HHsearch alignment for GI: 254780791 and conserved domain: cd04100

>cd04100 Asp_Lys_Asn_RS_N Asp_Lys_Asn_RS_N: N-terminal, anticodon recognition domain of class 2b aminoacyl-tRNA synthetases (aaRSs). This domain is a beta-barrel domain (OB fold) involved in binding the tRNA anticodon stem-loop. Class 2b aaRSs include the homodimeric aspartyl-, asparaginyl-, and lysyl-tRNA synthetases (AspRS, AsnRS, and LysRS). aaRSs catalyze the specific attachment of amino acids (AAs) to their cognate tRNAs during protein biosynthesis. This 2-step reaction involves i) the activation of the AA by ATP in the presence of magnesium ions, followed by ii) the transfer of the activated AA to the terminal ribose of tRNA. In the case of the class2b aaRSs, the activated AA is attached to the 3'OH of the terminal ribose. Eukaryotes contain 2 sets of aaRSs, both of which are encoded by the nuclear genome. One set concerns with cytoplasmic protein synthesis, whereas the other exclusively with mitochondrial protein synthesis. Included in this group are archeal and archeal-like A
Probab=91.40  E-value=1.5  Score=25.15  Aligned_cols=76  Identities=17%  Similarity=0.228  Sum_probs=57.3

Q ss_pred             CEEEEEEECCCCCCCCCCEEEEEEECCCCEEEEEEECCCCCC---CCCCCCCCCEEEEEEEEEEEC----CCCEEEEEEE
Q ss_conf             189999970543568886279998748947999997352105---866814598899999966752----8843799999
Q gi|254780791|r   34 HVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNK---IEFLPEEGIEFLVIGKITTFP----GSSKYQIIIE  106 (529)
Q Consensus        34 ~~~v~gEis~~~~~~~sGH~Yf~lkd~~a~i~~~~~~~~~~~---~~~~~~~G~~v~~~g~~~~y~----~~g~~ql~v~  106 (529)
T Consensus         1 ~V~v~Gwv~~~R~--~g~~~Fi~lrD~~g~iQvv~~~~~~~~~~~~~~~l~~es~I~v~G~v~~~~~~~~~~g~~Ei~~~   78 (85)
T cd04100           1 EVTLAGWVHSRRD--HGGLIFIDLRDGSGIVQVVVNKEELGEFFEEAEKLRTESVVGVTGTVVKRPEGNLATGEIELQAE   78 (85)
T ss_pred             CEEEEEEEEEEEC--CCCEEEEEEECCCCEEEEEECCCCCHHHHHHHHCCCCCCEEEEEEEEEECCCCCCCCCCEEEEEE
T ss_conf             9999998790432--89889958503895089999177585788776358988899999999968877789988999993


Q ss_pred             EEEEC
Q ss_conf             71016
Q gi|254780791|r  107 SLIPS  111 (529)
Q Consensus       107 ~i~~~  111 (529)
T Consensus        79 ~i~il   83 (85)
T cd04100          79 ELEVL   83 (85)
T ss_pred             EEEEE
T ss_conf             99998