BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780790|ref|YP_003065203.1| hypothetical protein CLIBASIA_03405 [Candidatus Liberibacter asiaticus str. psy62] (129 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780790|ref|YP_003065203.1| hypothetical protein CLIBASIA_03405 [Candidatus Liberibacter asiaticus str. psy62] Length = 129 Score = 251 bits (641), Expect = 3e-69, Method: Compositional matrix adjust. Identities = 129/129 (100%), Positives = 129/129 (100%) Query: 1 MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60 MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR Sbjct: 1 MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60 Query: 61 RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120 RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM Sbjct: 61 RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120 Query: 121 TRRVYFIKK 129 TRRVYFIKK Sbjct: 121 TRRVYFIKK 129 >gi|254781197|ref|YP_003065610.1| guanylate kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 185 Score = 26.9 bits (58), Expect = 0.12, Method: Compositional matrix adjust. Identities = 16/67 (23%), Positives = 30/67 (44%), Gaps = 6/67 (8%) Query: 64 FLETVRYGVMYF------MLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117 F+ET + Y+ + + + + + + L+LT QGL PL V+S+ Sbjct: 67 FIETTKVRDEYYGYLKEDINNPMEHGYDILLILTHQGLAPLKKLYEDQVTSIFIAPPSEA 126 Query: 118 RFMTRRV 124 + RR+ Sbjct: 127 ELIQRRI 133 >gi|254780132|ref|YP_003064545.1| guanylate kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 186 Score = 26.9 bits (58), Expect = 0.12, Method: Compositional matrix adjust. Identities = 16/67 (23%), Positives = 30/67 (44%), Gaps = 6/67 (8%) Query: 64 FLETVRYGVMYF------MLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117 F+ET + Y+ + + + + + + L+LT QGL PL V+S+ Sbjct: 67 FIETTKVRDEYYGYLKEDINNPMEHGYDILLILTHQGLAPLKKLYEDQVTSIFIAPPSEA 126 Query: 118 RFMTRRV 124 + RR+ Sbjct: 127 ELIQRRI 133 >gi|254781094|ref|YP_003065507.1| glycyl-tRNA synthetase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 702 Score = 23.1 bits (48), Expect = 1.6, Method: Composition-based stats. Identities = 7/11 (63%), Positives = 9/11 (81%) Query: 48 WIPSRLFIFLK 58 W P RLF++LK Sbjct: 47 WTPHRLFLYLK 57 >gi|255764478|ref|YP_003065205.2| aminopeptidase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 418 Score = 21.9 bits (45), Expect = 3.9, Method: Composition-based stats. Identities = 10/27 (37%), Positives = 15/27 (55%) Query: 11 IVVVFFIDVMGFFILMKCGADPFYSRI 37 +V VF+ D +L K GAD + R+ Sbjct: 62 LVSVFYKDSEATLMLYKYGADYAFDRV 88 >gi|254781174|ref|YP_003065587.1| outer membrane assembly lipoprotein YfiO [Candidatus Liberibacter asiaticus str. psy62] Length = 271 Score = 21.6 bits (44), Expect = 4.9, Method: Compositional matrix adjust. Identities = 9/11 (81%), Positives = 9/11 (81%) Query: 38 FSIAVAFLVTW 48 FSIAV FLV W Sbjct: 28 FSIAVCFLVGW 38 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.345 0.153 0.464 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 75,893 Number of Sequences: 1233 Number of extensions: 2734 Number of successful extensions: 21 Number of sequences better than 100.0: 15 Number of HSP's better than 100.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 7 Number of HSP's gapped (non-prelim): 16 length of query: 129 length of database: 328,796 effective HSP length: 65 effective length of query: 64 effective length of database: 248,651 effective search space: 15913664 effective search space used: 15913664 T: 11 A: 40 X1: 15 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 38 (21.6 bits) S2: 33 (17.3 bits)