>cd05789 S1_Rrp4 S1_Rrp4: Rrp4 S1-like RNA-binding domain. S1-like RNA-binding domains are found in a wide variety of RNA-associated proteins. Rrp4 protein is a subunit of the exosome complex. The exosome plays a central role in 3' to 5' RNA processing and degradation in eukarytes and archaea. Its functions include the removal of incorrectly processed RNA and the maintenance of proper levels of mRNA, rRNA and a number of small RNA species. In Saccharomyces cerevisiae, the exosome includes nine core components, six of which are homologous to bacterial RNase PH. These form a hexameric ring structure. The other three subunits (RrP4, Rrp40, and Csl4) contain an S1 RNA binding domain and are part of the "S1 pore structure".

Probab=96.21 E-value=0.022 Score=36.78 Aligned_cols=59 Identities=25% Similarity=0.423 Sum_probs=51.5 Q ss_pred HHHHCCCEEEEEEEECCCCEEEEEEC-CCEEEEEHHHCC-C---------CCCCCCCCEEEEEEEEECCC Q ss_conf 98520838999998405763899957-935874478748-8---------75115276699999761135 Q gi|254780788|r 134 FKDKVGEIISGTVKRVEYGNVIVDLG-NSDGVIRRDETI-S---------RENLRPGDRVKSYIYDVRRE 192 (526) Q Consensus 134 f~~r~Geiv~G~V~r~e~~~iiVdlg-~~ea~Lp~~e~i-p---------~E~~~~Gdrika~i~~V~~~ 192 (526) T Consensus 2 Y~P~~GD~ViG~V~~i~~~~w~vdi~s~~~a~L~ls~v~~~~~~~d~~~mr~~l~iGDli~a~V~~v~~~ 71 (86) T cd05789 2 YIPEVGDVVIGRVTEVGFKRWKVDINSPYDAVLPLSEVNLPRTDEDELNMRSYLDEGDLIVAEVQSVDSD 71 (86) T ss_pred CCCCCCCEEEEEEEEEECCCEEEECCCCEEEEEEHHHCCCCCCCHHHHHHHHHCCCCCEEEEEEEEECCC T ss_conf 8798899999999998088189974996077987454467776314677886566898999999998899

HHsearch alignment for GI: 254780788 and conserved domain: cd05789