HHsearch alignment for GI: 254780791 and conserved domain: cd04316

>cd04316 ND_PkAspRS_like_N ND_PkAspRS_like_N: N-terminal, anticodon recognition domain of the type found in the homodimeric non-discriminating (ND) Pyrococcus kodakaraensis aspartyl-tRNA synthetase (AspRS). This domain is a beta-barrel domain (OB fold) involved in binding the tRNA anticodon stem-loop. P. kodakaraensis AspRS is a class 2b aaRS. aaRSs catalyze the specific attachment of amino acids (AAs) to their cognate tRNAs during protein biosynthesis. This 2-step reaction involves i) the activation the AA by ATP in the presence of magnesium ions, followed by ii) the transfer of the activated AA to the terminal ribose of tRNA. In the case of the class2b aaRSs, the activated AA is attached to the 3'OH of the terminal ribose. P. kodakaraensis ND-AspRS can charge both tRNAAsp and tRNAAsn. Some of the enzymes in this group may be discriminating, based on the presence of homologs of asparaginyl-tRNA synthetase (AsnRS) in their completed genomes.
Probab=92.77  E-value=1.1  Score=26.38  Aligned_cols=77  Identities=19%  Similarity=0.194  Sum_probs=58.4

Q ss_pred             CCEEEEEEECCCCCCCCCCEEEEEEECCCCEEEEEEECCCCCCCCC----CCCCCCEEEEEEEEEEECCC--CEEEEEEE
Q ss_conf             7189999970543568886279998748947999997352105866----81459889999996675288--43799999
Q gi|254780791|r   33 SHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNKIEF----LPEEGIEFLVIGKITTFPGS--SKYQIIIE  106 (529)
Q Consensus        33 ~~~~v~gEis~~~~~~~sGH~Yf~lkd~~a~i~~~~~~~~~~~~~~----~~~~G~~v~~~g~~~~y~~~--g~~ql~v~  106 (529)
T Consensus        13 ~~V~i~Gwv~~~R~--~g~~~Fi~LRD~~G~vQ~v~~~~~~~~~~~~~~~~l~~EsvV~V~G~V~-~~~~~~~giEi~v~   89 (108)
T cd04316          13 EEVTVAGWVHEIRD--LGGIKFVILRDREGIVQVTAPKKKVDKELFKTVRKLSRESVISVTGTVK-AEPKAPNGVEIIPE   89 (108)
T ss_pred             CEEEEEEEEEEEEC--CCCEEEEEEECCCEEEEEEEECCCCCHHHHHHHHCCCCCEEEEEEEEEE-ECCCCCCCEEEEEE
T ss_conf             99999899982321--7987999998098779999937888989999986599944999999999-48989996758964


Q ss_pred             EEEECC
Q ss_conf             710168
Q gi|254780791|r  107 SLIPSG  112 (529)
Q Consensus       107 ~i~~~g  112 (529)
T Consensus        90 ~i~ils   95 (108)
T cd04316          90 EIEVLS   95 (108)
T ss_pred             EEEEEE
T ss_conf             899985