>cd05707 S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes S. cerevisiae S1 repeat 11 (sc11). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.

Probab=97.17 E-value=0.0021 Score=44.28 Aligned_cols=61 Identities=25% Similarity=0.464 Sum_probs=53.5 Q ss_pred CCEEEEEEEECCCCEEEEEEC-CCEEEEEHHHCC------CCCCCCCCCEEEEEEEEECCCCCEEEEEEE Q ss_conf 838999998405763899957-935874478748------875115276699999761135870289871 Q gi|254780788|r 139 GEIISGTVKRVEYGNVIVDLG-NSDGVIRRDETI------SRENLRPGDRVKSYIYDVRREQRGPQVLLS 201 (526) Q Consensus 139 Geiv~G~V~r~e~~~iiVdlg-~~ea~Lp~~e~i------p~E~~~~Gdrika~i~~V~~~~rgpqi~lS 201 (526) T Consensus 1 G~~v~G~V~~i~~~G~FV~l~~~~~glVhiselsd~fVkd~~~~f~vGq~V~~kV~~iD~~~~--ri~LS 68 (68) T cd05707 1 GDVVRGFVKNIANNGVFVTLGRGVDARVRVSELSDSYLKDWKKRFKVGQLVKGKIVSIDPDNG--RIEMT 68 (68) T ss_pred CCEEEEEEEEECCCCEEEEECCCCEEEEEHHHHCHHHHCCHHHHCCCCCEEEEEEEEEECCCC--EEECC T ss_conf 999899999803640799917996799995991723564998917999999999999828758--67359

HHsearch alignment for GI: 254780788 and conserved domain: cd05707