HHsearch alignment for GI: 254780791 and conserved domain: COG1200

>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription].
Probab=91.27  E-value=1.5  Score=25.05  Aligned_cols=94  Identities=16%  Similarity=0.129  Sum_probs=60.9

Q ss_pred             CCCHHHHHHHHHHHHHH-----C---C---CCEEEEEEECCCCCCCCCC--EEEEEEECCCCEEEEEEECCCCCCCCCCC
Q ss_conf             62299999999999740-----0---1---7189999970543568886--27999874894799999735210586681
Q gi|254780791|r   14 EYSVSELSYHLKHIVES-----N---L---SHVCVRGEISGYRGIHSSG--HAYFSLKDNHSRIDAIIWKGTLNKIEFLP   80 (529)
Q Consensus        14 ~~svs~l~~~i~~~l~~-----~---~---~~~~v~gEis~~~~~~~sG--H~Yf~lkd~~a~i~~~~~~~~~~~~~~~~   80 (529)
T Consensus        31 i~tv~DLL~~~P~~YeD~~~~~~i~~~~~g~~vti~g~V~~~~~~~~~~~~~l~v~~~d~~~~l~l~fFn~~~-~l~~~~  109 (677)
T COG1200          31 IHTVQDLLLYLPRRYEDRTLLPGIAEARPGEIVTIEGTVLSHEKFPFGKRKLLKVTLSDGTGVLTLVFFNFPA-YLKKKL  109 (677)
T ss_pred             CCCHHHHHHHCCCCHHHCCCCCCHHHCCCCCEEEEEEEEEEEECCCCCCCCEEEEEEECCCEEEEEEEECCCH-HHHHHC
T ss_conf             8759999986862142146567843537786699999997640257788734999996296899999978668-888418


Q ss_pred             CCCCEEEEEEEEEEECCCCEEEEEEEEEEE
Q ss_conf             459889999996675288437999997101
Q gi|254780791|r   81 EEGIEFLVIGKITTFPGSSKYQIIIESLIP  110 (529)
Q Consensus        81 ~~G~~v~~~g~~~~y~~~g~~ql~v~~i~~  110 (529)
T Consensus       110 ~~G~~v~v~Gk~~~--~~~~~~~~hpe~~~  137 (677)
T COG1200         110 KVGERVIVYGKVKR--FKGGLQITHPEYIV  137 (677)
T ss_pred             CCCCEEEEEEEEEE--CCCCEEEECCEEEE
T ss_conf             79988999998950--36835887666783