>cd05706 S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes S. cerevisiae S1 repeat 10 (sc10). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.

Probab=97.33 E-value=0.0021 Score=44.29 Aligned_cols=63 Identities=27% Similarity=0.432 Sum_probs=56.7 Q ss_pred HCCCEEEEEEEECCCCEEEEEEC-CCEEEEEHHHC------CCCCCCCCCCEEEEEEEEECCCCCEEEEEEE Q ss_conf 20838999998405763899957-93587447874------8875115276699999761135870289871 Q gi|254780788|r 137 KVGEIISGTVKRVEYGNVIVDLG-NSDGVIRRDET------ISRENLRPGDRVKSYIYDVRREQRGPQVLLS 201 (526) Q Consensus 137 r~Geiv~G~V~r~e~~~iiVdlg-~~ea~Lp~~e~------ip~E~~~~Gdrika~i~~V~~~~rgpqi~lS 201 (526) T Consensus 2 kvG~~l~G~Vt~V~~~g~fV~L~~~~~Glvhisel~dd~~~~~~~~~~~g~~V~v~Vl~VD~~~k--rI~LS 71 (73) T cd05706 2 KVGDILPGRVTKVNDRYVLVQLGNKVTGPSFITDALDDYSEALPYKFKKNDIVRACVLSVDVPNK--KIALS 71 (73) T ss_pred CCCCEEEEEEEEECCCEEEEEECCCCEEEEEHHHHCCCCCCCCHHHCCCCCEEEEEEEEEECCCC--EEEEE T ss_conf 88989999999988887999908994799998993046013817516899999999999988899--89886

HHsearch alignment for GI: 254780788 and conserved domain: cd05706