HHsearch alignment for GI: 254780791 and conserved domain: PRK06142

>PRK06142 enoyl-CoA hydratase; Provisional.
Probab=94.31  E-value=0.64  Score=28.37  Aligned_cols=39  Identities=21%  Similarity=0.273  Sum_probs=25.3

Q ss_pred             HHHHHHHHCCCEEEEEE-CCCCCC-HHHHHHHCCCCCCCHH
Q ss_conf             99999974890488520-577752-5898864123777214
Q gi|254780791|r  231 MIVRAIANSSIPIISAI-GHETDW-TLADYAADLRAPTPTG  269 (529)
Q Consensus       231 ~laraI~~~~iPVisgI-GHE~D~-Tl~D~VAD~Ra~TPTa  269 (529)
T Consensus        99 ~~~~~i~~~~kPvIaav~G~a~GgG~~la~~cD~~ia~~~a  139 (271)
T PRK06142         99 ASINAVADCRKPVLAAVQGWCIGGAVDLISACDMRYASADA  139 (271)
T ss_pred             HHHHHHHHCCCCEEEEECCEEEEHHHHHHHHHCCCCCCCCC
T ss_conf             99999972899899998884440758999861512227985