HHsearch alignment for GI: 254780791 and conserved domain: PRK06293

>PRK06293 single-stranded DNA-binding protein; Provisional.
Probab=90.24  E-value=0.67  Score=28.17  Aligned_cols=75  Identities=23%  Similarity=0.352  Sum_probs=49.0

Q ss_pred             EEEEEEC---CCCCCCCCC--EEEEEE--------ECCCCEEEEEEECCCCCCCCCCCCCCCEEEEEEEEEE--ECC---
Q ss_conf             9999970---543568886--279998--------7489479999973521058668145988999999667--528---
Q gi|254780791|r   36 CVRGEIS---GYRGIHSSG--HAYFSL--------KDNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITT--FPG---   97 (529)
Q Consensus        36 ~v~gEis---~~~~~~~sG--H~Yf~l--------kd~~a~i~~~~~~~~~~~~~~~~~~G~~v~~~g~~~~--y~~---   97 (529)
T Consensus         5 ~LvGrLt~DPElR-~T~sG~aVa~FtlAvn~~~~~~~et~fi~~v~W~k~AE~~~~yl~KGs~V~VeGrl~trsyedkdG   83 (161)
T PRK06293          5 YFAGYLGADPEER-MTSKGKRVVVLRLGVKSRVGSKDETVWCRCNIWHNRYDKMLPYLKKGSGVIVAGDISVESYMSKDG   83 (161)
T ss_pred             EEEEECCCCCCEE-ECCCCCEEEEEEEEECCCCCCCCCCEEEEEEEHHHHHHHHHHHHCCCCEEEEEEEEEECCCCCCCC
T ss_conf             5456146687244-889998799999998688787568659999973478999999864789899998777347687899


Q ss_pred             --CCEEEEEEEEEEEC
Q ss_conf             --84379999971016
Q gi|254780791|r   98 --SSKYQIIIESLIPS  111 (529)
Q Consensus        98 --~g~~ql~v~~i~~~  111 (529)
T Consensus        84 ~kry~tEVvad~~~fl   99 (161)
T PRK06293         84 SPQSSLVVSVDTLKFS   99 (161)
T ss_pred             CEEEEEEEEEEEEEEC
T ss_conf             8898999999678965