HHsearch alignment for GI: 254780791 and conserved domain: pfam00465

>pfam00465 Fe-ADH Iron-containing alcohol dehydrogenase.
Probab=95.36  E-value=0.19  Score=33.11  Aligned_cols=70  Identities=23%  Similarity=0.372  Sum_probs=48.0

Q ss_pred             CEEEEEECCCHH---HHHHHHHHHHHCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCEEEEECCCCCHH
Q ss_conf             289998478425---89999998630597589997210011110367999999997410035767775899951688844
Q gi|254780791|r  146 KIIAVITSPTGA---VIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIE  222 (529)
Q Consensus       146 ~~i~vits~~~a---~~~D~~~~~~~r~p~~~~~~p~~vQG~~a~~~i~~ai~~~~~~~~~~~~~~~D~iii~RGGGS~e  222 (529)
T Consensus        23 ~r~llVt~~~~~~~g~~~~l~~~L~~~-~~~~~~~-~~v~~~p~~~~v~~~~~~~~~~~-------~D-~IIaiGGGS~i   92 (312)
T pfam00465        23 ARALIVTDPSLKKLGLLDRVLDSLEEA-GIEVVVF-DGVEPNPTLEEVDEAAAAAREEG-------AD-VIIAVGGGSVI   92 (312)
T ss_pred             CEEEEEECCCHHHCCHHHHHHHHHHHC-CCEEEEE-CCCCCCCCHHHHHHHHHHHHHCC-------CC-EEEECCCCCCC
T ss_conf             979999895856676399999999974-9949998-58279999999999999999649-------98-99980897612


Q ss_pred             HHH
Q ss_conf             422
Q gi|254780791|r  223 DLW  225 (529)
Q Consensus       223 DL~  225 (529)
T Consensus        93 D~a   95 (312)
T pfam00465        93 DTA   95 (312)
T ss_pred             HHH
T ss_conf             499