HHsearch alignment for GI: 254780791 and conserved domain: cd04492

>cd04492 YhaM_OBF_like YhaM_OBF_like: A subfamily of OB folds similar to that found in Bacillus subtilis YhaM and Staphylococcus aureus cmp-binding factor-1 (SaCBF1). Both these proteins are 3'-to-5'exoribonucleases. YhaM requires Mn2+ or Co2+ for activity and is inactive in the presence of Mg2+. YhaM also has a Mn2+ dependent 3'-to-5'single-stranded DNA exonuclease activity. SaCBF is also a double-stranded DNA binding protein, binding specifically to cmp, the replication enhancer found in S. aureus plasmid pT181. Proteins in this group combine an N-terminal OB fold with a C-terminal HD domain. The HD domain is found in metal-dependent phosphohydrolases.
Probab=96.74  E-value=0.023  Score=41.22  Aligned_cols=75  Identities=19%  Similarity=0.312  Sum_probs=53.7

Q ss_pred             EEEEEEECCCCCCCCCCEEE--EEEECCCCEEEEEEECCCCCCCCCCCCCCCEEEEEEEEEEECCCCEEEEEEEEEEECC
Q ss_conf             89999970543568886279--9987489479999973521058668145988999999667528843799999710168
Q gi|254780791|r   35 VCVRGEISGYRGIHSSGHAY--FSLKDNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSG  112 (529)
Q Consensus        35 ~~v~gEis~~~~~~~sGH~Y--f~lkd~~a~i~~~~~~~~~~~~~~~~~~G~~v~~~g~~~~y~~~g~~ql~v~~i~~~g  112 (529)
T Consensus         3 ~fli~~~~~-~-~tk~G~~Yl~l~L~D~tG~I~ak~W~~~~~~-~~~~~~g~~V~v~G~v~~y--~g~~Ql~I~~i~~~~   77 (83)
T cd04492           3 FFLIKSKEL-R-TAKNGKPYLALTLQDKTGEIEAKLWDASEED-EEKFKPGDIVHVKGRVEEY--RGRLQLKIQRIRLVT   77 (83)
T ss_pred             EEEEEEHHH-H-CCCCCCCEEEEEEECCCCEEEEEECCCCHHH-HHCCCCCCEEEEEEEEEEE--CCCEEEEEEEEEECC
T ss_conf             999998010-0-0579991789999878876888885788678-8307899999999999888--995108998968998


Q ss_pred             CC
Q ss_conf             00
Q gi|254780791|r  113 SG  114 (529)
Q Consensus       113 ~G  114 (529)
T Consensus        78 ~~   79 (83)
T cd04492          78 EE   79 (83)
T ss_pred             CC
T ss_conf             34