HHsearch alignment for GI: 254780791 and conserved domain: PRK08957

>PRK08957 consensus.
Probab=96.01  E-value=0.041  Score=39.05  Aligned_cols=47  Identities=17%  Similarity=0.258  Sum_probs=20.2

Q ss_pred             EECCCCCCCCCCCCCCCEEEEEEEEEEECCCCEEEEEEEEEEECCCCHHH
Q ss_conf             97352105866814598899999966752884379999971016800799
Q gi|254780791|r   68 IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLL  117 (529)
Q Consensus        68 ~~~~~~~~~~~~~~~G~~v~~~g~~~~y~~~g~~ql~v~~i~~~g~G~l~  117 (529)
T Consensus        52 eFy~ackk~GIKPIIG~El~v~~~~--~-~~~~~~LvLLAkN~~GY~NL~   98 (1159)
T PRK08957         52 KFYGAAHGAGIKPIIGADFWVQSPL--L-GDELTHLTVLAANNEGYQNLT   98 (1159)
T ss_pred             HHHHHHHHCCCCEEEEEEEEEECCC--C-CCCCCCEEEEECCHHHHHHHH
T ss_conf             9999999869987977799973687--7-787342899958999999999