insertion of selenocysteine at in-frame UGA stop codons. In E. coli SelB binds GTP, selenocysteyl-tRNAsec and a stem-loop structure immediately downstream of the UGA codon (the SECIS sequence). The absence of active SelB prevents the participation of selenocysteyl-tRNAsec in translation. Archaeal and animal mechanisms of selenocysteine incorporation are more complex. Although the SECIS elements have different secondary structures and conserved elements between archaea and eukaryotes, they do share a common feature. Unlike in E. coli, these SECIS elements are located in the 3' UTRs. This group contains eukaryotic SelBs and some from archaea. Length = 192 Score = 67.0 bits (164), Expect = 2e-11 Identities = 44/167 (26%), Positives = 76/167 (45%), Gaps = 24/167 (14%) Query: 386 VTIMGHVDHGKTSLLDAI-RKADVA------KGEIGGITQHIG------------AYQVA 426 V ++GHVD GKTSL A+ A A + + GIT +G + Sbjct: 3 VGVLGHVDSGKTSLAKALSEIASTAAFDKNPQSQERGITLDLGFSSFYVDKPKHLRELIN 62 Query: 427 YQGKN--ITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADVS 484 +N IT +D PGHA+ GA++ D+ +LV+ A + I Q E + + Sbjct: 63 PGEENLQITLVDCPGHASLIRTIIGGAQIIDLMLLVVDATKGIQTQTAECLVIGEILCKK 122 Query: 485 IIVAINKIDKLGADPQKVRMSLLK---HDVFVESMGGDILDVEISAK 528 +IV +NKID + + ++ ++ +K ++ + + +SAK Sbjct: 123 LIVVLNKIDLIPEEERERKIEKMKKKLQKTLEKTRFKNSPIIPVSAK 169 >gnl|CDD|133368 cd04168, TetM_like, Tet(M)-like subfamily. Tet(M), Tet(O), Tet(W), and OtrA are tetracycline resistance genes found in Gram-positive and Gram-negative bacteria. Tetracyclines inhibit protein synthesis by preventing aminoacyl-tRNA from binding to the ribosomal acceptor site. This subfamily contains tetracycline resistance proteins that function through ribosomal protection and are typically found on mobile genetic elements, such as transposons or plasmids, and are often conjugative. Ribosomal protection proteins are homologous to the elongation factors EF-Tu and EF-G. EF-G and Tet(M) compete for binding on the ribosomes. Tet(M) has a higher affinity than EF-G, suggesting these two proteins may have overlapping binding sites and that Tet(M) must be released before EF-G can bind. Tet(M) and Tet(O) have been shown to have ribosome-dependent GTPase activity. These proteins are part of the GTP translation factor family, which includes EF-G, EF-Tu, EF2, LepA, and SelB. Length = 237 Score = 66.1 bits (162), Expect = 4e-11 Identities = 52/185 (28%), Positives = 86/185 (46%), Gaps = 32/185 (17%) Query: 388 IMGHVDHGKTSLL-------DAIRKA-DVAKG-------EIG---GITQHIGAYQVAYQG 429 I+ HVD GKT+L AIRK V KG E+ GIT I + ++Q Sbjct: 4 ILAHVDAGKTTLTESLLYTSGAIRKLGSVDKGTTRTDTMELERQRGIT--IFSAVASFQW 61 Query: 430 KN--ITFLDTPGHAAF-YEMRARGARVTDIAVLVLAADEEIMPQAIESINHA-KAADVSI 485 ++ + +DTPGH F E+ R V D A+LV++A E + Q + + ++ Sbjct: 62 EDTKVNLIDTPGHMDFIAEVE-RSLSVLDGAILVISAVEGVQAQT-RILWRLLRKLNIPT 119 Query: 486 IVAINKIDKLGADPQKVRMSL---LKHDVFVESMGGDILDVEISAKNNLNLDKLLDAILL 542 I+ +NKID+ GAD +KV + L D+ G ++ + + + D+ + + Sbjct: 120 IIFVNKIDRAGADLEKVYQEIKEKLSSDIVPMQKVGLAPNICETNEID---DEFWETLAE 176 Query: 543 QAEML 547 + L Sbjct: 177 GDDEL 181 >gnl|CDD|177010 CHL00071, tufA, elongation factor Tu. Length = 409 Score = 65.4 bits (160), Expect = 6e-11 Identities = 54/150 (36%), Positives = 73/150 (48%), Gaps = 30/150 (20%) Query: 387 TIMGHVDHGKTSLLDAIRKA---------------DVAKGEIG-GITQHIGAYQVAYQGK 430 TI GHVDHGKT+L AI D A E GIT I V Y+ + Sbjct: 17 TI-GHVDHGKTTLTAAITMTLAAKGGAKAKKYDEIDSAPEEKARGIT--INTAHVEYETE 73 Query: 431 NITF--LDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADV-SIIV 487 N + +D PGHA + + GA D A+LV++A + MPQ E I AK V +I+V Sbjct: 74 NRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTKEHILLAKQVGVPNIVV 133 Query: 488 AINKIDKLGADPQ-------KVRMSLLKHD 510 +NK D++ D + +VR L K+D Sbjct: 134 FLNKEDQVD-DEELLELVELEVRELLSKYD 162 Score = 33.8 bits (78), Expect = 0.19 Identities = 29/103 (28%), Positives = 49/103 (47%), Gaps = 24/103 (23%) Query: 766 IYDLLDSIKDSMSELLSPEIRETFLGNAEVLEVFAVTKLGNVAGCKVSEGKVERGS---- 821 IY+L+D++ DS + + FL E +VF++T G VA G++ERG+ Sbjct: 199 IYNLMDAV-DSYIPTPERDTDKPFLMAIE--DVFSITGRGTVA-----TGRIERGTVKVG 250 Query: 822 ------GVRLIRNSTVIYEGKLKTLKRFKDEVSEVHAGQDCGM 858 G+R + +TV L+ F+ + E AG + G+ Sbjct: 251 DTVEIVGLRETKTTTVT------GLEMFQKTLDEGLAGDNVGI 287 >gnl|CDD|35686 KOG0465, KOG0465, KOG0465, Mitochondrial elongation factor [Translation, ribosomal structure and biogenesis]. Length = 721 Score = 61.8 bits (150), Expect = 7e-10 Identities = 41/139 (29%), Positives = 56/139 (40%), Gaps = 18/139 (12%) Query: 386 VTIMGHVDHGKTSLLDAIRKADVAKGEIG------------------GITQHIGAYQVAY 427 + I H+D GKT+L + + IG GIT A + Sbjct: 42 IGISAHIDAGKTTLTERMLYYTGRIKHIGEVRGGGATMDSMELERQRGITIQSAATYFTW 101 Query: 428 QGKNITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADVSIIV 487 + I +DTPGH F R RV D AVLVL A + Q K +V I Sbjct: 102 RDYRINIIDTPGHVDFTFEVERALRVLDGAVLVLDAVAGVESQTETVWRQMKRYNVPRIC 161 Query: 488 AINKIDKLGADPQKVRMSL 506 INK+D++GA P + + Sbjct: 162 FINKMDRMGASPFRTLNQI 180 >gnl|CDD|33865 COG4108, PrfC, Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis]. Length = 528 Score = 61.4 bits (149), Expect = 1e-09 Identities = 42/134 (31%), Positives = 58/134 (43%), Gaps = 22/134 (16%) Query: 388 IMGHVDHGKTSLLD-------AIRKADVAKGEIG---------------GITQHIGAYQV 425 I+ H D GKT+L + AI++A KG GI+ Q Sbjct: 17 IISHPDAGKTTLTEKLLLFGGAIQEAGTVKGRKSGKHAKSDWMEIEKQRGISVTSSVMQF 76 Query: 426 AYQGKNITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADVSI 485 Y + LDTPGH F E R D AV+V+ A + I PQ ++ + D+ I Sbjct: 77 DYADCLVNLLDTPGHEDFSEDTYRTLTAVDSAVMVIDAAKGIEPQTLKLFEVCRLRDIPI 136 Query: 486 IVAINKIDKLGADP 499 INK+D+ G DP Sbjct: 137 FTFINKLDREGRDP 150 >gnl|CDD|34854 COG5257, GCD11, Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis]. Length = 415 Score = 61.0 bits (148), Expect = 1e-09 Identities = 58/204 (28%), Positives = 90/204 (44%), Gaps = 48/204 (23%) Query: 377 SDLDIRPPVVTI--MGHVDHGKTSLLDAIR--KADVAKGEIG-GITQHIG---------- 421 +D P V I +GHVDHGKT+L A+ D E+ GIT +G Sbjct: 2 ADPKHIQPEVNIGMVGHVDHGKTTLTKALSGVWTDRHSEELKRGITIKLGYADAKIYKCP 61 Query: 422 ------AYQVAYQGKN----------ITFLDTPGHAAFYEMRARGARVTDIAVLVLAADE 465 Y + N ++F+D PGH GA + D A+LV+AA+E Sbjct: 62 ECYRPECYTTEPKCPNCGAETELVRRVSFVDAPGHETLMATMLSGAALMDGALLVIAANE 121 Query: 466 EI-MPQAIESINHAKAADV----SIIVAINKIDKLGADPQKVRMSLLKHDVFVESMGGDI 520 PQ E H A ++ +II+ NKID + ++ + + FV+ G + Sbjct: 122 PCPQPQTRE---HLMALEIIGIKNIIIVQNKIDLV--SRERALENYEQIKEFVK---GTV 173 Query: 521 LD----VEISAKNNLNLDKLLDAI 540 + + ISA++ N+D L++AI Sbjct: 174 AENAPIIPISAQHKANIDALIEAI 197 >gnl|CDD|58078 cd01342, Translation_Factor_II_like, Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins. Elongation factor Tu consists of three structural domains, this family represents the second domain. Domain II adopts a beta barrel structure and is involved in binding to charged tRNA. Domain II is found in other proteins such as elongation factor G and translation initiation factor IF-2. This group also includes the C2 subdomain of domain IV of IF-2 that has the same fold as domain II of (EF-Tu). Like IF-2 from certain prokaryotes such as Thermus thermophilus, mitochondrial IF-2 lacks domain II, which is thought to be involved in binding of E.coli IF-2 to 30S subunits.. Length = 83 Score = 61.1 bits (148), Expect = 1e-09 Identities = 30/82 (36%), Positives = 45/82 (54%), Gaps = 1/82 (1%) Query: 793 AEVLEVFAVTKLGNVAGCKVSEGKVERGSGVRLIRNSTVIYEGKLKTLKRFKDEVSEVHA 852 A V +VF G VA +V G +++G VR+ + +GK+K+LKRFK EV E A Sbjct: 3 ALVFKVFKDKGRGTVATGRVESGTLKKGDKVRVGPGGGGV-KGKVKSLKRFKGEVDEAVA 61 Query: 853 GQDCGMAFEKYDNIQAGDMIEC 874 G G+ + D+I+ GD + Sbjct: 62 GDIVGIVLKDKDDIKIGDTLTD 83 Score = 38.4 bits (89), Expect = 0.010 Identities = 23/94 (24%), Positives = 37/94 (39%), Gaps = 12/94 (12%) Query: 557 AEGIVVEGKLDRGRGPVVTVLVQKGTLSKGNILVVGDQWGKIRALFNDRGQGISKAVPSM 616 +V + D+GRG V T V+ GTL KG+ + VG G ++ + + Sbjct: 1 LRALVFKVFKDKGRGTVATGRVESGTLKKGDKVRVGPGGGGVKGKVK----SLKRF---- 52 Query: 617 PIEVLGLQGMPMAGDKFGVVDSESRAREIAQYRQ 650 G +AGD G+V + +I Sbjct: 53 ----KGEVDEAVAGDIVGIVLKDKDDIKIGDTLT 82 >gnl|CDD|133285 cd01885, EF2, EF2 (for archaea and eukarya). Translocation requires hydrolysis of a molecule of GTP and is mediated by EF-G in bacteria and by eEF2 in eukaryotes. The eukaryotic elongation factor eEF2 is a GTPase involved in the translocation of the peptidyl-tRNA from the A site to the P site on the ribosome. The 95-kDa protein is highly conserved, with 60% amino acid sequence identity between the human and yeast proteins. Two major mechanisms are known to regulate protein elongation and both involve eEF2. First, eEF2 can be modulated by reversible phosphorylation. Increased levels of phosphorylated eEF2 reduce elongation rates presumably because phosphorylated eEF2 fails to bind the ribosomes. Treatment of mammalian cells with agents that raise the cytoplasmic Ca2+ and cAMP levels reduce elongation rates by activating the kinase responsible for phosphorylating eEF2. In contrast, treatment of cells with insulin increases elongation rates by promoting eEF2 dephosphorylation. Second, the protein can be post-translationally modified by ADP-ribosylation. Various bacterial toxins perform this reaction after modification of a specific histidine residue to diphthamide, but there is evidence for endogenous ADP ribosylase activity. Similar to the bacterial toxins, it is presumed that modification by the endogenous enzyme also inhibits eEF2 activity. Length = 222 Score = 60.3 bits (147), Expect = 2e-09 Identities = 36/136 (26%), Positives = 56/136 (41%), Gaps = 26/136 (19%) Query: 386 VTIMGHVDHGKTSLLDA-IRKADVAKGEIGG---------------IT--------QHIG 421 + I+ HVDHGKT+L D+ + A + ++ G IT Sbjct: 3 ICIIAHVDHGKTTLSDSLLASAGIISEKLAGKARYMDSREDEQERGITMKSSAISLYFEY 62 Query: 422 AYQVAYQGKN--ITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAK 479 + G I +D+PGH F R+ D A++V+ A E + Q + A Sbjct: 63 EEEDKADGNEYLINLIDSPGHVDFSSEVTAALRLCDGALVVVDAVEGVCVQTETVLRQAL 122 Query: 480 AADVSIIVAINKIDKL 495 V ++ INKID+L Sbjct: 123 KERVKPVLVINKIDRL 138 >gnl|CDD|133283 cd01883, EF1_alpha, Eukaryotic elongation factor 1 (EF1) alpha subfamily. EF1 is responsible for the GTP-dependent binding of aminoacyl-tRNAs to the ribosomes. EF1 is composed of four subunits: the alpha chain which binds GTP and aminoacyl-tRNAs, the gamma chain that probably plays a role in anchoring the complex to other cellular components and the beta and delta (or beta') chains. This subfamily is the alpha subunit, and represents the counterpart of bacterial EF-Tu for the archaea (aEF1-alpha) and eukaryotes (eEF1-alpha). eEF1-alpha interacts with the actin of the eukaryotic cytoskeleton and may thereby play a role in cellular transformation and apoptosis. EF-Tu can have no such role in bacteria. In humans, the isoform eEF1A2 is overexpressed in 2/3 of breast cancers and has been identified as a putative oncogene. This subfamily also includes Hbs1, a G protein known to be important for efficient growth and protein synthesis under conditions of limiting translation initiation in yeast, and to associate with Dom34. It has been speculated that yeast Hbs1 and Dom34 proteins may function as part of a complex with a role in gene expression. Length = 219 Score = 58.6 bits (143), Expect = 7e-09 Identities = 50/192 (26%), Positives = 79/192 (41%), Gaps = 44/192 (22%) Query: 388 IMGHVDHGKTSL-------LDAIRKADVAK-----GEIG-------------------GI 416 ++GHVD GK++ L + K + K E+G G+ Sbjct: 4 VIGHVDAGKSTTTGHLLYLLGGVDKRTIEKYEKEAKEMGKGSFKYAWVLDTLKEERERGV 63 Query: 417 TQHIGAYQVAYQGKNITFLDTPGHAAFYEMRARGARVTDIAVLVLAADE-------EIMP 469 T +G + + T LD PGH F GA D+AVLV+ A + E Sbjct: 64 TIDVGLAKFETEKYRFTILDAPGHRDFVPNMITGASQADVAVLVVDARKGEFEAGFEKGG 123 Query: 470 QAIESINHAKAADVS-IIVAINKIDKLGADPQKVRMSLLKHDV--FVESMGGDILDVE-- 524 Q E A+ V +IVA+NK+D + + + R +K ++ F++ +G + DV Sbjct: 124 QTREHALLARTLGVKQLIVAVNKMDDVTVNWSEERYDEIKKELSPFLKKVGYNPKDVPFI 183 Query: 525 -ISAKNNLNLDK 535 IS NL + Sbjct: 184 PISGLTGDNLIE 195 >gnl|CDD|31353 COG1159, Era, GTPase [General function prediction only]. Length = 298 Score = 57.5 bits (139), Expect = 1e-08 Identities = 48/172 (27%), Positives = 73/172 (42%), Gaps = 30/172 (17%) Query: 386 VTIMGHVDHGKTSLLDAIRKADVA---------KGEIGGITQHIGAYQVAYQGKNITFLD 436 V I+G + GK++LL+A+ ++ + I GI Q I F+D Sbjct: 9 VAIIGRPNVGKSTLLNALVGQKISIVSPKPQTTRNRIRGIV-TTDNAQ-------IIFVD 60 Query: 437 TPG----HAAFYEMRARGARVT----DIAVLVLAADEEIMPQAIESINHAKAADVSIIVA 488 TPG A E+ + AR D+ + V+ ADE P + K +I+ Sbjct: 61 TPGIHKPKHALGELMNKAARSALKDVDLILFVVDADEGWGPGDEFILEQLKKTKTPVILV 120 Query: 489 INKIDKLGADPQKVRMSLLKHDVFVESMGGDILDVEISAKNNLNLDKLLDAI 540 +NKIDK+ LLK F++ + V ISA N+D LL+ I Sbjct: 121 VNKIDKVKPK-----TVLLKLIAFLKKLLPFKEIVPISALKGDNVDTLLEII 167 >gnl|CDD|145217 pfam01926, MMR_HSR1, GTPase of unknown function. Length = 106 Score = 57.7 bits (140), Expect = 2e-08 Identities = 26/106 (24%), Positives = 46/106 (43%), Gaps = 9/106 (8%) Query: 395 GKTSLLDAIRKADVAK-GEIGGITQHIGAYQVAYQGKNITFLDTPG--HAAFYEMRARGA 451 GK++L++A+ A + G T+ +V GK I +DTPG A G Sbjct: 1 GKSTLINALTGKKRAIVSDYPGTTRDPNEGRVELDGKQIILVDTPGIIEGASKGEGELGN 60 Query: 452 RV------TDIAVLVLAADEEIMPQAIESINHAKAADVSIIVAINK 491 R D+ + V+ A E + + +E ++ +I+ +NK Sbjct: 61 RTLEAIEEADLILHVVDASEGLTEEDLEILDLLLELGKPVILVLNK 106 >gnl|CDD|34853 COG5256, TEF1, Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis]. Length = 428 Score = 56.8 bits (137), Expect = 3e-08 Identities = 46/198 (23%), Positives = 78/198 (39%), Gaps = 44/198 (22%) Query: 382 RPPVVTI--MGHVDHGKTSLL------------DAIRKADVAKGEIG------------- 414 P + + +GHVD GK++L+ + K + E+G Sbjct: 4 EKPHLNLVFIGHVDAGKSTLVGRLLYDLGEIDKRTMEKLEKEAKELGKESFKFAWVLDKT 63 Query: 415 ------GITQHIGAYQVAYQGKNITFLDTPGHAAFYEMRARGARVTDIAVLVLAADE--- 465 G+T + + N T +D PGH F + GA D+AVLV+ A + Sbjct: 64 KEERERGVTIDVAHSKFETDKYNFTIIDAPGHRDFVKNMITGASQADVAVLVVDARDGEF 123 Query: 466 ----EIMPQAIESINHAKAADVS-IIVAINKIDKLGADPQKVRMSLLKHDVFVESMGGDI 520 + Q E A+ + +IVA+NK+D + D ++ + + ++ +G + Sbjct: 124 EAGFGVGGQTREHAFLARTLGIKQLIVAVNKMDLVSWDEERFEEIVSEVSKLLKMVGYNP 183 Query: 521 LDVE---ISAKNNLNLDK 535 DV IS NL K Sbjct: 184 KDVPFIPISGFKGDNLTK 201 >gnl|CDD|35685 KOG0464, KOG0464, KOG0464, Elongation factor G [Translation, ribosomal structure and biogenesis]. Length = 753 Score = 56.3 bits (135), Expect = 3e-08 Identities = 45/149 (30%), Positives = 60/149 (40%), Gaps = 24/149 (16%) Query: 374 DSESDLDIRPPVVT------IMGHVDHGKTSLLD-------AIRKA-DVAKGEI------ 413 D +S I P + I+ H+D GKT+ + AI A DV G+ Sbjct: 22 DIKSLHSIINPAIAKIRNIGIIAHIDAGKTTTTERILYLAGAIHSAGDVDDGDTVTDFLA 81 Query: 414 ----GGITQHIGAYQVAYQGKNITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMP 469 GIT A ++G I +DTPGH F R RV D AV V A + Sbjct: 82 IERERGITIQSAAVNFDWKGHRINLIDTPGHVDFRLEVERCLRVLDGAVAVFDASAGVEA 141 Query: 470 QAIESINHAKAADVSIIVAINKIDKLGAD 498 Q + A + INK+DKL A+ Sbjct: 142 QTLTVWRQADKFKIPAHCFINKMDKLAAN 170 >gnl|CDD|133288 cd01888, eIF2_gamma, eIF2-gamma (gamma subunit of initiation factor 2). eIF2 is a heterotrimeric translation initiation factor that consists of alpha, beta, and gamma subunits. The GTP-bound gamma subunit also binds initiator methionyl-tRNA and delivers it to the 40S ribosomal subunit. Following hydrolysis of GTP to GDP, eIF2:GDP is released from the ribosome. The gamma subunit has no intrinsic GTPase activity, but is stimulated by the GTPase activating protein (GAP) eIF5, and GDP/GTP exchange is stimulated by the guanine nucleotide exchange factor (GEF) eIF2B. eIF2B is a heteropentamer, and the epsilon chain binds eIF2. Both eIF5 and eIF2B-epsilon are known to bind strongly to eIF2-beta, but have also been shown to bind directly to eIF2-gamma. It is possible that eIF2-beta serves simply as a high-affinity docking site for eIF5 and eIF2B-epsilon, or that eIF2-beta serves a regulatory role. eIF2-gamma is found only in eukaryotes and archaea. It is closely related to SelB, the selenocysteine-specific elongation factor from eubacteria. The translational factor components of the ternary complex, IF2 in eubacteria and eIF2 in eukaryotes are not the same protein (despite their unfortunately similar names). Both factors are GTPases; however, eubacterial IF-2 is a single polypeptide, while eIF2 is heterotrimeric. eIF2-gamma is a member of the same family as eubacterial IF2, but the two proteins are only distantly related. This family includes translation initiation, elongation, and release factors. Length = 203 Score = 54.6 bits (132), Expect = 1e-07 Identities = 54/197 (27%), Positives = 82/197 (41%), Gaps = 55/197 (27%) Query: 390 GHVDHGKTSLLDAIR--KADVAKGEIG-GITQHIGAYQVA---------------YQGKN 431 GHV HGK++L+ A+ K E+ IT +G Y A Y+ K Sbjct: 7 GHVAHGKSTLVKALSGVWTVRFKEELERNITIKLG-YANAKIYKCPNCGCPRPYCYRSKE 65 Query: 432 -------------------ITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEI-MPQA 471 ++F+D PGH GA V D A+L++AA+E PQ Sbjct: 66 DSPECECPGCGGETKLVRHVSFVDCPGHEILMATMLSGAAVMDGALLLIAANEPCPQPQT 125 Query: 472 IESINHAKAADV----SIIVAINKIDKLGADPQKVRMSLLKHDVFVESMGGDILD----V 523 E H A ++ II+ NKID + ++ + + FV+ G I + + Sbjct: 126 SE---HLAALEIMGLKHIIIVQNKIDLV--KEEQALENYEQIKKFVK---GTIAENAPII 177 Query: 524 EISAKNNLNLDKLLDAI 540 ISA+ N+D LL+ I Sbjct: 178 PISAQLKYNIDVLLEYI 194 >gnl|CDD|31354 COG1160, COG1160, Predicted GTPases [General function prediction only]. Length = 444 Score = 54.0 bits (130), Expect = 2e-07 Identities = 55/229 (24%), Positives = 90/229 (39%), Gaps = 24/229 (10%) Query: 374 DSESDLDIRPPVVTIMGHVDHGKTSLLDAIRKAD-VAKGEIGGITQHIGAYQVAYQGKNI 432 + E + + P + I+G + GK+SL++AI + V +I G T+ + G+ Sbjct: 169 EEEEEEETDPIKIAIIGRPNVGKSSLINAILGEERVIVSDIAGTTRDSIDIEFERDGRKY 228 Query: 433 TFLDTPG----------HAAFYEMRARGA-RVTDIAVLVLAADEEIMPQAIESINHAKAA 481 +DT G + R A D+ +LV+ A E I Q + + A Sbjct: 229 VLIDTAGIRRKGKITESVEKYSVARTLKAIERADVVLLVIDATEGISEQDLRIAGLIEEA 288 Query: 482 DVSIIVAINKIDKLGADPQ---KVRMSLLKHDVFVESMGGDILDVEISAKNNLNLDKLLD 538 I++ +NK D + D + + L + F+ V ISA LDKL + Sbjct: 289 GRGIVIVVNKWDLVEEDEATMEEFKKKLRRKLPFL----DFAPIVFISALTGQGLDKLFE 344 Query: 539 AILLQAEMLDLKTS---INRKAEGIVVEGK--LDRGRGPVVTVLVQKGT 582 AI E + S +NR E V + + GR + Q T Sbjct: 345 AIKEIYECATRRISTSLLNRVLEDAVAKHPPPVRYGRRLKIKYATQVST 393 Score = 53.6 bits (129), Expect = 2e-07 Identities = 44/172 (25%), Positives = 77/172 (44%), Gaps = 26/172 (15%) Query: 383 PPVVTIMGHVDHGKTSLLDAI---RKADVAKGEIGGITQHIGAYQVAYQGKNITFLDTPG 439 PVV I+G + GK++L + + R A V+ + G+T+ + G+ +DT G Sbjct: 3 TPVVAIVGRPNVGKSTLFNRLTGRRIAIVS--DTPGVTRDRIYGDAEWLGREFILIDTGG 60 Query: 440 -----HAAFYEMRARGARV----TDIAVLVLAADEEIMPQAIESINHAKAADVSIIVAIN 490 E+ A + D+ + V+ E I P E + + +I+ +N Sbjct: 61 LDDGDEDELQELIREQALIAIEEADVILFVVDGREGITPADEEIAKILRRSKKPVILVVN 120 Query: 491 KIDKLGADPQKVRMSLLKHDVFVESMG-GDILDVEISAKNNLNLDKLLDAIL 541 KID L A+ ++ + S+G G+ V ISA++ + LLDA+L Sbjct: 121 KIDNLKAEEL-------AYEFY--SLGFGEP--VPISAEHGRGIGDLLDAVL 161 >gnl|CDD|35682 KOG0461, KOG0461, KOG0461, Selenocysteine-specific elongation factor [Translation, ribosomal structure and biogenesis]. Length = 522 Score = 53.9 bits (129), Expect = 2e-07 Identities = 58/235 (24%), Positives = 99/235 (42%), Gaps = 31/235 (13%) Query: 383 PPV---VTIMGHVDHGKTSLLDAI-----------RKADVAKG---EIG--GITQHIGAY 423 PP + I+GHVD GKT+L A+ +G ++G +T A Sbjct: 4 PPSNLNLGILGHVDSGKTTLARALSELGSTAAFDKHPQSTERGITLDLGFSTMTVLSPAR 63 Query: 424 QVAYQGKNITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADV 483 + T +D PGHA+ GA++ D+ +LV+ + Q E + + Sbjct: 64 LPQGEQLQFTLVDCPGHASLIRTIIGGAQIIDLMILVIDVQKGKQTQTAECLIIGELLCK 123 Query: 484 SIIVAINKIDKL--GADPQKVRMSLLKHDVFVESMG--GDILDVEISAKNNLNLDKLLDA 539 ++V INKID L K+ S K +ES G G+ VE+SA + ++++ Sbjct: 124 KLVVVINKIDVLPENQRASKIEKSAKKVRKTLESTGFDGNSPIVEVSAADGYFKEEMIQE 183 Query: 540 ILLQAEMLDLKTSINRKAEGIVVEGKLD-----RGRGPVVTVLVQKGTLSKGNIL 589 + E L+ + ++ E +D +G+G V+T V +G L + Sbjct: 184 LK---EALESRIFEPKRDEEGPFLMAVDHCFAIKGQGTVLTGTVLRGVLRLNTEI 235 >gnl|CDD|133369 cd04169, RF3, RF3 subfamily. Peptide chain release factor 3 (RF3) is a protein involved in the termination step of translation in bacteria. Termination occurs when class I release factors (RF1 or RF2) recognize the stop codon at the A-site of the ribosome and activate the release of the nascent polypeptide. The class II release factor RF3 then initiates the release of the class I RF from the ribosome. RF3 binds to the RF/ribosome complex in the inactive (GDP-bound) state. GDP/GTP exchange occurs, followed by the release of the class I RF. Subsequent hydrolysis of GTP to GDP triggers the release of RF3 from the ribosome. RF3 also enhances the efficiency of class I RFs at less preferred stop codons and at stop codons in weak contexts. Length = 267 Score = 51.0 bits (123), Expect = 1e-06 Identities = 44/134 (32%), Positives = 59/134 (44%), Gaps = 22/134 (16%) Query: 388 IMGHVDHGKTSLLD-------AIRKADVAKG------------EIG---GITQHIGAYQV 425 I+ H D GKT+L + AIR+A K EI GI+ Q Sbjct: 7 IISHPDAGKTTLTEKLLLFGGAIREAGAVKARKSRKHATSDWMEIEKQRGISVTSSVMQF 66 Query: 426 AYQGKNITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADVSI 485 Y+ I LDTPGH F E R D AV+V+ A + + PQ + + + I Sbjct: 67 EYRDCVINLLDTPGHEDFSEDTYRTLTAVDSAVMVIDAAKGVEPQTRKLFEVCRLRGIPI 126 Query: 486 IVAINKIDKLGADP 499 I INK+D+ G DP Sbjct: 127 ITFINKLDREGRDP 140 >gnl|CDD|133286 cd01886, EF-G, Elongation factor G (EF-G) subfamily. Translocation is mediated by EF-G (also called translocase). The structure of EF-G closely resembles that of the complex between EF-Tu and tRNA. This is an example of molecular mimicry; a protein domain evolved so that it mimics the shape of a tRNA molecule. EF-G in the GTP form binds to the ribosome, primarily through the interaction of its EF-Tu-like domain with the 50S subunit. The binding of EF-G to the ribosome in this manner stimulates the GTPase activity of EF-G. On GTP hydrolysis, EF-G undergoes a conformational change that forces its arm deeper into the A site on the 30S subunit. To accommodate this domain, the peptidyl-tRNA in the A site moves to the P site, carrying the mRNA and the deacylated tRNA with it. The ribosome may be prepared for these rearrangements by the initial binding of EF-G as well. The dissociation of EF-G leaves the ribosome ready to accept the next aminoacyl-tRNA into the A site. This group contains both eukaryotic and bacterial members. Length = 270 Score = 50.9 bits (123), Expect = 2e-06 Identities = 41/133 (30%), Positives = 55/133 (41%), Gaps = 18/133 (13%) Query: 388 IMGHVDHGKTSLLD-------AIRKA-DVAKGEIG----------GITQHIGAYQVAYQG 429 I+ H+D GKT+ + I K +V G GIT A ++ Sbjct: 4 IIAHIDAGKTTTTERILYYTGRIHKIGEVHGGGATMDFMEQERERGITIQSAATTCFWKD 63 Query: 430 KNITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADVSIIVAI 489 I +DTPGH F R RV D AV V A + PQ A +V I + Sbjct: 64 HRINIIDTPGHVDFTIEVERSLRVLDGAVAVFDAVAGVEPQTETVWRQADRYNVPRIAFV 123 Query: 490 NKIDKLGADPQKV 502 NK+D+ GAD +V Sbjct: 124 NKMDRTGADFFRV 136 >gnl|CDD|133295 cd01895, EngA2, EngA2 subfamily. This CD represents the second GTPase domain of EngA and its orthologs, which are composed of two adjacent GTPase domains. Since the sequences of the two domains are more similar to each other than to other GTPases, it is likely that an ancient gene duplication, rather than a fusion of evolutionarily distinct GTPases, gave rise to this family. Although the exact function of these proteins has not been elucidated, studies have revealed that the E. coli EngA homolog, Der, and Neisseria gonorrhoeae EngA are essential for cell viability. A recent report suggests that E. coli Der functions in ribosome assembly and stability. Length = 174 Score = 48.6 bits (117), Expect = 7e-06 Identities = 46/177 (25%), Positives = 74/177 (41%), Gaps = 23/177 (12%) Query: 382 RPPVVTIMGHVDHGKTSLLDAIRKAD-VAKGEIGGITQHIGAYQVAYQGKNITFLDTPG- 439 P + I+G + GK+SL++A+ + V +I G T+ Y GK T +DT G Sbjct: 1 DPIRIAIIGRPNVGKSSLVNALLGEERVIVSDIAGTTRDSIDVPFEYDGKKYTLIDTAGI 60 Query: 440 --------HAAFYE-MRARGA-RVTDIAVLVLAADEEIMPQAIESINHAKAADVSIIVAI 489 Y +R A D+ +LV+ A E I Q + ++++ + Sbjct: 61 RRKGKVEEGIEKYSVLRTLKAIERADVVLLVIDATEGITEQDLRIAGLILEEGKALVIVV 120 Query: 490 NKIDKLGADPQKVRMSLLKHDV-----FVESMGGDILDVEISAKNNLNLDKLLDAIL 541 NK D + + M K ++ F++ I V ISA +DKL DAI Sbjct: 121 NKWDLV--EKDSKTMKEFKKEIRRKLPFLD--YAPI--VFISALTGQGVDKLFDAID 171 >gnl|CDD|147093 pfam04760, IF2_N, Translation initiation factor IF-2, N-terminal region. This conserved feature at the N-terminus of bacterial translation initiation factor IF2 has recently had its structure solved. It shows structural similarity to the tRNA anticodon Stem Contact Fold domains of the methionyl-tRNA and glutaminyl-tRNA synthetases, and a similar fold is also found in the B5 domain of the phenylalanine-tRNA synthetase. Length = 52 Score = 48.6 bits (117), Expect = 8e-06 Identities = 16/50 (32%), Positives = 28/50 (56%) Query: 305 PETITIQELSQRMSERSADVIKFLMKEGQIMKPGDVIDADLSEIIANEFG 354 E I + EL++ + S ++IK L K G + +D + +E++A EFG Sbjct: 1 MEKIRVYELAKELGVSSKELIKKLFKLGIMKTHNSTLDEETAELLAEEFG 50 >gnl|CDD|30833 COG0486, ThdF, Predicted GTPase [General function prediction only]. Length = 454 Score = 48.3 bits (115), Expect = 9e-06 Identities = 57/241 (23%), Positives = 98/241 (40%), Gaps = 31/241 (12%) Query: 312 ELSQRMSERSADVIKFLMK-EGQIMKPGDVIDADLSEIIANEFGNTVKRVLESDIEVGIF 370 LSQ ++E +++ L + E I P + I+ + E I + + + E Sbjct: 152 ALSQLINELREALLELLAQVEANIDFPEEDIEELVLEKIREKLEELIAELDEL------- 204 Query: 371 DVADSESDLDIRPPV-VTIMGHVDHGKTSLLDAIRKADVA-KGEIGGITQHIGAYQVAYQ 428 +A ++ +R + V I+G + GK+SLL+A+ D A +I G T+ + + Sbjct: 205 -LATAKQGKILREGLKVVIIGRPNVGKSSLLNALLGRDRAIVTDIAGTTRDVIEEDINLN 263 Query: 429 GKNITFLDTPG---HAAFYEM----RARGARVT-DIAVLVLAADEEIMPQAIESINHAKA 480 G + +DT G E RA+ A D+ + VL A + + + + I Sbjct: 264 GIPVRLVDTAGIRETDDVVERIGIERAKKAIEEADLVLFVLDASQPLDKEDLALIELLPK 323 Query: 481 ADVSIIVAINKIDKLGADPQKVRMSLLKHDVFVESMGGDILDVEISAKNNLNLDKLLDAI 540 IIV +NK D + + E + + ISAK LD L +AI Sbjct: 324 -KKPIIVVLNKADLVSKIELES-----------EKLANGDAIISISAKTGEGLDALREAI 371 Query: 541 L 541 Sbjct: 372 K 372 >gnl|CDD|133363 cd04163, Era, Era subfamily. Era (E. coli Ras-like protein) is a multifunctional GTPase found in all bacteria except some eubacteria. It binds to the 16S ribosomal RNA (rRNA) of the 30S subunit and appears to play a role in the assembly of the 30S subunit, possibly by chaperoning the 16S rRNA. It also contacts several assembly elements of the 30S subunit. Era couples cell growth with cytokinesis and plays a role in cell division and energy metabolism. Homologs have also been found in eukaryotes. Era contains two domains: the N-terminal GTPase domain and a C-terminal domain KH domain that is critical for RNA binding. Both domains are important for Era function. Era is functionally able to compensate for deletion of RbfA, a cold-shock adaptation protein that is required for efficient processing of the 16S rRNA. Length = 168 Score = 48.2 bits (116), Expect = 1e-05 Identities = 31/118 (26%), Positives = 50/118 (42%), Gaps = 13/118 (11%) Query: 432 ITFLDTPG----HAAFYEMRARGARVT----DIAVLVLAADEEIMPQAIESINHAKAADV 483 I F+DTPG E + A D+ + V+ A E I + K + Sbjct: 53 IIFVDTPGIHKPKKKLGERMVKAAWSALKDVDLVLFVVDASEPIGEGDEFILELLKKSKT 112 Query: 484 SIIVAINKIDKLGADPQKVRMSLLKHDVFVESMGGDILDVEISAKNNLNLDKLLDAIL 541 +I+ +NKID + D + LL ++ +G ISA N+D+LL+ I+ Sbjct: 113 PVILVLNKIDLVK-DKED----LLPLLEKLKELGPFAEIFPISALKGENVDELLEEIV 165 >gnl|CDD|30567 COG0218, COG0218, Predicted GTPase [General function prediction only]. Length = 200 Score = 46.8 bits (111), Expect = 2e-05 Identities = 35/174 (20%), Positives = 69/174 (39%), Gaps = 19/174 (10%) Query: 383 PPVVTIMGHVDHGKTSLLDAI--RKADVAKGEIGGITQHIGAYQVAYQGKNITFLDTPGH 440 P + G + GK+SL++A+ +K + G TQ I ++V + +D PG+ Sbjct: 24 LPEIAFAGRSNVGKSSLINALTNQKNLARTSKTPGRTQLINFFEV---DDELRLVDLPGY 80 Query: 441 ---AAFYEMRARGARVTD----------IAVLVLAADEEIMPQAIESINHAKAADVSIIV 487 E++ + ++ + VL++ A E I + +IV Sbjct: 81 GYAKVPKEVKEKWKKLIEEYLEKRANLKGVVLLIDARHPPKDLDREMIEFLLELGIPVIV 140 Query: 488 AINKIDKLGADPQKVRMSLLKHDVFVESMGGDILDVEISAKNNLNLDKLLDAIL 541 + K DKL + +++ + + + D V S+ +D+L IL Sbjct: 141 VLTKADKLKKSERNKQLNKVA-EELKKPPPDDQWVVLFSSLKKKGIDELKAKIL 193 >gnl|CDD|31297 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only]. Length = 219 Score = 46.5 bits (109), Expect = 3e-05 Identities = 36/191 (18%), Positives = 75/191 (39%), Gaps = 18/191 (9%) Query: 386 VTIMGHVDHGKTSLLDAIRKADVAKGEIGGITQHIGAYQVAYQGKNITF--LDTPGHAAF 443 + ++G GKT+LL+ + + +G I A + +NI DT G + Sbjct: 8 IVVLGDGGVGKTTLLNRLVGDEFPEGYPPTIGNLDPAKTIEPYRRNIKLQLWDTAGQEEY 67 Query: 444 YEMRARGARVTDIAVLVLAAD-----EEIMPQAIESINHAKAADVSIIVAINKIDKLGAD 498 +R R + ++V + +E+ + +E + DV I++ NKID Sbjct: 68 RSLRPEYYRGANGILIVYDSTLRESSDELTEEWLEELRELAPDDVPILLVGNKIDLFDEQ 127 Query: 499 PQ-KVRMSLLKHDVFVESMGGDILD--------VEISAKN--NLNLDKLLDAILLQAEML 547 + ++ L +V + + + +E SAK+ N+++L +L + Sbjct: 128 SSSEEILNQLNREVVLLVLAPKAVLPEVANPALLETSAKSLTGPNVNELFKELLRKLLEE 187 Query: 548 DLKTSINRKAE 558 K + + Sbjct: 188 IEKLVLKNELR 198 >gnl|CDD|35680 KOG0459, KOG0459, KOG0459, Polypeptide release factor 3 [Translation, ribosomal structure and biogenesis]. Length = 501 Score = 46.1 bits (109), Expect = 4e-05 Identities = 53/184 (28%), Positives = 76/184 (41%), Gaps = 22/184 (11%) Query: 430 KNITFLDTPGHAAFYEMRARGARVTDIAVLVLAA-------DEEIMPQAIESINHAKAAD 482 K T LD PGH +F GA D+AVLV++A E Q E AK A Sbjct: 157 KRFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAMLAKTAG 216 Query: 483 VS-IIVAINKIDKLGADPQKVRMSLLKHDV--FVESMGG----DILDVEISAKNNLNLDK 535 V +IV INK+D + R K + F+ +G D V +S N+ Sbjct: 217 VKHLIVLINKMDDPTVNWSNERYEECKEKLQPFLRKLGFNPKPDKHFVPVSGLTGANVKD 276 Query: 536 LLDAI------LLQAEMLDLKTSINRKAEGIVVEGKLDRGR--GPVVTVLVQKGTLSKGN 587 D++ + E LD + R G + ++ + G VV V+ G++ KG Sbjct: 277 RTDSVCPWYKGPIFLEYLDELPHLERILNGPIRCPVANKYKDMGTVVGGKVESGSIKKGQ 336 Query: 588 ILVV 591 LVV Sbjct: 337 QLVV 340 >gnl|CDD|133279 cd01878, HflX, HflX subfamily. A distinct conserved domain with a glycine-rich segment N-terminal of the GTPase domain characterizes the HflX subfamily. The E. coli HflX has been implicated in the control of the lambda cII repressor proteolysis, but the actual biological functions of these GTPases remain unclear. HflX is widespread, but not universally represented in all three superkingdoms. Length = 204 Score = 44.3 bits (106), Expect = 2e-04 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 11/62 (17%) Query: 479 KAADVSIIVAINKIDKLGADPQKVRMSLLKHDVFVESMGGDILDVEISAKNNLNLDKLLD 538 A D+ +I+ +NKID L + + R+ + D V ISAK LD+LL+ Sbjct: 150 GAEDIPMILVLNKIDLLDDEELEERLEAGRPDA-----------VFISAKTGEGLDELLE 198 Query: 539 AI 540 AI Sbjct: 199 AI 200 >gnl|CDD|133278 cd01876, YihA_EngB, The YihA (EngB) subfamily. This subfamily of GTPases is typified by the E. coli YihA, an essential protein involved in cell division control. YihA and its orthologs are small proteins that typically contain less than 200 amino acid residues and consists of the GTPase domain only (some of the eukaryotic homologs contain an N-terminal extension of about 120 residues that might be involved in organellar targeting). Homologs of yihA are found in most Gram-positive and Gram-negative pathogenic bacteria, with the exception of Mycobacterium tuberculosis. The broad-spectrum nature of YihA and its essentiality for cell viability in bacteria make it an attractive antibacterial target. Length = 170 Score = 43.6 bits (104), Expect = 2e-04 Identities = 32/168 (19%), Positives = 63/168 (37%), Gaps = 34/168 (20%) Query: 395 GKTSLLDAI--RKADVAKGEIGGITQHIGAYQVAYQGKNITFLDTPGHAAFY-------E 445 GK+SL++A+ RK + G TQ I + V +D PG Y E Sbjct: 11 GKSSLINALTNRKKLARTSKTPGKTQLINFFNV---NDKFRLVDLPG----YGYAKVSKE 63 Query: 446 MRARGARVTD----------IAVLVLAADEEIMPQAIESINHAKAADVSIIVAINKIDKL 495 ++ + ++ + VL++ + +E ++ + + +V + K DKL Sbjct: 64 VKEKWGKLIEEYLENRENLKGVVLLIDSRHGPTEIDLEMLDWLEELGIPFLVVLTKADKL 123 Query: 496 GADPQKVRMSLLKHDVFVESMGGDILDVEI---SAKNNLNLDKLLDAI 540 + +K + + +D I S+ +D+L I Sbjct: 124 KKSELAKALKEIK-----KELKLFEIDPPIILFSSLKGQGIDELRALI 166 >gnl|CDD|32720 COG2895, CysN, GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism]. Length = 431 Score = 43.3 bits (102), Expect = 3e-04 Identities = 39/176 (22%), Positives = 70/176 (39%), Gaps = 41/176 (23%) Query: 390 GHVDHGKTSL---------------LDAIRKADVAKGEIG------------------GI 416 G VD GK++L L ++ + KG G GI Sbjct: 13 GSVDDGKSTLIGRLLYDTKAIYEDQLASLERDSKRKGTQGEKIDLALLVDGLEAEREQGI 72 Query: 417 TQHIGAYQVAYQGKNITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESIN 476 T + + + + DTPGH + A GA D+A+L++ A + ++ Q + Sbjct: 73 TIDVAYRYFSTEKRKFIIADTPGHEQYTRNMATGASTADLAILLVDARKGVLEQ---TRR 129 Query: 477 HAKAADV----SIIVAINKIDKLGADPQKVRMSLLKHDVFVESMGG-DILDVEISA 527 H+ A + ++VA+NK+D + + + + F +G D+ + ISA Sbjct: 130 HSFIASLLGIRHVVVAVNKMDLVDYSEEVFEAIVADYLAFAAQLGLKDVRFIPISA 185 >gnl|CDD|133294 cd01894, EngA1, EngA1 subfamily. This CD represents the first GTPase domain of EngA and its orthologs, which are composed of two adjacent GTPase domains. Since the sequences of the two domains are more similar to each other than to other GTPases, it is likely that an ancient gene duplication, rather than a fusion of evolutionarily distinct GTPases, gave rise to this family. Although the exact function of these proteins has not been elucidated, studies have revealed that the E. coli EngA homolog, Der, and Neisseria gonorrhoeae EngA are essential for cell viability. A recent report suggests that E. coli Der functions in ribosome assembly and stability. Length = 157 Score = 43.2 bits (103), Expect = 3e-04 Identities = 29/130 (22%), Positives = 54/130 (41%), Gaps = 24/130 (18%) Query: 423 YQVAYQGKNITFLDTPGHAAFYE-----MRA---RGARVTDIAVLVLAADEEIMPQAIES 474 + + G+ +DT G E +R D+ + V+ E + P E Sbjct: 38 GEAEWGGREFILIDTGGIEPDDEGISKEIREQAELAIEEADVILFVVDGREGLTPADEEI 97 Query: 475 INHAKAADVSIIVAINKIDKLGADPQKVRMSLLKHDVFVE--SMG-GDILDVEISAKNNL 531 + + + +I+ +NK+D ++ + D E S+G G+ + ISA++ Sbjct: 98 AKYLRKSKKPVILVVNKVD-----------NIKEEDEAAEFYSLGFGEP--IPISAEHGR 144 Query: 532 NLDKLLDAIL 541 + LLDAIL Sbjct: 145 GIGDLLDAIL 154 >gnl|CDD|133281 cd01881, Obg_like, The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1. Four of these groups (Obg, DRG, YyaF/YchF, and Ygr210) are characterized by a distinct glycine-rich motif immediately following the Walker B motif (G3 box). Obg/CgtA is an essential gene that is involved in the initiation of sporulation and DNA replication in the bacteria Caulobacter and Bacillus, but its exact molecular role is unknown. Furthermore, several OBG family members possess a C-terminal RNA-binding domain, the TGS domain, which is also present in threonyl-tRNA synthetase and in bacterial guanosine polyphosphatase SpoT. Nog1 is a nucleolar protein that might function in ribosome assembly. The DRG and Nog1 subfamilies are ubiquitous in archaea and eukaryotes, the Ygr210 subfamily is present in archaea and fungi, and the Obg and YyaF/YchF subfamilies are ubiquitous in bacteria and eukaryotes. The Obg/Nog1 and DRG subfamilies appear to form one major branch of the Obg family and the Ygr210 and YchF subfamilies form another branch. No GEFs, GAPs, or GDIs for Obg have been identified. Length = 176 Score = 42.9 bits (102), Expect = 4e-04 Identities = 41/179 (22%), Positives = 68/179 (37%), Gaps = 47/179 (26%) Query: 395 GKTSLLDAIRKADVAKGEIGG-----ITQHIGAYQVAYQGKNITFLDTPG---HAAFYEM 446 GK++LL+A+ A ++ + ++G +V G I D PG A+ Sbjct: 8 GKSTLLNALTNAKP---KVANYPFTTLEPNLGVVEVPD-GARIQVADIPGLIEGAS---- 59 Query: 447 RARG--------ARVTDIAVLVL--AADEEIMP----QAIESINH----AKAADVS---- 484 RG R D + V+ + D++I + E +N + Sbjct: 60 EGRGLGNQFLAHIRRADAILHVVDASEDDDIGGVDPLEDYEILNAELKLYDLETILGLLT 119 Query: 485 ---IIVAINKIDKLGADPQKVRMSLLKHDVFVESMGGDILDVEISAKNNLNLDKLLDAI 540 +I +NKID A+ L + V ++ V ISAK LD+L+ AI Sbjct: 120 AKPVIYVLNKIDLDDAEE------LEEELVRELALEEGAEVVPISAKTEEGLDELIRAI 172 >gnl|CDD|32410 COG2229, COG2229, Predicted GTPase [General function prediction only]. Length = 187 Score = 42.6 bits (100), Expect = 5e-04 Identities = 39/177 (22%), Positives = 71/177 (40%), Gaps = 22/177 (12%) Query: 381 IRPPVVTIMGHVDHGKTSLL-----------DAIRKADVAKG-EIGGITQHIGAYQVAYQ 428 + + ++G V GKT+ + +A + KG + G+ ++ + Sbjct: 8 MIETKIVVIGPVGAGKTTFVRALSDKPLVITEADASSVSGKGKRPTTVAMDFGSIEL-DE 66 Query: 429 GKNITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKA-ADVSIIV 487 + TPG F M +R A++++ + I A E I+ + + ++V Sbjct: 67 DTGVHLFGTPGQERFKFMWEILSRGAVGAIVLVDSSRPITFHAEEIIDFLTSRNPIPVVV 126 Query: 488 AINKIDKLGAD-PQKVRMSLLKHDVFVESMGGDILDVEISAKNNLNLDKLLDAILLQ 543 AINK D A P+K+R +L + V +EI A LD +LL+ Sbjct: 127 AINKQDLFDALPPEKIREALKLELLSVPV-------IEIDATEGEGARDQLDVLLLK 176 >gnl|CDD|145992 pfam03144, GTP_EFTU_D2, Elongation factor Tu domain 2. Elongation factor Tu consists of three structural domains, this is the second domain. This domain adopts a beta barrel structure. This the second domain is involved in binding to charged tRNA. This domain is also found in other proteins such as elongation factor G and translation initiation factor IF-2. This domain is structurally related to pfam03143, and in fact has weak sequence matches to this domain. Length = 70 Score = 42.6 bits (101), Expect = 5e-04 Identities = 19/70 (27%), Positives = 36/70 (51%), Gaps = 3/70 (4%) Query: 805 GNVAGCKVSEGKVERGSGVRLIRNSTVIYEGKLKTLKRFKDEVSEVHAGQDCGMAFE--K 862 G VA +V G +++G V + N T +G++ +L+ F ++ E AG + G+ Sbjct: 1 GTVATGRVESGTLKKGDKVVIGPNGT-GKKGRVTSLEMFHGDLREAVAGANAGIILAGIG 59 Query: 863 YDNIQAGDMI 872 +I+ GD + Sbjct: 60 LKDIKRGDTL 69 Score = 35.7 bits (83), Expect = 0.058 Identities = 19/71 (26%), Positives = 34/71 (47%), Gaps = 8/71 (11%) Query: 571 GPVVTVLVQKGTLSKGNILVVG----DQWGKIRALFNDRG---QGISKAVPSMPIEVLGL 623 G V T V+ GTL KG+ +V+G + G++ +L G + ++ A + + +GL Sbjct: 1 GTVATGRVESGTLKKGDKVVIGPNGTGKKGRVTSLEMFHGDLREAVAGANAGIILAGIGL 60 Query: 624 QGMPMAGDKFG 634 + GD Sbjct: 61 KD-IKRGDTLT 70 >gnl|CDD|34855 COG5258, GTPBP1, GTPase [General function prediction only]. Length = 527 Score = 41.4 bits (97), Expect = 0.001 Identities = 67/300 (22%), Positives = 106/300 (35%), Gaps = 71/300 (23%) Query: 357 VKRVLESDIEVGIFDVADSESDLDIRPPVVTIMGHVDHGKTSLLDAIRK----------- 405 V+ +D V V + V GHVDHGK++L+ + Sbjct: 92 VRVHEGTDGYVAEVLVRRKTEEAPEHVLVGV-AGHVDHGKSTLVGVLVTGRLDDGDGATR 150 Query: 406 --ADVAKGEI-GGITQHIGAYQVAYQG-----------------------KNITFLDTPG 439 DV K E+ G++ I + K ++F+DT G Sbjct: 151 SYLDVQKHEVERGLSADISLRVYGFDDGKVVRLKNPLDEAEKAAVVKRADKLVSFVDTVG 210 Query: 440 HAAFYEMRARG--ARVTDIAVLVLAADEEIMPQAIESINHAKAADVSIIVAINKIDKLGA 497 H + RG + D +LV+AAD+ + E + A A ++ +IV + KID + Sbjct: 211 HEPWLRTTIRGLLGQKVDYGLLVVAADDGVTKMTKEHLGIALAMELPVIVVVTKIDMVPD 270 Query: 498 DP-QKVR---MSLLK------------HDVFVESMGGDILD-----VEISAKNNLNLDKL 536 D Q V +LLK DV + + S+ LD L Sbjct: 271 DRFQGVVEEISALLKRVGRIPLIVKDTDDVVLAAKAMKAGRGVVPIFYTSSVTGEGLDLL 330 Query: 537 LDAILLQAEMLDLKTSINRKAEG----IVVEGKLDRGRGPVVTVLVQKGTLSKGNILVVG 592 + LL L EG + + G G VV+ V+ G L G+ +++G Sbjct: 331 DEFFLL------LPKRRRWDDEGPFLMYIDKIYSVTGVGTVVSGSVKSGILHVGDTVLLG 384 >gnl|CDD|133347 cd04147, Ras_dva, Ras-dva subfamily. Ras-dva (Ras - dorsal-ventral anterior localization) subfamily consists of a set of proteins characterized only in Xenopus leavis, to date. In Xenopus Ras-dva expression is activated by the transcription factor Otx2 and begins during gastrulation throughout the anterior ectoderm. Ras-dva expression is inhibited in the anterior neural plate by factor Xanf1. Downregulation of Ras-dva results in head development abnormalities through the inhibition of several regulators of the anterior neural plate and folds patterning, including Otx2, BF-1, Xag2, Pax6, Slug, and Sox9. Downregulation of Ras-dva also interferes with the FGF-8a signaling within the anterior ectoderm. Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Ras proteins. Length = 198 Score = 41.3 bits (97), Expect = 0.001 Identities = 37/131 (28%), Positives = 54/131 (41%), Gaps = 9/131 (6%) Query: 419 HIGAYQVAYQGKNITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIES---- 474 H Y+V + LDT G +F MR + +D LV A D+ + +E Sbjct: 36 HRKEYEVGGVSLTLDILDTSGSYSFPAMRKLSIQNSDAFALVYAVDDPESFEEVERLREE 95 Query: 475 INHAKA-ADVSIIVAINKIDKLGADPQKVRMSLLKHDVFVESMGGDILDVEISAKNNLNL 533 I K V I+V NK D L + Q L + + VE SAK+N N+ Sbjct: 96 ILEVKEDKFVPIVVVGNKADSLEEERQVPAKDALS----TVELDWNCGFVETSAKDNENV 151 Query: 534 DKLLDAILLQA 544 ++ +L QA Sbjct: 152 LEVFKELLRQA 162 >gnl|CDD|32443 COG2262, HflX, GTPases [General function prediction only]. Length = 411 Score = 40.7 bits (95), Expect = 0.002 Identities = 44/198 (22%), Positives = 79/198 (39%), Gaps = 36/198 (18%) Query: 384 PVVTIMGHVDHGKTSLLDAIRKADVA--------------KGEIGGITQHIGAYQVAYQG 429 P+V ++G+ + GK++L +A+ ADV + E+G + + V + Sbjct: 193 PLVALVGYTNAGKSTLFNALTGADVYVADQLFATLDPTTRRIELGDGRKVLLTDTVGF-- 250 Query: 430 KNITFLDTPGHAAFYEMRARGARVTDIAVLVL-AADEEIMPQA---IESINHAKAADVSI 485 I L P AF + D+ + V+ A+D EI+ + + + A ++ I Sbjct: 251 --IRDLPHPLVEAFKSTLEE-VKEADLLLHVVDASDPEILEKLEAVEDVLAEIGADEIPI 307 Query: 486 IVAINKIDKLGADPQKVRMSLLKHDVFVESMGGDILDVEISAKNNLNLDKLLDAI--LLQ 543 I+ +NKID L + + + V ISAK LD L + I LL Sbjct: 308 ILVLNKIDLLEDEEILAELERGSPNP-----------VFISAKTGEGLDLLRERIIELLS 356 Query: 544 AEMLDLKTSINRKAEGIV 561 ++ + G + Sbjct: 357 GLRTEVTLELPYTDAGRL 374 >gnl|CDD|35679 KOG0458, KOG0458, KOG0458, Elongation factor 1 alpha [Translation, ribosomal structure and biogenesis]. Length = 603 Score = 40.0 bits (93), Expect = 0.003 Identities = 34/133 (25%), Positives = 51/133 (38%), Gaps = 12/133 (9%) Query: 415 GITQHIGAYQVAYQGKNITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIES 474 G+T + + K +T +D PGH F GA D+AVLV+ A + Sbjct: 240 GVTMDVKTTWFESKSKIVTLIDAPGHKDFIPNMISGASQADVAVLVVDASTGEFESGFDP 299 Query: 475 IN----HAKAADV----SIIVAINKIDKLGADPQKVRMSLLKHDVFVESMGG----DILD 522 HA +IVAINK+D + + K F++ G + Sbjct: 300 GGQTREHALLLRSLGISQLIVAINKMDLVSWSQDRFEEIKNKLSSFLKESCGFKESSVKF 359 Query: 523 VEISAKNNLNLDK 535 + IS + NL K Sbjct: 360 IPISGLSGENLIK 372 >gnl|CDD|35690 KOG0469, KOG0469, KOG0469, Elongation factor 2 [Translation, ribosomal structure and biogenesis]. Length = 842 Score = 40.0 bits (93), Expect = 0.003 Identities = 30/141 (21%), Positives = 59/141 (41%), Gaps = 32/141 (22%) Query: 386 VTIMGHVDHGKTSLLDA-IRKADVAKGEIGGITQHIGA-------------------YQV 425 ++++ HVDHGK++L D+ ++KA + G T+ +++ Sbjct: 22 MSVIAHVDHGKSTLTDSLVQKAGIISAAKAGETRFTDTRKDEQERGITIKSTAISLFFEM 81 Query: 426 ------AYQGKN------ITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIE 473 + + I +D+PGH F RVTD A++V+ + Q Sbjct: 82 SDDDLKFIKQEGDGNGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTET 141 Query: 474 SINHAKAADVSIIVAINKIDK 494 + A A + ++ +NK+D+ Sbjct: 142 VLRQAIAERIKPVLVMNKMDR 162 >gnl|CDD|35687 KOG0466, KOG0466, KOG0466, Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis]. Length = 466 Score = 39.5 bits (92), Expect = 0.004 Identities = 34/121 (28%), Positives = 60/121 (49%), Gaps = 17/121 (14%) Query: 430 KNITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEI-MPQAIESINHAKAADV----S 484 ++++F+D PGH GA V D A+L++A +E PQ E H A ++ Sbjct: 125 RHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSE---HLAAVEIMKLKH 181 Query: 485 IIVAINKIDKLGADPQKVRMSLLKHDVFVESMGGDILD----VEISAKNNLNLDKLLDAI 540 II+ NKID + K +L +H+ + + G + + + ISA+ N+D + + I Sbjct: 182 IIILQNKIDLI-----KESQALEQHEQIQKFIQGTVAEGAPIIPISAQLKYNIDVVCEYI 236 Query: 541 L 541 + Sbjct: 237 V 237 >gnl|CDD|133366 cd04166, CysN_ATPS, CysN_ATPS subfamily. CysN, together with protein CysD, form the ATP sulfurylase (ATPS) complex in some bacteria and lower eukaryotes. ATPS catalyzes the production of ATP sulfurylase (APS) and pyrophosphate (PPi) from ATP and sulfate. CysD, which catalyzes ATP hydrolysis, is a member of the ATP pyrophosphatase (ATP PPase) family. CysN hydrolysis of GTP is required for CysD hydrolysis of ATP; however, CysN hydrolysis of GTP is not dependent on CysD hydrolysis of ATP. CysN is an example of lateral gene transfer followed by acquisition of new function. In many organisms, an ATPS exists which is not GTP-dependent and shares no sequence or structural similarity to CysN. Length = 208 Score = 38.6 bits (91), Expect = 0.007 Identities = 34/153 (22%), Positives = 55/153 (35%), Gaps = 56/153 (36%) Query: 390 GHVDHGKTSL---------------LDAI--RKADVAKGEIG--------------GITQ 418 G VD GK++L L A+ + + GIT Sbjct: 6 GSVDDGKSTLIGRLLYDSKSIFEDQLAALESKSCGTGGEPLDLALLVDGLQAEREQGIT- 64 Query: 419 HIGAYQVAYQGKNITF---------LDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMP 469 I VAY F DTPGH + GA D+A+L++ A + ++ Sbjct: 65 -I---DVAY----RYFSTPKRKFIIADTPGHEQYTRNMVTGASTADLAILLVDARKGVLE 116 Query: 470 QAIESINHAKAADV----SIIVAINKIDKLGAD 498 Q + H+ + ++VA+NK+D + Sbjct: 117 Q---TRRHSYILSLLGIRHVVVAVNKMDLVDYS 146 >gnl|CDD|133359 cd04159, Arl10_like, Arl10-like subfamily. Arl9/Arl10 was identified from a human cancer-derived EST dataset. No functional information about the subfamily is available at the current time, but crystal structures of human Arl10b and Arl10c have been solved. Length = 159 Score = 38.8 bits (91), Expect = 0.007 Identities = 42/164 (25%), Positives = 63/164 (38%), Gaps = 22/164 (13%) Query: 386 VTIMGHVDHGKTSLLDAIRKADVAKGEIGGITQHIGAYQVAYQGKNITFLDTPGHAAFYE 445 +T++G + GKT+L++ I ++ I T +V + D G F Sbjct: 2 ITLVGLQNSGKTTLVNVIAGGQFSEDTIP--TVGFNMRKVTKGNVTLKVWDLGGQPRFRS 59 Query: 446 MRARGARVTDIAVLVL-AADEEIMPQAIES----INHAKAADVSIIVAINKIDKLGADPQ 500 M R R + V V+ AAD + A + + ++V NK D GA Sbjct: 60 MWERYCRGVNAIVYVVDAADRTALEAAKNELHDLLEKPSLEGIPLLVLGNKNDLPGA--- 116 Query: 501 KVRMSLLKHDVFVESMG-GDILDVE-----ISAKNNLNLDKLLD 538 L D +E M I D E IS K N+D +LD Sbjct: 117 ------LSVDELIEQMNLKSITDREVSCYSISCKEKTNIDIVLD 154 >gnl|CDD|133364 cd04164, trmE, TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes. It controls modification of the uridine at the wobble position (U34) of tRNAs that read codons ending with A or G in the mixed codon family boxes. TrmE contains a GTPase domain that forms a canonical Ras-like fold. It functions a molecular switch GTPase, and apparently uses a conformational change associated with GTP hydrolysis to promote the tRNA modification reaction, in which the conserved cysteine in the C-terminal domain is thought to function as a catalytic residue. In bacteria that are able to survive in extremely low pH conditions, TrmE regulates glutamate-dependent acid resistance. Length = 157 Score = 38.6 bits (91), Expect = 0.008 Identities = 21/87 (24%), Positives = 32/87 (36%), Gaps = 15/87 (17%) Query: 455 DIAVLVLAADEEIMPQAIESINHAKAADVSIIVAINKIDKLGADPQKVRMSLLKHDVFVE 514 D+ + V+ D + AD IIV +NK D L ++ Sbjct: 82 DLVLFVI--DASRGLDEEDLEILELPADKPIIVVLNKSDLLPDSELLSLLAGKPI----- 134 Query: 515 SMGGDILDVEISAKNNLNLDKLLDAIL 541 + ISAK LD+L +A+L Sbjct: 135 --------IAISAKTGEGLDELKEALL 153 >gnl|CDD|35298 KOG0075, KOG0075, KOG0075, GTP-binding ADP-ribosylation factor-like protein [General function prediction only]. Length = 186 Score = 38.4 bits (89), Expect = 0.009 Identities = 43/173 (24%), Positives = 69/173 (39%), Gaps = 22/173 (12%) Query: 386 VTIMGHVDHGKTSLLDAIRKADVAKGEIGGITQHIGAYQVAYQGKNITFLDTPGHAAFYE 445 ++++G + GKT+L++ I + E T +V I D G F Sbjct: 23 LSLVGLQNSGKTTLVNVIARGQYL--EDMIPTVGFNMRKVTKGNVTIKLWDLGGQPRFRS 80 Query: 446 MRARGARVTDIAVLVL-AADEEIMPQAIESIN----HAKAADVSIIVAINKIDKLGADPQ 500 M R R V V+ AAD + + + ++ + ++V NKID GA Sbjct: 81 MWERYCRGVSAIVYVVDAADPDKLEASRSELHDLLDKPSLTGIPLLVLGNKIDLPGA--- 137 Query: 501 KVRMSLLKHDVFVESMG-GDILDVE-----ISAKNNLNLDKLLDAILLQAEML 547 L +E MG I D E IS K +N+D LD ++ ++ L Sbjct: 138 ------LSKIALIERMGLSSITDREVCCFSISCKEKVNIDITLDWLIEHSKSL 184 >gnl|CDD|30719 COG0370, FeoB, Fe2+ transport system protein B [Inorganic ion transport and metabolism]. Length = 653 Score = 37.9 bits (88), Expect = 0.013 Identities = 40/171 (23%), Positives = 75/171 (43%), Gaps = 19/171 (11%) Query: 384 PVVTIMGHVDHGKTSLLDAIRKADVAKGEIGGITQHIGAYQVAYQGKNITFLDTPGHAAF 443 V ++G+ + GKT+L +A+ A+ G G+T ++ Y+G I +D PG Sbjct: 4 LTVALVGNPNVGKTTLFNALTGANQKVGNWPGVTVEKKEGKLKYKGHEIEIVDLPG---T 60 Query: 444 YEMRARGA--RVT-------DIAVLVLAADEEIMPQAIESINHAKAADVSIIVAINKIDK 494 Y + A +V ++V D + + + + +I+A+N ID+ Sbjct: 61 YSLTAYSEDEKVARDFLLEGKPDLIVNVVDATNLERNLYLTLQLLELGIPMILALNMIDE 120 Query: 495 LGADPQKVRMSLLKHDVFVESMGGDILDVEISAKNNLNLDKLLDAILLQAE 545 A + +R+ + K + +G + V AK L++L AI+ AE Sbjct: 121 --AKKRGIRIDIEK---LSKLLGVPV--VPTVAKRGEGLEELKRAIIELAE 164 >gnl|CDD|33396 COG3596, COG3596, Predicted GTPase [General function prediction only]. Length = 296 Score = 37.6 bits (87), Expect = 0.016 Identities = 25/138 (18%), Positives = 54/138 (39%), Gaps = 10/138 (7%) Query: 368 GIFDVADSESDLDIRPPVVTIMGHVDHGKTSLLDAIRKADVAKGEIGGITQHIGAYQVAY 427 I + + P V +MG GK+SL++A+ + +V + G+ I Sbjct: 24 RILEQLRMLQLTEKEPVNVLLMGATGAGKSSLINALFQGEVKEVSKVGVGTDITTRLRLS 83 Query: 428 Q-GKNITFLDTPGHAAFYEMRARGARV-------TDIAVLVLAADEEIMPQAIESINH-- 477 G+N+ DTPG + A ++ D+ + ++ AD+ + + + Sbjct: 84 YDGENLVLWDTPGLGDGKDKDAEHRQLYRDYLPKLDLVLWLIKADDRALGTDEDFLRDVI 143 Query: 478 AKAADVSIIVAINKIDKL 495 D ++ + + D+ Sbjct: 144 ILGLDKRVLFVVTQADRA 161 >gnl|CDD|57926 cd01855, YqeH, YqeH. YqeH is an essential GTP-binding protein. Depletion of YqeH induces an excess initiation of DNA replication, suggesting that it negatively controls initiation of chromosome replication. The YqeH subfamily is common in eukaryotes and sporadically present in bacteria with probable acquisition by plants from chloroplasts. Proteins of the YqeH family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases.. Length = 190 Score = 36.8 bits (85), Expect = 0.025 Identities = 18/68 (26%), Positives = 34/68 (50%), Gaps = 7/68 (10%) Query: 477 HAKAADVSIIVAINKIDKLGADPQKVRMSLLKHDVFVES---MGGDILDVE-ISAKNNLN 532 + +I+ NKID L P+ + +K+ + ++ +G DV ISAK Sbjct: 56 RLFGGNNPVILVGNKIDLL---PKDKNLVRIKNWLRAKAAAGLGLKPKDVILISAKKGWG 112 Query: 533 LDKLLDAI 540 +++L++AI Sbjct: 113 VEELINAI 120 >gnl|CDD|35615 KOG0394, KOG0394, KOG0394, Ras-related GTPase [General function prediction only]. Length = 210 Score = 36.9 bits (85), Expect = 0.025 Identities = 43/173 (24%), Positives = 68/173 (39%), Gaps = 21/173 (12%) Query: 386 VTIMGHVDHGKTSLLDAI---RKADVAKGEIGGITQHIGAYQVAYQGKNITFLDTPGHAA 442 V I+G GKTSL++ + + K IG QV + + DT G Sbjct: 12 VIILGDSGVGKTSLMNQYVNKKFSQQYKATIGADFLT-KEVQVDDRSVTLQIWDTAGQER 70 Query: 443 FYEMRARGARVTDIAVLVLAADEEIMPQAIESINH-----AKAADVS------IIVAINK 491 F + R D VLV + P++ E++ + A ++ NK Sbjct: 71 FQSLGVAFYRGADCCVLVYDVNN---PKSFENLENWRKEFLIQASPQDPETFPFVILGNK 127 Query: 492 IDKLGADPQKVRMSLLKHDVFVESMGGDILDVEISAKNNLNLDKLLDAILLQA 544 ID G ++V K + +S G +I E SAK N+D+ + I +A Sbjct: 128 IDVDGGKSRQVSEK--KAQTWCKSKG-NIPYFETSAKEATNVDEAFEEIARRA 177 >gnl|CDD|57927 cd01856, YlqF, YlqF. Proteins of the YlqF family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases. The YlqF subfamily is represented in a phylogenetically diverse array of bacteria (including gram-positive bacteria, proteobacteria, Synechocystis, Borrelia, and Thermotoga) and in all eukaryotes.. Length = 171 Score = 36.7 bits (85), Expect = 0.026 Identities = 24/87 (27%), Positives = 42/87 (48%), Gaps = 4/87 (4%) Query: 354 GNTVKRVLESDIEVGIFDVADSESDLDIRPPVVTIMGHVDHGKTSLLDAIRKADVAK-GE 412 G VK++L++ ++ L R ++G + GK++L++ +R VAK G Sbjct: 86 GKGVKKLLKAAKKLLKDIEKLKAKGLLPRGIRAMVVGIPNVGKSTLINRLRGKKVAKVGN 145 Query: 413 IGGITQHIGAYQVAYQGKNITFLDTPG 439 G+T+ I ++ I LDTPG Sbjct: 146 KPGVTKGIQWIKI---SPGIYLLDTPG 169 >gnl|CDD|36358 KOG1143, KOG1143, KOG1143, Predicted translation elongation factor [Translation, ribosomal structure and biogenesis]. Length = 591 Score = 36.5 bits (84), Expect = 0.036 Identities = 35/166 (21%), Positives = 68/166 (40%), Gaps = 40/166 (24%) Query: 365 IEVGIFDVADSESDLDIRPPVVTIMGHVDHGKTSLLDAIRKADV---------------- 408 +EV + V DS+ +++R V ++G D GK++LL + + ++ Sbjct: 152 VEVLVRKVPDSQQFIEVR---VAVLGGCDVGKSTLLGVLTQGELDNGNGRARLNIFRHPH 208 Query: 409 ------------------AKGEIGGITQHIGAYQVAYQG-KNITFLDTPGHAAFYEMRAR 449 +G++ Q++ A ++ + K +TF+D GHA + + Sbjct: 209 EIQSGRTSSISNEVLGFDNRGKVVNYAQNMTAEEIVEKSSKLVTFIDLAGHAKYQKTTIH 268 Query: 450 G--ARVTDIAVLVLAADEEIMPQAIESINHAKAADVSIIVAINKID 493 G A LV++AD I E + A ++ V + K+D Sbjct: 269 GLTGYTPHFACLVVSADRGITWTTREHLGLIAALNIPFFVLVTKMD 314 Score = 28.8 bits (64), Expect = 6.8 Identities = 22/102 (21%), Positives = 44/102 (43%), Gaps = 4/102 (3%) Query: 767 YDLLDSIKDSMSELLSPEIRETFLGNA---EVLEVFAVTKLGNVAGCKVSEGKVERGSGV 823 LL + + +S + E R + +V E++ V +G V G +SEG++ G+ V Sbjct: 376 LRLLRTFLNCLSPAGTAEERIQLVQLPAEFQVDEIYNVPHVGQVVGGMLSEGQLHEGADV 435 Query: 824 RL-IRNSTVIYEGKLKTLKRFKDEVSEVHAGQDCGMAFEKYD 864 + + + +++R + V AGQ ++ D Sbjct: 436 LVGPMKDGTFEKITVGSIRRNRQACRVVRAGQAASLSLNDPD 477 >gnl|CDD|36405 KOG1191, KOG1191, KOG1191, Mitochondrial GTPase [Translation, ribosomal structure and biogenesis]. Length = 531 Score = 35.3 bits (81), Expect = 0.071 Identities = 45/223 (20%), Positives = 80/223 (35%), Gaps = 28/223 (12%) Query: 343 ADLSEIIANEFGNTVKRVLESDIEVGIFDVADSESDLDIRPPVVTIMGHVDHGKTSLLDA 402 + + E L +V E + + I+G + GK+SLL+A Sbjct: 228 EEERPLEEIETVEIFIESLSLLDDVLSHLNKADEIERLQSGLQIAIVGRPNVGKSSLLNA 287 Query: 403 IRKADVA-KGEIGGITQHIGAYQVAYQGKNITFLDTPG--------HAAFYEMRAR-GAR 452 + + D + + G T+ QV G + DT G A RAR Sbjct: 288 LSREDRSIVSPVPGTTRDAIEAQVTVNGVPVRLSDTAGIREESNDGIEALGIERARKRIE 347 Query: 453 VTDIAVLVLAADEEIMPQAIE------------SINHAKAADVSIIVAINKIDKLGADPQ 500 D+ +LV+ A+E ++ + K II+ NK D + P+ Sbjct: 348 RADVILLVVDAEESDTESDLKIARILETEGVGLVVIVNKMEKQRIILVANKSDLVSKIPE 407 Query: 501 KVRMSLLKHDVFVESMGGDILD--VEISAKNNLNLDKLLDAIL 541 ++ + V+ + G + VE+S ++L A+L Sbjct: 408 MTKIPV----VYPSAEGRSVFPIVVEVSCTTKEGCERLSTALL 446 >gnl|CDD|35313 KOG0090, KOG0090, KOG0090, Signal recognition particle receptor, beta subunit (small G protein superfamily) [Intracellular trafficking, secretion, and vesicular transport]. Length = 238 Score = 34.9 bits (80), Expect = 0.093 Identities = 35/182 (19%), Positives = 60/182 (32%), Gaps = 17/182 (9%) Query: 383 PPVVTIMGHVDHGKTSLLDAIRKADVAKGEIGGITQHIGAYQVAYQGKNITFLDTPGHAA 442 V ++G D GKTSL + +G + I + Y+ +N+T +D PGH+ Sbjct: 38 QNAVLLVGLSDSGKTSLFTQLITGSH-RGTVTSIEPNEATYR--LGSENVTLVDLPGHSR 94 Query: 443 ----FYEMRARGARVTDIAVLV--LAADEEIMPQA-----IESINHAKAADVSIIVAINK 491 E I +V + + A I + K +++A NK Sbjct: 95 LRRKLLEYLKHNYSAKAIVFVVDSATFLKNVRDVAEFLYDILLDSRVKKNKPPVLIACNK 154 Query: 492 IDKLGADPQKVRMSLLK---HDVFVESMGGDILDVEISAKNNLNLDKLLDAILLQAEMLD 548 D A + L+ H + + E AK+ + D E Sbjct: 155 QDLFTAKTAEKIRQQLEKEIHKLRESRSALRSISDEDIAKDFTLGKEGEDFKFSHLEDQK 214 Query: 549 LK 550 + Sbjct: 215 VT 216 >gnl|CDD|133254 cd00878, Arf_Arl, Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases. Arf proteins are activators of phospholipase D isoforms. Unlike Ras proteins they lack cysteine residues at their C-termini and therefore are unlikely to be prenylated. Arfs are N-terminally myristoylated. Members of the Arf family are regulators of vesicle formation in intracellular traffic that interact reversibly with membranes of the secretory and endocytic compartments in a GTP-dependent manner. They depart from other small GTP-binding proteins by a unique structural device, interswitch toggle, that implements front-back communication from N-terminus to the nucleotide binding site. Arf-like (Arl) proteins are close relatives of the Arf, but only Arl1 has been shown to function in membrane traffic like the Arf proteins. Arl2 has an unrelated function in the folding of native tubulin, and Arl4 may function in the nucleus. Most other Arf family proteins are so far relatively poorly characterized. Thus, despite their significant sequence homologies, Arf family proteins may regulate unrelated functions. Length = 158 Score = 34.9 bits (81), Expect = 0.11 Identities = 31/155 (20%), Positives = 55/155 (35%), Gaps = 23/155 (14%) Query: 395 GKTSLLDAIRKADVAKGEIGGITQHIGAYQVAYQGKNITFLDTPGHAAFYEMRARGARVT 454 GKT++L ++ +V T V Y+ + T D G + T Sbjct: 11 GKTTILYKLKLGEVVTTIP---TIGFNVETVEYKNVSFTVWDVGGQDKIRPLWKHYYENT 67 Query: 455 DIAVLVL-AADEEIMPQAIESI----NHAKAADVSIIVAINKIDKLGADPQKV------R 503 + + V+ ++D E + +A E + N + V +++ NK D GA Sbjct: 68 NGIIFVVDSSDRERIEEAKEELHKLLNEEELKGVPLLIFANKQDLPGALSVSELIEKLGL 127 Query: 504 MSLLKHDVFVESMGGDILDVEISAKNNLNLDKLLD 538 +L ++ SA LD+ LD Sbjct: 128 EKILGRRWHIQP---------CSAVTGDGLDEGLD 153 >gnl|CDD|133343 cd04143, Rhes_like, Rhes_like subfamily. This subfamily includes Rhes (Ras homolog enriched in striatum) and Dexras1/AGS1 (activator of G-protein signaling 1). These proteins are homologous, but exhibit significant differences in tissue distribution and subcellular localization. Rhes is found primarily in the striatum of the brain, but is also expressed in other areas of the brain, such as the cerebral cortex, hippocampus, inferior colliculus, and cerebellum. Rhes expression is controlled by thyroid hormones. In rat PC12 cells, Rhes is farnesylated and localizes to the plasma membrane. Rhes binds and activates PI3K, and plays a role in coupling serpentine membrane receptors with heterotrimeric G-protein signaling. Rhes has recently been shown to be reduced under conditions of dopamine supersensitivity and may play a role in determining dopamine receptor sensitivity. Dexras1/AGS1 is a dexamethasone-induced Ras protein that is expressed primarily in the brain, with low expression levels in other tissues. Dexras1 localizes primarily to the cytoplasm, and is a critical regulator of the circadian master clock to photic and nonphotic input. Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Ras proteins. Length = 247 Score = 34.7 bits (80), Expect = 0.12 Identities = 35/130 (26%), Positives = 58/130 (44%), Gaps = 25/130 (19%) Query: 426 AYQGKNITFLDTPGHAAFYEMRARGARVTDIAVLVLAAD------------EEIMPQAIE 473 YQ + LDT G+ F MR D+ +LV + D E+I+ Sbjct: 47 VYQ---LDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRESFEEVCRLREQILETKSC 103 Query: 474 SINHAK-AADVSIIVAINKIDKLGADPQKVRMSLLKHDVFVESMGGDILDV--EISAKNN 530 N K + +++ NK D+ P++V+ + +V + +GGD E+SAK N Sbjct: 104 LKNKTKENVKIPMVICGNKADR--DFPREVQ----RDEV-EQLVGGDENCAYFEVSAKKN 156 Query: 531 LNLDKLLDAI 540 NLD++ A+ Sbjct: 157 SNLDEMFRAL 166 >gnl|CDD|133298 cd01898, Obg, Obg subfamily. The Obg nucleotide binding protein subfamily has been implicated in stress response, chromosome partitioning, replication initiation, mycelium development, and sporulation. Obg proteins are among a large group of GTP binding proteins conserved from bacteria to humans. The E. coli homolog, ObgE is believed to function in ribosomal biogenesis. Members of the subfamily contain two equally and highly conserved domains, a C-terminal GTP binding domain and an N-terminal glycine-rich domain. Length = 170 Score = 34.7 bits (81), Expect = 0.13 Identities = 40/176 (22%), Positives = 68/176 (38%), Gaps = 49/176 (27%) Query: 395 GKTSLLDAIRKADVAKGEIGG-----ITQHIGAYQVAYQGKNITFLDTPG---------- 439 GK++LL AI A K +I + ++G +V G++ D PG Sbjct: 12 GKSTLLSAISNA---KPKIADYPFTTLVPNLGVVRV-DDGRSFVVADIPGLIEGASEGKG 67 Query: 440 -------HAAFYEMRARGARVTDIAVLV-LAADEEIMPQAIESINH------AKAADVSI 485 H R R + ++ L+ D++ + + ++I + + + Sbjct: 68 LGHRFLRHIE----RTRL-----LLHVIDLSGDDDPV-EDYKTIRNELELYNPELLEKPR 117 Query: 486 IVAINKIDKLGADPQKVRMSLLKHDVFVESMGGDILDVEISAKNNLNLDKLLDAIL 541 IV +NKID L + LLK + E G + ISA LD+LL + Sbjct: 118 IVVLNKIDLLDEEE---LFELLKELLK-ELWGKPV--FPISALTGEGLDELLRKLA 167 >gnl|CDD|35385 KOG0163, KOG0163, KOG0163, Myosin class VI heavy chain [Cytoskeleton]. Length = 1259 Score = 33.5 bits (76), Expect = 0.24 Identities = 29/153 (18%), Positives = 61/153 (39%), Gaps = 1/153 (0%) Query: 116 EIESRRRALHEAQVREEELRKRLEQQSLEQPSQESSIDLPEVCDSQQVPEQVLEDPCKEK 175 E E +RR E + REEE +KR + + + E + + +++ ++ E KE Sbjct: 934 EAERKRREAEEKRRREEEEKKRAKAEMETKRKAEEEQRKAQEEEERRLALELQEQLAKEA 993 Query: 176 DLEIKDVDVGTEVESSVILSHDMGDSDSSSVVNNKFRESSSDASSNRGKSRGGAGKYASV 235 + E K + + L+ + +SD V ++ + ++ + +V Sbjct: 994 EEEAKRQNQLEQERRDHELALRLANSDGGQVEDSPPVIRALVNDASPMGPNKMLIRSENV 1053 Query: 236 NSSKPVTRNKVGDDDK-KYKKVRIAVAADVDEE 267 + + + D K KY ++R + D E Sbjct: 1054 RAQQAALGKQKYDLSKWKYAELRDTINTSCDIE 1086 >gnl|CDD|34868 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]. Length = 4600 Score = 33.5 bits (76), Expect = 0.26 Identities = 53/313 (16%), Positives = 111/313 (35%), Gaps = 32/313 (10%) Query: 78 SSQDLSQAKAKGNFRRASRSDKVSSQKNDSSFAGLSQGEIESRRRALHEAQVREEELRKR 137 + +DL + + K N + A+ ++ K D + A + E V ++ + Sbjct: 3912 NEEDLLETEQKSNEQSAANNESDLVSKEDDNKALEDKDRQEKEDEEEMSDDVGIDDEIQP 3971 Query: 138 LEQQSLEQPSQE-SSIDLPEVCDSQQVPEQVLEDPCKEKDLEIKDVDVGTE--------- 187 Q++ QP E +DLPE + V +D DLE D++ E Sbjct: 3972 DIQENNSQPPPENEDLDLPEDLKLDEKEGDVSKD----SDLEDMDMEAADENKEEADAEK 4027 Query: 188 ---------VESSVILSHDMGDSDSSSVVNNKFRES----SSDASSNRGKSRGGAGKYAS 234 +E + L D+ D S + + + + + N + G Sbjct: 4028 DEPMQDEDPLEENNTLDEDIQQDDFSDLAEDDEKMNEDGFEENVQENEESTEDGVKSDEE 4087 Query: 235 VNSSKPVTRNKVGDDDKKYKKVRIAVAADVDEEGGASRGRSLSAMRRRQEKFRRN-QQQE 293 + + V ++ D+ K +A+ DEE + ++ R N Sbjct: 4088 LEQGE-VPEDQAIDNHPKMDAKSTFASAEADEENTDKGIVGENEELGEEDGVRGNGTADG 4146 Query: 294 KREKISREIVVPETITIQELSQRMSERSADVIKFLMKEGQIMKPGDVIDADLSEIIANEF 353 + E++ + P+ + R + D ++ + +I + D+ ++ +EF Sbjct: 4147 EFEQVQEDTSTPK--EAMSEADRQYQSLGDHLREWQQANRIHEWEDLTESQSQAFDDSEF 4204 Query: 354 GNTVKRVLESDIE 366 + VK E D++ Sbjct: 4205 MH-VKEDEEEDLQ 4216 >gnl|CDD|35300 KOG0077, KOG0077, KOG0077, Vesicle coat complex COPII, GTPase subunit SAR1 [Intracellular trafficking, secretion, and vesicular transport]. Length = 193 Score = 33.4 bits (76), Expect = 0.31 Identities = 27/112 (24%), Positives = 45/112 (40%), Gaps = 16/112 (14%) Query: 395 GKTSLLDAIRKADVAKGEIGGITQHIGAYQVAYQGKNITFLDTPGHAAFYEMRARGAR-- 452 GKT+LL ++ + + T H + +++ G T D GH R + Sbjct: 32 GKTTLLHMLKDDRLGQHVP---TLHPTSEELSIGGMTFTTFDLGGHLQ----ARRVWKDY 84 Query: 453 ---VTDIAVLVLAADEEIMPQAIES----INHAKAADVSIIVAINKIDKLGA 497 V I LV A D+E ++ + ++ A V ++ NKID A Sbjct: 85 FPQVDAIVYLVDAYDQERFAESKKELDALLSDESLATVPFLILGNKIDIPYA 136 >gnl|CDD|146992 pfam04615, Utp14, Utp14 protein. This protein is found to be part of a large ribonucleoprotein complex containing the U3 snoRNA. Depletion of the Utp proteins impedes production of the 18S rRNA, indicating that they are part of the active pre-rRNA processing complex. This large RNP complex has been termed the small subunit (SSU) processome. Length = 731 Score = 33.1 bits (76), Expect = 0.32 Identities = 37/193 (19%), Positives = 73/193 (37%), Gaps = 16/193 (8%) Query: 121 RRALHEAQVREEELRKRLEQQSLEQPSQESSIDLPEVCDSQQVPEQVLEDPCKEKDLEIK 180 R AL E + EELR+++E +S+ + ++ D E + + E+P + K Sbjct: 305 RAALEEQLRQGEELRRKIEGKSVSEEDEDEDSDSEEEDEDDDEDDDDGENPWMLRKKLGK 364 Query: 181 DVDVGTEVESSVILSHD-MGDSDSSSVVNNK------------FRESSSDASSNRGKSRG 227 + + E+S +LS M +++ N + + K Sbjct: 365 LKEGEDDEENSGLLSMKFMQRAEARRKEENDAEIEELRRELEGEESGDEEENEEPEKKNV 424 Query: 228 GAGKYASVNSSKPV---TRNKVGDDDKKYKKVRIAVAADVDEEGGASRGRSLSAMRRRQE 284 G K+ N K K ++ K KK DEE + + +R E Sbjct: 425 GRRKFGPENLEKEAESKKLKKENKNEFKEKKSSDEEEELEDEEEDKVKEVVNKLLLKRSE 484 Query: 285 KFRRNQQQEKREK 297 K ++ +++E+ ++ Sbjct: 485 KAQKEEEEEELDE 497 >gnl|CDD|37213 KOG2002, KOG2002, KOG2002, TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism]. Length = 1018 Score = 33.0 bits (75), Expect = 0.41 Identities = 49/231 (21%), Positives = 83/231 (35%), Gaps = 33/231 (14%) Query: 61 KVSVFRKSSRVIESSSDSSQDL-SQAKAKGNFRRASRSD-KVSSQKNDSSFAGLSQGEI- 117 K R S VI + +DL QA +A D + K + L + E+ Sbjct: 797 KNGDKRISKTVIAQEAQLCKDLLKQALEHV--AQAQEEDEEERRAKQEKEEEALIEKELE 854 Query: 118 ESRRRALHEAQVREEELRKRLEQQSLEQPSQESSIDLPEV------------CDSQQVPE 165 E+RR+ E RE+ ++R E + + ++ E DS E Sbjct: 855 EARRKEEEEKARREKLEKQREEYRERTK-EILKLPEIEEEKKKSGGGGRKRGDDSDSDGE 913 Query: 166 QVLEDPCKEKDL-------EIKDVDVGTEVESSVILSHDMGDSDSSSVVNNKFRESSSDA 218 + K+KD + + +E + S + S ++ +++ SD+ Sbjct: 914 RKKGGKRKKKDKKKRKRKPKKDSKEKLSESDRRKPKSKAFISTSERS-DDDVVKKAESDS 972 Query: 219 SSNRGKSRGGAGKYASVNSSKPVTRNKVGDDDKKYKKVRIAVAADVDEEGG 269 + SR AS S +P+ + D D+ KK R D DEE Sbjct: 973 DDDSQDSRE-----ASEESDRPIESD--SDSDETSKKDRNKELNDSDEESE 1016 >gnl|CDD|35616 KOG0395, KOG0395, KOG0395, Ras-related GTPase [General function prediction only]. Length = 196 Score = 32.7 bits (74), Expect = 0.48 Identities = 41/142 (28%), Positives = 54/142 (38%), Gaps = 20/142 (14%) Query: 434 FLDTPGHAAFYEMRARGARVTDIAVLVLAADE----EIMPQAIESINHAKAAD-VSIIVA 488 LDT G F MR R D +LV + + E Q E I K D V II+ Sbjct: 55 ILDTAGQEEFSAMRDLYIRNGDGFLLVYSITDRSSFEEAKQLREQILRVKGRDDVPIILV 114 Query: 489 INKIDKLGADPQKVRMSLLKHDVFVESMGGDILDVEISAKNNLNLDKLLDAILLQAEMLD 548 NK D ++V K S G +E SAK N N+D++ + Sbjct: 115 GNKCD--LERERQVSEEEGKA--LARSWG--CAFIETSAKLNYNVDEVFY---------E 159 Query: 549 LKTSINRKAEGIVVEGKLDRGR 570 L I EG + KL G+ Sbjct: 160 LVREIRLPREGSLKGRKLSSGK 181 >gnl|CDD|39860 KOG4661, KOG4661, KOG4661, Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription]. Length = 940 Score = 32.5 bits (73), Expect = 0.56 Identities = 26/101 (25%), Positives = 49/101 (48%), Gaps = 1/101 (0%) Query: 49 TRKRRSYVQGEEKVSVFRKSSRVIESSSDSSQDLSQAKAKGNFRRASRSDKVSSQKNDSS 108 +R +S +G+E+ V KS S +SQD + ++K R++ +K + D Sbjct: 555 SRSTKSGSRGKERTVVMDKSKGDPVISVKTSQDSKERRSKSQDRKSRSREKRRERSFDKR 614 Query: 109 FAGLSQGEIESRRRALHEAQVREEELRKRLEQQSLEQPSQE 149 + E E R+R + E + RE+ + +E++ LE+ E Sbjct: 615 KEERRRREAEERQR-IREEREREQRRKAAVEREELERLKAE 654 >gnl|CDD|37709 KOG2498, KOG2498, KOG2498, IK cytokine down-regulator of HLA class II [Signal transduction mechanisms]. Length = 544 Score = 32.3 bits (73), Expect = 0.57 Identities = 36/242 (14%), Positives = 77/242 (31%), Gaps = 24/242 (9%) Query: 49 TRKRRSYVQGEEKVSVFRKSSRVIESSSDSSQDLSQAKAKGNFRRASRSDKVSSQKNDSS 108 R Y + E+K + R+ + + + +A +R + + K D Sbjct: 47 HEMPREYKEDEDKAARSREKKKALYGKLKKQHIEKEDEAALKYRDRAAERRDGVNK-DYE 105 Query: 109 FAGLSQGEIESRRRALHEAQVREEELRKRLEQQSLEQPSQESSIDLPEVCDSQQVPEQVL 168 L E + R++L Q+S L + D + + Sbjct: 106 ETELPSTAQYRAVGPDAEKDKDQAIKRRQLIQESKFLGGDMEHTHLVKGLDYALLQKVRS 165 Query: 169 EDPCKEKDLEIKDVDVGTEVESSVILSHDMGDSDSSSVVNNKFRESSSDASSNRGKSRGG 228 E K+ + E + ++ + + S D + + R S + R Sbjct: 166 EIAAKDDEEE-ELMEKPVDEKKS--------AEDPEEKIEAELRLGESGKVLKKKLGRNV 216 Query: 229 AGKYASVNSSKPVTRNKVGDDDKKYKKVRIAVAADVDEEGGASR-----GRSLSAMRRRQ 283 + +NK + ++ + R+A +D+E + GRS + +Q Sbjct: 217 YRV---------LFKNKEDERNELFAPGRMAYVVILDDEVLETDIPTTLGRSKLDLPTKQ 267 Query: 284 EK 285 E+ Sbjct: 268 EE 269 >gnl|CDD|35900 KOG0681, KOG0681, KOG0681, Actin-related protein - Arp5p [Cytoskeleton]. Length = 645 Score = 32.3 bits (73), Expect = 0.57 Identities = 18/58 (31%), Positives = 28/58 (48%) Query: 118 ESRRRALHEAQVREEELRKRLEQQSLEQPSQESSIDLPEVCDSQQVPEQVLEDPCKEK 175 +R A+ E ++LE + Q QES++DL + VP ++ ED KEK Sbjct: 293 ALKRVEKINARENRREDEQQLESYNKAQGEQESNLDLEQKFPLLNVPAELDEDQLKEK 350 >gnl|CDD|31281 COG1084, COG1084, Predicted GTPase [General function prediction only]. Length = 346 Score = 32.2 bits (73), Expect = 0.60 Identities = 15/62 (24%), Positives = 25/62 (40%) Query: 378 DLDIRPPVVTIMGHVDHGKTSLLDAIRKADVAKGEIGGITQHIGAYQVAYQGKNITFLDT 437 +D P + + G+ + GK+SL+ + A T+ I I +DT Sbjct: 163 AIDPDLPTIVVAGYPNVGKSSLVRKLTTAKPEVAPYPFTTKGIHVGHFERGYLRIQVIDT 222 Query: 438 PG 439 PG Sbjct: 223 PG 224 >gnl|CDD|133296 cd01896, DRG, The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins. GTPases act as molecular switches regulating diverse cellular processes. DRG2 and DRG1 comprise the DRG subfamily in eukaryotes. In view of their widespread expression in various tissues and high conservation among distantly related species in eukaryotes and archaea, DRG proteins may regulate fundamental cellular processes. It is proposed that the DRG subfamily proteins play their physiological roles through RNA binding. Length = 233 Score = 32.1 bits (74), Expect = 0.61 Identities = 16/64 (25%), Positives = 24/64 (37%), Gaps = 16/64 (25%) Query: 486 IVAINKIDKLGADPQKVRMSLLKHDVFVESMGGDILDVEISAKNNLNLDKLLDAILLQAE 545 + NKID + + + V ISA+ LNLD+L + I + Sbjct: 180 LYVYNKIDLISIEELDLLARQPNS-------------VVISAEKGLNLDELKERIW---D 223 Query: 546 MLDL 549 L L Sbjct: 224 KLGL 227 >gnl|CDD|36247 KOG1029, KOG1029, KOG1029, Endocytic adaptor protein intersectin [Signal transduction mechanisms, Intracellular trafficking, secretion, and vesicular transport]. Length = 1118 Score = 32.0 bits (72), Expect = 0.65 Identities = 15/36 (41%), Positives = 23/36 (63%) Query: 114 QGEIESRRRALHEAQVREEELRKRLEQQSLEQPSQE 149 Q E+E RR+AL E Q RE E ++ E++ E+ +E Sbjct: 326 QAELERRRQALEEQQQREREEVEQKEREEEEKKERE 361 >gnl|CDD|48380 cd03116, MobB, Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes. In E. coli, the synthesis of Moco involves genes from several loci: moa, mob, mod, moe and mog. The mob locus contains mobA and mobB genes. MobB catalyzes the attachment of the guanine dinucleotide to molybdopterin.. Length = 159 Score = 32.1 bits (73), Expect = 0.68 Identities = 19/75 (25%), Positives = 33/75 (44%), Gaps = 10/75 (13%) Query: 383 PPVVTIMGHVDHGKTSLLDAIRKADVAKGEIGGITQHIGAYQVAYQGKNITFLDTPGHAA 442 V+ +G+ GKT+LL+ + A A+G + + + +I DTPG + Sbjct: 1 MKVIGFVGYSGSGKTTLLEKLIPALSARG------LRVAVIKHDHHDFDI---DTPGKDS 51 Query: 443 FYEMRARGARVTDIA 457 Y R GA ++ Sbjct: 52 -YRHREAGAEEVLVS 65 >gnl|CDD|38818 KOG3612, KOG3612, KOG3612, PHD Zn-finger protein [General function prediction only]. Length = 588 Score = 32.0 bits (72), Expect = 0.77 Identities = 51/254 (20%), Positives = 89/254 (35%), Gaps = 20/254 (7%) Query: 84 QAKAKGNFRRASRSDKVSSQKNDSSFAGLSQGEIES---RRRALHEAQVREEELRKRLEQ 140 A AK S D + Q N S F G S EI R+ + + + K Q Sbjct: 273 GAAAKYTPLTPSPMDLLDLQTNPSVFVGQSIREIRRCPLCYRSSNTLSLGDTWFTKPCLQ 332 Query: 141 QSLEQPSQESSIDLPEVCDSQQVPEQVLEDPCKEKDLEIKDVDVGTEVESSVILSHDMGD 200 + P+ ++ S P +V P +E IK S L + Sbjct: 333 RHELAPAPQAG--------SSPWPAKVPVSP-REP---IKYDVRFVGGTHSRALIEERDV 380 Query: 201 SDSSSVVNNKFRESSSDASSNRGKSRGGAGKYASVNSSKPVTRNKVGDD--DKKYKKVRI 258 + S S+ + S K + A ++ S + + K K I Sbjct: 381 TSSDSIPMSPITPRGPSVLSAAIKLTQVSKMLADLHYSTQLGGVHADPTVVEDKMKDAII 440 Query: 259 AVAADVDEEGGASRGRSLSA-MRRRQEKFRRNQQQEKREKISREIVVPETITIQELSQRM 317 + + SR RSL A + +++F QQ +RE + + + E+ + + Sbjct: 441 DLQESTLSDYSGSRERSLVAATEKLRQEFEELQQTSRRE--LPVPLRNFELEMAEMRKTL 498 Query: 318 SERSADVIKFLMKE 331 ++ A+ IK +K+ Sbjct: 499 EQKHAENIKEEIKK 512 >gnl|CDD|31356 COG1162, COG1162, Predicted GTPases [General function prediction only]. Length = 301 Score = 31.8 bits (72), Expect = 0.91 Identities = 22/95 (23%), Positives = 44/95 (46%), Gaps = 7/95 (7%) Query: 447 RARGARVTDIAVLVLAADEEIMPQAIES-INHAKAADVSIIVAINKIDKLGADPQKVRMS 505 R A ++V D + ++ + A+A + ++ +NKID L + V+ Sbjct: 74 RPPVANNDQAIIVVSLVDPDFNTNLLDRYLVLAEAGGIEPVIVLNKIDLLDDEEAAVKEL 133 Query: 506 LLKHDVFVESMGGDILDVEISAKNNLNLDKLLDAI 540 L ++ E +G +L +SAKN L++L + + Sbjct: 134 LREY----EDIGYPVL--FVSAKNGDGLEELAELL 162 >gnl|CDD|36273 KOG1055, KOG1055, KOG1055, GABA-B ion channel receptor subunit GABABR1 and related subunits, G-protein coupled receptor superfamily [Inorganic ion transport and metabolism, Amino acid transport and metabolism, Signal transduction mechanisms]. Length = 865 Score = 31.5 bits (71), Expect = 0.92 Identities = 25/144 (17%), Positives = 52/144 (36%), Gaps = 27/144 (18%) Query: 80 QDLSQAKAKGNFRRASRSDKVSSQKNDSSFAGLSQGEIESRRRALHEAQVREEELRKRLE 139 Q S+A+ +S ++ ++ L + E R+ + E + R EL+ + Sbjct: 736 QWASEAQRNMKTGPSSSVNENEEERLR-----LLKKENRRLRKKIMEKEERLSELKHQ-- 788 Query: 140 QQSLEQPSQESSIDLPEVCDSQQVPEQVLEDPCKEKDLEIKDVDVGTEVESSVIL----- 194 L+ +++ ++P +SQ P + + D+ T++ S+ L Sbjct: 789 ---LQPRPRKTITEIP--GNSQ--LRSRRHKPSPTELVVYHDITSLTDITPSLSLQRGNH 841 Query: 195 --------SHDMGDSDSSSVVNNK 210 S G S S + K Sbjct: 842 PPEPPPRDSPVDGSSVSPVGLLTK 865 >gnl|CDD|35301 KOG0078, KOG0078, KOG0078, GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins [Signal transduction mechanisms, Intracellular trafficking, secretion, and vesicular transport]. Length = 207 Score = 31.7 bits (72), Expect = 0.92 Identities = 47/190 (24%), Positives = 74/190 (38%), Gaps = 20/190 (10%) Query: 386 VTIMGHVDHGKTSLLDAIRKADVAKGEI--GGITQHIGAYQVAYQGKNITF--LDTPGHA 441 + ++G GKT LL I GI I ++ GK I DT G Sbjct: 15 LLLIGDSGVGKTCLLLRFSDDSFNTSFISTIGIDFKIKTIEL--DGKKIKLQIWDTAGQE 72 Query: 442 AFYEMRARGARVTDIAVLVL-AADE---EIMPQAIESINHAKAADVSIIVAINKIDKLGA 497 F + R +LV +E E + I++I+ + DV I+ NK D Sbjct: 73 RFRTITTAYYRGAMGILLVYDITNEKSFENIRNWIKNIDEHASDDVVKILVGNKCDL--E 130 Query: 498 DPQKVRMSLLKHDVFVESMGGDILDVEISAKNNLNLDK----LLDAILLQAEMLDLKTSI 553 + ++V + + G I E SAK N N+++ L IL + E +L+ S Sbjct: 131 EKRQVSKE--RGEALAREYG--IKFFETSAKTNFNIEEAFLSLARDILQKLEDAELEASN 186 Query: 554 NRKAEGIVVE 563 N K + + Sbjct: 187 NSKIRPLDIN 196 >gnl|CDD|39796 KOG4596, KOG4596, KOG4596, Uncharacterized conserved protein [Function unknown]. Length = 1936 Score = 31.6 bits (71), Expect = 0.93 Identities = 27/125 (21%), Positives = 44/125 (35%), Gaps = 9/125 (7%) Query: 35 QGANQGRARSVVVETRKRRSYVQGEEKVSVFRKSSRVIESSSDSSQDLSQAKAKGNFRRA 94 QG NQ + S+ E VQ + R++E D LS + + Sbjct: 1655 QGRNQ-ISSSIRREENVESREVQIRRCEQLVD---RIVEEPIDLKMALSTDICEEERIKK 1710 Query: 95 SRSDKVSSQKNDSSFAG--LSQGEIESRRRALHEAQVREEELRKRLEQQSLEQPSQESSI 152 R + S + ++ G S G I R+ + + L+Q + E SI Sbjct: 1711 DRIREKSCEAAENVKFGGKRSAGCI---RQGGGPPPKLGRFISAKDLPVPLQQQNDEDSI 1767 Query: 153 DLPEV 157 + EV Sbjct: 1768 NAEEV 1772 >gnl|CDD|39393 KOG4191, KOG4191, KOG4191, Histone acetyltransferases PCAF/SAGA/ADA, subunit TADA3L/NGG1 [Chromatin structure and dynamics]. Length = 516 Score = 30.4 bits (68), Expect = 2.1 Identities = 26/157 (16%), Positives = 53/157 (33%), Gaps = 14/157 (8%) Query: 161 QQVPEQVLEDPCKEKDLEIKDVDVGTEVESSVILSHDMGDSDSSSVVNNKFRESSSDASS 220 ++ + E P + V VE ++ S + S ES +D +S Sbjct: 306 LRLSSALHEQPEDGLPFALTQRAVQEFVEENISSSMENSPIPDMSGK-----ESGADGAS 360 Query: 221 NRGKSRGGAGKYASVNSSKPVTRNKVGDDDKKYKKVRIAVAADVDEEGGASRGRSLSAMR 280 +++ N V K + K + + + D D L+ +R Sbjct: 361 TSPRNQ---------NKPFSVPHTKSLESRLKEELIAQGLLEDEDRPASDDDDEVLAELR 411 Query: 281 RRQEKFRRNQQQEKREKISREIVVPETITIQELSQRM 317 + Q + + +++K + PE + QE Q + Sbjct: 412 KLQAELKAVSAHNRKKKHDLLRLAPEEMARQEFQQVL 448 >gnl|CDD|133005 cd02511, Beta4Glucosyltransferase, UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core. Length = 229 Score = 30.3 bits (69), Expect = 2.5 Identities = 10/36 (27%), Positives = 16/36 (44%) Query: 458 VLVLAADEEIMPQAIESINHAKAADVSIIVAINKID 493 VL L ADE + P+ + I A D + + + Sbjct: 75 VLSLDADERLTPELADEILALLATDDYDGYYVPRRN 110 >gnl|CDD|58094 cd03703, aeIF5B_II, aeIF5B_II: This family represents the domain II of archeal and eukaryotic aeIF5B. aeIF5B is a homologue of prokaryotic Initiation Factor 2 (IF2). Disruption of the eIF5B gene (FUN12) in yeast causes a severe slow-growth phenotype, associated with a defect in translation. eIF5B has a function analogous to prokaryotic IF2 in mediating the joining of joining of 60S subunits. The eIF5B consists of three N-terminal domains (I, II, II) connected by a long helix to domain IV. Domain I is a G domain, domain II and IV are beta-barrels and domain III has a novel alpha-beta-alpha sandwich fold. The G domain and the beta-barrel domain II display a similar structure and arrangement to the homologous domains of EF1A, eEF1A and aeIF2gamma.. Length = 110 Score = 30.1 bits (68), Expect = 2.7 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 4/50 (8%) Query: 557 AEGIVVEGKLDRGRGPVVTVLVQKGTLSKGNILVVGDQWG----KIRALF 602 +G V+E K + G G + V++ GTL +G+ +VV G K+RAL Sbjct: 1 LQGTVLEVKEEEGLGTTIDVILYDGTLREGDTIVVCGLNGPIVTKVRALL 50 >gnl|CDD|147703 pfam05695, DUF825, Plant protein of unknown function (DUF825). This family consists of several plant proteins greater than 1000 residues in length. The function of this family is unknown. Length = 1170 Score = 29.9 bits (67), Expect = 3.1 Identities = 12/31 (38%), Positives = 14/31 (45%) Query: 763 YKIIYDLLDSIKDSMSELLSPEIRETFLGNA 793 Y I +L + M L PE E FLGN Sbjct: 203 YSPISELFTEDEKYMINNLFPEEMERFLGNF 233 >gnl|CDD|133365 cd04165, GTPBP1_like, GTPBP1-like. Mammalian GTP binding protein 1 (GTPBP1), GTPBP2, and nematode homologs AGP-1 and CGP-1 are GTPases whose specific functions remain unknown. In mouse, GTPBP1 is expressed in macrophages, in smooth muscle cells of various tissues and in some neurons of the cerebral cortex; GTPBP2 tissue distribution appears to overlap that of GTPBP1. In human leukemia and macrophage cell lines, expression of both GTPBP1 and GTPBP2 is enhanced by interferon-gamma (IFN-gamma). The chromosomal location of both genes has been identified in humans, with GTPBP1 located in chromosome 22q12-13.1 and GTPBP2 located in chromosome 6p21-12. Human glioblastoma multiforme (GBM), a highly-malignant astrocytic glioma and the most common cancer in the central nervous system, has been linked to chromosomal deletions and a translocation on chromosome 6. The GBM translocation results in a fusion of GTPBP2 and PTPRZ1, a protein involved in oligodendrocyte differentiation, recovery, and survival. This fusion product may contribute to the onset of GBM. Length = 224 Score = 29.5 bits (67), Expect = 3.6 Identities = 41/195 (21%), Positives = 71/195 (36%), Gaps = 54/195 (27%) Query: 386 VTIMGHVDHGKTSLLDAI--------------------------RKADVAKGEIG----- 414 V ++G+VD GK++LL + R + V+ +G Sbjct: 2 VAVVGNVDAGKSTLLGVLTQGELDNGRGKARLNLFRHKHEVESGRTSSVSNEILGFDSDG 61 Query: 415 -------GITQHIGAYQVAYQGKNITFLDTPGHAAFYEMRARG--ARVTDIAVLVLAADE 465 K +TF+D GH + + G D A+LV+AA+ Sbjct: 62 EVVNYPDNHLSESDIEICEKSSKLVTFIDLAGHERYLKTTLFGLTGYAPDYAMLVVAANA 121 Query: 466 EIMPQAIESINHAKAADVSIIVAINKID--------KLGADPQKVRMS--LLKHDVFVES 515 I+ E + A A ++ + V + KID + D +++ + K V V+S Sbjct: 122 GIIGMTKEHLGLALALNIPVFVVVTKIDLAPANILQETLKDLKRILKVPGVRKLPVPVKS 181 Query: 516 MGGDILDVEISAKNN 530 DV ++A N Sbjct: 182 DD----DVVLAASNF 192 >gnl|CDD|30425 COG0076, GadB, Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism]. Length = 460 Score = 29.6 bits (66), Expect = 3.9 Identities = 21/91 (23%), Positives = 38/91 (41%), Gaps = 7/91 (7%) Query: 353 FGNTVKRVLESDIEVGIFDVADSESDLDIRPPVVTIMGHVDHGKTSLLDAIRKADVAKGE 412 G + +D + + + ++ + I VV G D G ++ + AD+A+ Sbjct: 179 LGLRRVPTVPTDYRIDVDALEEAIDENTIGGVVVGTAGTTDTGSIDDIEEL--ADIAEEY 236 Query: 413 IGGITQHIGAYQVAYQGKNITFLDTPGHAAF 443 GI H+ A A+ G + FL+ G F Sbjct: 237 --GIWLHVDA---AFGGFLLPFLEPDGRWDF 262 >gnl|CDD|110105 pfam01080, Presenilin, Presenilin. Mutations in presenilin-1 are a major cause of early onset Alzheimer's disease. It has been found that presenilin-1 binds to beta-catenin in-vivo. This family also contains SPE proteins from C.elegans. Length = 403 Score = 29.4 bits (66), Expect = 4.2 Identities = 26/120 (21%), Positives = 41/120 (34%), Gaps = 15/120 (12%) Query: 46 VVETRKRRSYVQGEEKVSVFRKSSRVIESSSDSSQDLSQAKAKGNFRRASRSDKVSSQKN 105 +VET + R E SS V+ + S+Q+ + RR S+S + Sbjct: 202 LVETAQER----NEPIFPALIYSSTVVVLTVGSNQEETNEGTPSTIRRTSKSTR------ 251 Query: 106 DSSFAGLSQGEIESRRRALHEAQVREEELRKRLEQQSLEQPSQESSIDLPEVCDSQQVPE 165 + + + L + E S E SQ S PE D+ + PE Sbjct: 252 ----SAANPDSAPTSHSTLELPEKSSTPELSDDESDSSETESQSDSSLAPE-EDAAEQPE 306 >gnl|CDD|31357 COG1163, DRG, Predicted GTPase [General function prediction only]. Length = 365 Score = 29.4 bits (66), Expect = 4.5 Identities = 25/97 (25%), Positives = 39/97 (40%), Gaps = 9/97 (9%) Query: 386 VTIMGHVDHGKTSLLDAIRKADVAKGEIGGITQHIGAYQVAYQGKNITFLDTPG-HAAFY 444 V ++G GK++LL+ + + T + Y+G I LD PG Sbjct: 66 VALVGFPSVGKSTLLNKLTNTKSEVADYPFTTLEPVPGMLEYKGAQIQLLDLPGIIEGAS 125 Query: 445 EMRARG------ARVTDIAVLVLAADEEIMPQAIESI 475 R RG AR D+ ++VL E+ P + I Sbjct: 126 SGRGRGRQVLSVARNADLIIIVLDVFED--PHHRDII 160 >gnl|CDD|37850 KOG2639, KOG2639, KOG2639, Sodium sulfate symporter and related arsenite permeases [Inorganic ion transport and metabolism]. Length = 685 Score = 29.5 bits (66), Expect = 4.6 Identities = 13/73 (17%), Positives = 28/73 (38%) Query: 96 RSDKVSSQKNDSSFAGLSQGEIESRRRALHEAQVREEELRKRLEQQSLEQPSQESSIDLP 155 + + + + + S+ E RR + + R LR+RL P++ L Sbjct: 396 KHEIHVWRLAAAQVSPASKEEENVRRTLSAKIRARARSLRERLPTSCNSNPAENYFNTLA 455 Query: 156 EVCDSQQVPEQVL 168 E+ ++ + L Sbjct: 456 ELQAKNRIRNKTL 468 >gnl|CDD|147076 pfam04732, Filament_head, Intermediate filament head (DNA binding) region. This family represents the N-terminal head region of intermediate filaments. Intermediate filament heads bind DNA. Vimentin heads are able to alter nuclear architecture and chromatin distribution, and the liberation of heads by HIV-1 protease liberates may play an important role in HIV-1 associated cytopathogenesis and carcinogenesis. Phosphorylation of the head region can affect filament stability. The head has been shown to interaction with the rod domain of the same protein. Length = 89 Score = 29.0 bits (65), Expect = 5.7 Identities = 25/79 (31%), Positives = 36/79 (45%), Gaps = 3/79 (3%) Query: 19 TLKTSSLGVGHSSFQNQGANQGRARSVVVETRKRRSYVQGEEKVSVFRKSSRVIESSSDS 78 T +SS G SS ++ ++ R+RSV R S K S ++SS S S Sbjct: 14 TRSSSSRSSGGSSGRSSSSSGFRSRSVS---RSSSSSPSPSLKSSYRKRSSSAPPSLSSD 70 Query: 79 SQDLSQAKAKGNFRRASRS 97 S D S A A N + +R+ Sbjct: 71 SLDFSLADALNNEFKITRT 89 >gnl|CDD|57924 cd01849, YlqF_related_GTPase, YlqF-related GTPases. These proteins are found in bacteria, eukaryotes, and archaea. They all exhibit a circular permutation of the GTPase signature motifs so that the order of the conserved G box motifs is G4-G5-G1-G2-G3, with G4 and G5 being permuted from the C-terminal region of proteins in the Ras superfamily to the N-terminus of YlqF-related GTPases.. Length = 155 Score = 28.8 bits (64), Expect = 6.8 Identities = 17/59 (28%), Positives = 28/59 (47%), Gaps = 4/59 (6%) Query: 382 RPPVVTIMGHVDHGKTSLLDAIRKADVAK-GEIGGITQHIGAYQVAYQGKNITFLDTPG 439 + V ++G+ + GK+S+++A+ K G + G T Q I LDTPG Sbjct: 99 KSITVGVIGYPNVGKSSVINALLNKLKLKVGNVPGTTTSQ---QEVKLDNKIKLLDTPG 154 >gnl|CDD|35275 KOG0052, KOG0052, KOG0052, Translation elongation factor EF-1 alpha/Tu [Translation, ribosomal structure and biogenesis]. Length = 391 Score = 28.8 bits (64), Expect = 7.5 Identities = 28/106 (26%), Positives = 42/106 (39%), Gaps = 28/106 (26%) Query: 386 VTIMGHVDHGKTS----LLDAIRK----------ADVAKGEI--------------GGIT 417 + ++GHVD GK++ I K A++ KG GIT Sbjct: 10 IVVIGHVDSGKSTTTGYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGIT 69 Query: 418 QHIGAYQVAYQGKNITFLDTPGHAAFYEMRARGARVTDIAVLVLAA 463 I ++ +T +D PGH F + G D AVL++AA Sbjct: 70 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAA 115 >gnl|CDD|35889 KOG0670, KOG0670, KOG0670, U4/U6-associated splicing factor PRP4 [RNA processing and modification]. Length = 752 Score = 28.5 bits (63), Expect = 7.5 Identities = 38/207 (18%), Positives = 73/207 (35%), Gaps = 19/207 (9%) Query: 95 SRSDKVSSQKNDSSFAGLSQGEIESRRRALHEAQVREEELRKRLEQQSLEQPSQESSIDL 154 R +V S K SS S E+ R+ + E++ K+ + ++ Sbjct: 2 ERDSEVKSDKGTSSSEKSSSSEVNRRKTDRSRSGSDEKKGHKK------SKKEKKDKKHK 55 Query: 155 PEVCDSQQVPEQVLEDPCKEKDLEIKDVDVGTEVESSVILSHDMGDSDSSSVVNNKFRES 214 ++V + ++ P K++ LE V T+ S + + N R Sbjct: 56 KHHDREKEVHHENVDSPTKKRTLE----PVDTKGNESKRKESKESSRNEEDEIRNPDRRE 111 Query: 215 SSDASSNRGKSRGGAGKYASVNSSKPVTRNKVGDDDKKYKKVRIAVAADVDEEGGASRGR 274 S + R K + + D D++ + D EG RGR Sbjct: 112 RSKSPERR---DRELRKRRDAERRELSKERRSIDRDREDNR------RDPRHEGNRRRGR 162 Query: 275 SLSAMRRRQEKFRRNQQQEKREKISRE 301 S R + + R++++E+R + R+ Sbjct: 163 SRRRFRNNRRERDRDKRRERRHRRDRD 189 >gnl|CDD|36699 KOG1486, KOG1486, KOG1486, GTP-binding protein DRG2 (ODN superfamily) [Signal transduction mechanisms]. Length = 364 Score = 28.7 bits (64), Expect = 7.6 Identities = 32/103 (31%), Positives = 46/103 (44%), Gaps = 17/103 (16%) Query: 370 FDVADSESDLDIRPPVVTIMGHVDHGKTSLLDAIR--KADVAKGEIGGITQHIGAYQVAY 427 F+V S D R V ++G GK++LL I ++ A E +T G + Y Sbjct: 55 FEVLKSG---DAR---VALIGFPSVGKSTLLSKITSTHSEAASYEFTTLTCIPGV--IHY 106 Query: 428 QGKNITFLDTPG-HAAFYEMRARG------ARVTDIAVLVLAA 463 G NI LD PG + + RG AR D+ ++VL A Sbjct: 107 NGANIQLLDLPGIIEGASQGKGRGRQVIAVARTADLILMVLDA 149 >gnl|CDD|143815 pfam00025, Arf, ADP-ribosylation factor family. Pfam combines a number of different Prosite families together. Length = 174 Score = 28.7 bits (65), Expect = 7.7 Identities = 29/128 (22%), Positives = 46/128 (35%), Gaps = 29/128 (22%) Query: 395 GKTSLLDAIRKADVAKGEIGGI--TQHIGAYQVAYQGKNITFLDTPGHAAFYEMRARGAR 452 GKT++L + GEI T V Y+ T D G R Sbjct: 26 GKTTILYKL-----KLGEIVTTIPTIGFNVETVTYKNVKFTVWDVGGQ--------ESLR 72 Query: 453 ---------VTDIAVLVLAADEEIMPQAIES----INHAKAADVSIIVAINKIDKLGA-D 498 + +V +AD + + +A E +N + AD +++ NK D GA Sbjct: 73 PLWRNYFPNTDAVIFVVDSADRDRIEEAKEELHALLNEEELADAPLLILANKQDLPGAMS 132 Query: 499 PQKVRMSL 506 ++R L Sbjct: 133 EAEIRELL 140 >gnl|CDD|133252 cd00876, Ras, Ras family. The Ras family of the Ras superfamily includes classical N-Ras, H-Ras, and K-Ras, as well as R-Ras, Rap, Ral, Rheb, Rhes, ARHI, RERG, Rin/Rit, RSR1, RRP22, Ras2, Ras-dva, and RGK proteins. Ras proteins regulate cell growth, proliferation and differentiation. Ras is activated by guanine nucleotide exchange factors (GEFs) that release GDP and allow GTP binding. Many RasGEFs have been identified. These are sequestered in the cytosol until activation by growth factors triggers recruitment to the plasma membrane or Golgi, where the GEF colocalizes with Ras. Active GTP-bound Ras interacts with several effector proteins: among the best characterized are the Raf kinases, phosphatidylinositol 3-kinase (PI3K), RalGEFs and NORE/MST1. Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Ras proteins. Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation. Length = 160 Score = 28.7 bits (65), Expect = 7.7 Identities = 28/131 (21%), Positives = 46/131 (35%), Gaps = 35/131 (26%) Query: 431 NITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKA---------- 480 + LDT G F MR R D +LV + + ES K Sbjct: 48 TLDILDTAGQEEFSAMRDLYIRQGDGFILVYSITDR------ESFEEIKGYREQILRVKD 101 Query: 481 -ADVSIIVAINKIDKLGADPQKVRMSLLKHDVFVESMGGDILD------VEISAKNNLNL 533 D+ I++ NK D L + G + +E SAK+N+N+ Sbjct: 102 DEDIPIVLVGNKCD------------LENERQVSKEEGKALAKEWGCPFIETSAKDNINI 149 Query: 534 DKLLDAILLQA 544 D++ ++ + Sbjct: 150 DEVFKLLVREI 160 >gnl|CDD|176210 cd08248, RTN4I1, Human Reticulon 4 Interacting Protein 1. Human Reticulon 4 Interacting Protein 1 is a member of the medium chain dehydrogenase/ reductase (MDR) family. Riticulons are endoplasmic reticulum associated proteins involved in membrane trafficking and neuroendocrine secretion. The MDR/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. Length = 350 Score = 28.7 bits (65), Expect = 8.1 Identities = 18/80 (22%), Positives = 29/80 (36%), Gaps = 8/80 (10%) Query: 658 MARRLGSHSALEKLVKNANISSKMKEFPVIIKGDVQGSVEAIVDSLGALK-NSEVCLSI- 715 M G L K K + EFP+ + D G V I + + + EV ++ Sbjct: 48 MRSGYGRT-LLNKKRKPQSCKYSGIEFPLTLGRDCSGVVVDIGSGVKSFEIGDEVWGAVP 106 Query: 716 -----VHSSVGAINETDVSL 730 H+ + E +VS Sbjct: 107 PWSQGTHAEYVVVPENEVSK 126 >gnl|CDD|133250 cd00154, Rab, Rab family. Rab GTPases form the largest family within the Ras superfamily. There are at least 60 Rab genes in the human genome, and a number of Rab GTPases are conserved from yeast to humans. Rab GTPases are small, monomeric proteins that function as molecular switches to regulate vesicle trafficking pathways. The different Rab GTPases are localized to the cytosolic face of specific intracellular membranes, where they regulate distinct steps in membrane traffic pathways. In the GTP-bound form, Rab GTPases recruit specific sets of effector proteins onto membranes. Through their effectors, Rab GTPases regulate vesicle formation, actin- and tubulin-dependent vesicle movement, and membrane fusion. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which mask C-terminal lipid binding and promote cytosolic localization. While most unicellular organisms possess 5-20 Rab members, several have been found to possess 60 or more Rabs; for many of these Rab isoforms, homologous proteins are not found in other organisms. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Since crystal structures often lack C-terminal residues, the lipid modification site is not available for annotation in many of the CDs in the hierarchy, but is included where possible. Length = 159 Score = 28.6 bits (65), Expect = 8.5 Identities = 15/59 (25%), Positives = 28/59 (47%), Gaps = 6/59 (10%) Query: 482 DVSIIVAINKIDKLGADPQKVRMSLLKHDVFVESMGGDILDVEISAKNNLNLDKLLDAI 540 ++ II+ NKID D ++V + + +L E SAK N+++L ++ Sbjct: 105 NIPIILVGNKIDL--EDQRQV----STEEAQQFAKENGLLFFETSAKTGENVEELFQSL 157 >gnl|CDD|173857 cd08492, PBP2_NikA_DppA_OppA_like_15, The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction. Length = 484 Score = 28.3 bits (64), Expect = 8.6 Identities = 18/75 (24%), Positives = 25/75 (33%), Gaps = 9/75 (12%) Query: 401 DAIRKADVAKGEIGGITQHIGAYQVAYQ----GKNITFLDTPGHAAFYEMRARGARVTDI 456 ++R + G++ IT I G I TPG + D+ Sbjct: 209 ASVRVGALQSGQVDVITD-IPPQDEKQLAADGGPVIETRPTPGVPYSLYLNTTRPPFDDV 267 Query: 457 AV---LVLAAD-EEI 467 V L LA D E I Sbjct: 268 RVRQALQLAIDREAI 282 >gnl|CDD|58088 cd03697, EFTU_II, EFTU_II: Elongation factor Tu domain II. Elongation factors Tu (EF-Tu) are three-domain GTPases with an essential function in the elongation phase of mRNA translation. The GTPase center of EF-Tu is in the N-terminal domain (domain I), also known as the catalytic or G-domain. The G-domain is composed of about 200 amino acid residues, arranged into a predominantly parallel six-stranded beta-sheet core surrounded by seven a-helices. Non-catalytic domains II and III are beta-barrels of seven and six, respectively, antiparallel beta-strands that share an extended interface. Either non-catalytic domain is composed of about 100 amino acid residues. EF-Tu proteins exist in two principal conformations: in a compact one, EF-Tu*GTP, with tight interfaces between all three domains and a high affinity for aminoacyl-tRNA, and in an open one, EF-Tu*GDP, with essentially no G-domain-domain II interactions and a low affinity for aminoacyl-tRNA. EF-Tu has approximately a 100-fold higher affinity for GDP than for GTP.. Length = 87 Score = 28.5 bits (64), Expect = 9.3 Identities = 16/83 (19%), Positives = 37/83 (44%), Gaps = 13/83 (15%) Query: 794 EVLEVFAVTKLGNVAGCKVSEGKVERGSGVRLI-----RNSTVIYEGKLKTLKRFKDEVS 848 + +VF++ G V ++ G ++ G V ++ +TV ++ F+ + Sbjct: 4 PIEDVFSIPGRGTVVTGRIERGTIKVGDEVEIVGFGETLKTTVT------GIEMFRKTLD 57 Query: 849 EVHAGQDCGMAFE--KYDNIQAG 869 E AG + G+ K ++++ G Sbjct: 58 EAEAGDNVGVLLRGVKREDVERG 80 >gnl|CDD|31949 COG1763, MobB, Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism]. Length = 161 Score = 28.4 bits (63), Expect = 9.7 Identities = 19/107 (17%), Positives = 43/107 (40%), Gaps = 13/107 (12%) Query: 383 PPVVTIMGHVDHGKTSLLDAIRKADVAKGEIGGITQHIG-AYQVAYQGKNITFLDTPGHA 441 ++ I+G+ + GKT+L++ + + A+G +H + + GK DT Sbjct: 2 MKILGIVGYKNSGKTTLIEKLVRKLKARGYRVATVKHAHHDFDLDKPGK-----DT---- 52 Query: 442 AFYEMRARGARVTDIAV-LVLAADEEIMPQAIESINHAKAADVSIIV 487 Y R GA +A A + ++++ + +++ Sbjct: 53 --YRHRKAGADQVVVASDHRTALMTRTPDRDLDAVLSRLDPLLDLVL 97 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.313 0.130 0.346 Gapped Lambda K H 0.267 0.0585 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 9,467,721 Number of extensions: 501547 Number of successful extensions: 1710 Number of sequences better than 10.0: 1 Number of HSP's gapped: 1587 Number of HSP's successfully gapped: 207 Length of query: 884 Length of database: 6,263,737 Length adjustment: 102 Effective length of query: 782 Effective length of database: 4,059,619 Effective search space: 3174622058 Effective search space used: 3174622058 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 62 (28.0 bits)