HHsearch alignment for GI: 254780791 and conserved domain: PRK12366

>PRK12366 replication factor A; Reviewed.
Probab=91.39  E-value=1.5  Score=25.14  Aligned_cols=72  Identities=18%  Similarity=0.262  Sum_probs=50.4

Q ss_pred             EEEEEECCCCCC-------CCCCEE-EEEEECCCCEEEEEEECCCCCCCCCCCCCCCEEEEEEEEEEECCCCEEEEEEEE
Q ss_conf             999997054356-------888627-999874894799999735210586681459889999996675288437999997
Q gi|254780791|r   36 CVRGEISGYRGI-------HSSGHA-YFSLKDNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIES  107 (529)
Q Consensus        36 ~v~gEis~~~~~-------~~sGH~-Yf~lkd~~a~i~~~~~~~~~~~~~~~~~~G~~v~~~g~~~~y~~~g~~ql~v~~  107 (529)
T Consensus       188 ti~G~V~~~~~irtF~r~DGS~G~v~sl~l~DeTGsIRvTLWdd~a---d~~v~kGD~V~V~Gy~~e-gy~g~lel~~~n  263 (649)
T PRK12366        188 TINGEITKAYPKKEFTKKDGTEGQLKSFIVKDETGSIRVTLWNELT---DIEVKKGDIVEVSGYVKQ-GYSGNTELSVDN  263 (649)
T ss_pred             EEEEEEEECCCCEEEECCCCCCCEEEEEEEECCCCCEEEEEECCCC---CCCCCCCCEEEEEEEECC-CCCCCEEEEECC
T ss_conf             6999996436863532478986467678997788858999856766---543357989999888725-632404888753


Q ss_pred             EEEC
Q ss_conf             1016
Q gi|254780791|r  108 LIPS  111 (529)
Q Consensus       108 i~~~  111 (529)
T Consensus       264 ~~I~  267 (649)
T PRK12366        264 IGIV  267 (649)
T ss_pred             EEEC
T ss_conf             7850