>cd05689 S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain. While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 4 (ec4) of the Escherichia coli RPS1. Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.

Probab=97.24 E-value=0.0017 Score=44.92 Aligned_cols=59 Identities=22% Similarity=0.357 Sum_probs=52.5 Q ss_pred HCCCEEEEEEEECCCCEEEEEEC-CCEEEEEHHHCC-------CCCCCCCCCEEEEEEEEECCCCCE Q ss_conf 20838999998405763899957-935874478748-------875115276699999761135870 Q gi|254780788|r 137 KVGEIISGTVKRVEYGNVIVDLG-NSDGVIRRDETI-------SRENLRPGDRVKSYIYDVRREQRG 195 (526) Q Consensus 137 r~Geiv~G~V~r~e~~~iiVdlg-~~ea~Lp~~e~i-------p~E~~~~Gdrika~i~~V~~~~rg 195 (526) T Consensus 2 ~~G~~v~G~V~~It~fG~FV~i~~g~eGLvHiSelsw~~~~~~p~~~~~~Gd~v~vkIl~iD~e~~r 68 (72) T cd05689 2 PEGTRLFGKVTNLTDYGCFVELEEGVEGLVHVSEMDWTNKNIHPSKVVSLGDEVEVMVLDIDEERRR 68 (72) T ss_pred CCCCEEEEEEEEEECCEEEEEECCCCEEEEEHHHCCCCCCCCCHHHHCCCCCEEEEEEEEEECCCCE T ss_conf 8899999999899476239996699389999766316546679636038999999999999599799

HHsearch alignment for GI: 254780788 and conserved domain: cd05689