HHsearch alignment for GI: 254780791 and conserved domain: TIGR03007

>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily; InterPro: IPR014345 Members of this entry belong to the family of polysaccharide chain length determinant proteins. They are found in species that encode the PEP-CTERM/exosortase system and are predicted to act in protein sorting in a number of Gram-negative bacteria, they are also found near the epsH homologue that is the putative exosortase gene..
Probab=96.97  E-value=0.069  Score=36.99  Aligned_cols=224  Identities=14%  Similarity=0.148  Sum_probs=110.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHH----------------------
Q ss_conf             7766999998887789988899998556776530497889867888788865456899----------------------
Q gi|254780791|r  281 LQSSLINLEARLNNIIIRLIKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHN----------------------  338 (529)
Q Consensus       281 L~~~L~~l~~RL~~a~~~~l~~~~q~L~~l~r~L~~~~~~L~~~~QrLd~~~~rL~~~----------------------  338 (529)
T Consensus       166 i~~Qik~Y~~kL~~aE~~L~~FK~~~~~~lp~~~~~y~~~l~~~~~~L~~~~l~~~e~~~~Rd~l~rQL~g~~Pv~~~~~  245 (510)
T TIGR03007       166 IDEQIKEYEKKLEAAENRLKAFKQENGGILPDQEGDYYSELSEAQEELEAARLELNEAKAQRDALKRQLAGEEPVLLAGS  245 (510)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEECCC
T ss_conf             99999999999999999999876873453779737899999999999999999999888767887514588661562368


Q ss_pred             ------------HHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHH
Q ss_conf             ------------99998756889999984101134688999999999999999998876555-67888877677777887
Q gi|254780791|r  339 ------------LEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHILEKQQHIEQIVKQHL-RYIFLEKKEKIAILHML  405 (529)
Q Consensus       339 ------------l~~~l~~~~~~l~~~~~rL~~~~~~~~l~~~r~~L~~~q~~L~q~~~~~l-~~~~~~~~~~~~~l~~l  405 (529)
T Consensus       246 g~~~~~s~~~~~~~~Ri~~L~~~Ld~L~l~YTd~HPd--v~~~k~~Ia~L~~~~~~e~~~~~~Q~~~~~~~~~~~~~nPv  323 (510)
T TIGR03007       246 GEKSASSVANSELDSRIEALEKQLDALRLRYTDKHPD--VIATKREIAQLEEQKEEELESYRKQNGEGGGSEKGSIYNPV  323 (510)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCHH--HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCH
T ss_conf             8866531235625689999999999863363011558--99999999999999889998898730345555566789831


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHCCCEEEEECCCCCEECCHHHCCCCCEE
Q ss_conf             50268899999999999999999999999999999999999988716967773146199984898895777892999869
Q gi|254780791|r  406 REQTKNRIFYLHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRI  485 (529)
Q Consensus       406 ~~~~~~~l~~~~~~l~~l~~rL~~~~~~~L~~~~~rL~~l~~~L~slsP~~~L~RGYaiv~~~~GkiI~s~~~l~~gd~i  485 (529)
T Consensus       324 yQql~~~l~~~eA~~asl~~r~~~-~~~~~~~l~~~~~~iP~veaEl---~~L~rdy~~~k~~Ye~Ll~R~e~A~~S~~~  399 (510)
T TIGR03007       324 YQQLQIELAEAEAEIASLEARVAE-LTARIERLESLLRTIPEVEAEL---TQLNRDYEVNKSNYEQLLARRESAEVSKQM  399 (510)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHE
T ss_conf             377899999999999999999999-9999999999975327999999---999988755588899999889855553303


Q ss_pred             EEEEECEEEEEEEEECCCCCCCCCCCC
Q ss_conf             999911099999950578887677777
Q gi|254780791|r  486 LINFFDGQANAIVINKAPPKEQPTKKC  512 (529)
Q Consensus       486 ~i~l~DG~v~a~V~~k~~~~~~~~~~~  512 (529)
T Consensus       400 e~~--~~~v~FRviDPP~~P~~PsgP~  424 (510)
T TIGR03007       400 EVQ--DKAVSFRVIDPPIVPSKPSGPN  424 (510)
T ss_pred             EEE--CCCEEEEEECCCCCCCCCCCCC
T ss_conf             320--6702467756756789999878