>cd05705 S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 14 (hs14). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.

Probab=94.38 E-value=0.35 Score=27.92 Aligned_cols=59 Identities=20% Similarity=0.276 Sum_probs=48.9 Q ss_pred HCCCEEEEEEEECCCCEEEEEECC-CEEEEEHHHC---CCC------CCCCCCCEEEEEEEEECCCCCE Q ss_conf 208389999984057638999579-3587447874---887------5115276699999761135870 Q gi|254780788|r 137 KVGEIISGTVKRVEYGNVIVDLGN-SDGVIRRDET---ISR------ENLRPGDRVKSYIYDVRREQRG 195 (526) Q Consensus 137 r~Geiv~G~V~r~e~~~iiVdlg~-~ea~Lp~~e~---ip~------E~~~~Gdrika~i~~V~~~~rg 195 (526) T Consensus 2 keGq~vRGyVk~v~~~GvFv~Ls~~v~grv~~~nls~~~v~dp~~~~~~fp~GkLv~~kVlsvd~~~~~ 70 (74) T cd05705 2 KEGQLLRGYVSSVTKQGVFFRLSSSIVGRVLFQNVTKYFVSDPSLYNKYLPEGKLLTAKVLSVNSEKNL 70 (74) T ss_pred CCCCEEEEEEEECCCCCEEEEECCCEEEEEEEECCCHHHHCCHHHHHCCCCCCCEEEEEEEEECCCCCE T ss_conf 988798999998268739999568748999970036212068268861489998999999998677684

HHsearch alignment for GI: 254780788 and conserved domain: cd05705