HHsearch alignment for GI: 254780791 and conserved domain: PRK08763

>PRK08763 single-stranded DNA-binding protein; Provisional.
Probab=92.95  E-value=0.66  Score=28.23  Aligned_cols=80  Identities=16%  Similarity=0.215  Sum_probs=57.6

Q ss_pred             CCCCEEEEEEEC---CCCCCCCCCEEE--EEE------ECCC-------CEEEEEEECCCCCCCCCCCCCCCEEEEEEEE
Q ss_conf             017189999970---543568886279--998------7489-------4799999735210586681459889999996
Q gi|254780791|r   31 NLSHVCVRGEIS---GYRGIHSSGHAY--FSL------KDNH-------SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKI   92 (529)
Q Consensus        31 ~~~~~~v~gEis---~~~~~~~sGH~Y--f~l------kd~~-------a~i~~~~~~~~~~~~~~~~~~G~~v~~~g~~   92 (529)
T Consensus         4 ~~NkV~LiG~l~~Dpelr-~t~sG~~v~~fslA~~~~~~~~~g~~~~~t~w~~vv~~gk~AE~~~~yl~KG~~V~VeGrL   82 (160)
T PRK08763          4 GINKVILVGNLGNDPDIK-YTQSGMTITRISLATTSMRKDREGNTQERTEWHRVKFFGKLGEIAGEYLRKGSQCYIEGEI   82 (160)
T ss_pred             CCCEEEEEEECCCCCEEE-ECCCCCEEEEEEEEECCCEECCCCCCEECEEEEEEEEEHHHHHHHHHHHHCCCEEEEEEEE
T ss_conf             861999987547597587-8899987999999977873568888252105999998368999999874179989998888


Q ss_pred             E--EEC-----CCCEEEEEEEEEEEC
Q ss_conf             6--752-----884379999971016
Q gi|254780791|r   93 T--TFP-----GSSKYQIIIESLIPS  111 (529)
Q Consensus        93 ~--~y~-----~~g~~ql~v~~i~~~  111 (529)
T Consensus        83 ~~~~y~dkdG~kr~~teIv~~~v~~l  108 (160)
T PRK08763         83 RYDKFTGQDGQERYVTEIVADEMQML  108 (160)
T ss_pred             EEEEEECCCCCEEEEEEEEEEEEEEC
T ss_conf             88551758998899999999888981