HHsearch alignment for GI: 254780791 and conserved domain: PRK06751

>PRK06751 single-stranded DNA-binding protein; Provisional.
Probab=92.40  E-value=0.77  Score=27.65  Aligned_cols=76  Identities=21%  Similarity=0.366  Sum_probs=52.7

Q ss_pred             CEEEEEEEC---CCCCCCCCCEE--EEEE------ECCC-----CEEEEEEECCCCCCCCCCCCCCCEEEEEEEEEE--E
Q ss_conf             189999970---54356888627--9998------7489-----479999973521058668145988999999667--5
Q gi|254780791|r   34 HVCVRGEIS---GYRGIHSSGHA--YFSL------KDNH-----SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITT--F   95 (529)
Q Consensus        34 ~~~v~gEis---~~~~~~~sGH~--Yf~l------kd~~-----a~i~~~~~~~~~~~~~~~~~~G~~v~~~g~~~~--y   95 (529)
T Consensus         3 kV~LiGrL~~DPElr-~t~~G~~v~~f~lAv~r~~~~~~g~~~td~~~vv~wgk~AE~~~~yl~KG~~V~VeGrl~~r~y   81 (172)
T PRK06751          3 RVILVGRLTKDPDLR-YTPNGVAVATFTLAVNRAFANQQGEREADFINCVIWRKQAENVANYLKKGSLAGVDGRLQTRNY   81 (172)
T ss_pred             EEEEEEECCCCCEEE-ECCCCCEEEEEEEEECCCEECCCCCEEEEEEEEEEECHHHHHHHHHHCCCCEEEEEEEEECCCC
T ss_conf             799998768787588-8899987999999966760267897677899999728889999987578998999998624766


Q ss_pred             C-----CCCEEEEEEEEEEE
Q ss_conf             2-----88437999997101
Q gi|254780791|r   96 P-----GSSKYQIIIESLIP  110 (529)
Q Consensus        96 ~-----~~g~~ql~v~~i~~  110 (529)
T Consensus        82 edkdG~~r~~teIv~~~~~~  101 (172)
T PRK06751         82 EGQDGKRVYVTEVLAESVQF  101 (172)
T ss_pred             CCCCCCEEEEEEEEEEEEEE
T ss_conf             87899889999999966897