HHsearch alignment for GI: 254780791 and conserved domain: PRK00448

>PRK00448 polC DNA polymerase III PolC; Validated.
Probab=93.12  E-value=0.83  Score=27.38  Aligned_cols=79  Identities=16%  Similarity=0.115  Sum_probs=56.0

Q ss_pred             CCCCEEEEEEECCCCC-CCCCC-EEE-EEEECCCCEEEEEEECCCCCCCC--CCCCCCCEEEEEEEEEEECC-CCEEEEE
Q ss_conf             0171899999705435-68886-279-99874894799999735210586--68145988999999667528-8437999
Q gi|254780791|r   31 NLSHVCVRGEISGYRG-IHSSG-HAY-FSLKDNHSRIDAIIWKGTLNKIE--FLPEEGIEFLVIGKITTFPG-SSKYQII  104 (529)
Q Consensus        31 ~~~~~~v~gEis~~~~-~~~sG-H~Y-f~lkd~~a~i~~~~~~~~~~~~~--~~~~~G~~v~~~g~~~~y~~-~g~~ql~  104 (529)
T Consensus       233 ~~~~v~v~G~vf~~e~~~~k~g~~i~~~~itD~t~si~~k~f~~~~~~~~~~~~i~~g~~v~v~g~~~-~d~~~~~~~~~  311 (1436)
T PRK00448        233 EERRVVVEGYVFKKEIKELKSGRHILTFKITDYTSSITVKKFLRDKEDLKKFDEIKKGDWVKVRGSVQ-NDTFTRDLVMN  311 (1436)
T ss_pred             CCCEEEEEEEEEEEEEEECCCCCEEEEEEEEECCCCEEEEEECCCCCHHHHHHHCCCCCEEEEEEEEE-ECCCCCCEEEE
T ss_conf             25818999999866744315798799999982688689999447633278985167997899999985-12677721787


Q ss_pred             EEEEEE
Q ss_conf             997101
Q gi|254780791|r  105 IESLIP  110 (529)
Q Consensus       105 v~~i~~  110 (529)
T Consensus       312 ~~~i~~  317 (1436)
T PRK00448        312 AKDIKE  317 (1436)
T ss_pred             HHHHHC
T ss_conf             557110