>cd04487 RecJ_OBF2_like RecJ_OBF2_like: A subfamily of OB folds corresponding to the second OB fold (OBF2) of archaeal-specific proteins with similarity to eubacterial RecJ. RecJ is an ssDNA-specific exonuclease. Although the overall sequence similarity of these proteins to eubacterial RecJ proteins is marginal, they appear to carry motifs, which have been shown to be essential for nuclease function in Escherichia coli RecJ. In addition to this OB fold, most proteins in this subfamily contain: i) an N-terminal OB fold belonging to a different domain family (the ribosomal S1-like RNA-binding family); and ii) a domain, C-terminal to OBF2, characteristic of DHH family proteins. DHH family proteins include E. coli RecJ, and are predicted to have a phosphoesterase function.

Probab=96.18 E-value=0.041 Score=38.99 Aligned_cols=70 Identities=27% Similarity=0.406 Sum_probs=57.0 Q ss_pred EEEEEEECCCCCCCCCCEEEEEEECCCCEEEEEEECCCCCCCCCCC--CCCCEEEEEEEEEEECCCCEEEEEEEEEEE Q ss_conf 8999997054356888627999874894799999735210586681--459889999996675288437999997101 Q gi|254780791|r 35 VCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNKIEFLP--EEGIEFLVIGKITTFPGSSKYQIIIESLIP 110 (529) Q Consensus 35 ~~v~gEis~~~~~~~sGH~Yf~lkd~~a~i~~~~~~~~~~~~~~~~--~~G~~v~~~g~~~~y~~~g~~ql~v~~i~~ 110 (529) T Consensus 1 V~i~GeV~qik--QT~GPTIFti~Detg~v~~AAFee--aGvRAyPev~~gdiV~v~G~V~~r--~g~lQiE~~~~~~ 72 (73) T cd04487 1 VHIEGEVVQIK--QTSGPTIFTLRDETGTVWAAAFEE--AGVRAYPEVEVGDIVRVTGEVEPR--DGQLQIEVESLEV 72 (73) T ss_pred CEEEEEEEEEE--ECCCCEEEEEECCCCCEEHHHHCC--CCCCCCCCCCCCCEEEEEEEEEEE--CCEEEEEEEEEEC T ss_conf 97999999989--889999999975999698205130--674128887889889999899970--8858999730250

HHsearch alignment for GI: 254780791 and conserved domain: cd04487