HHsearch alignment for GI: 254780791 and conserved domain: pfam01336

>pfam01336 tRNA_anti OB-fold nucleic acid binding domain. This family contains OB-fold domains that bind to nucleic acids. The family includes the anti-codon binding domain of lysyl, aspartyl, and asparaginyl -tRNA synthetases (See pfam00152). Aminoacyl-tRNA synthetases catalyse the addition of an amino acid to the appropriate tRNA molecule EC:6.1.1.-. This family also includes part of RecG helicase involved in DNA repair. Replication factor A is a heterotrimeric complex, that contains a subunit in this family. This domain is also found at the C-terminus of bacterial DNA polymerase III alpha chain.
Probab=97.91  E-value=0.0001  Score=62.25  Aligned_cols=74  Identities=23%  Similarity=0.405  Sum_probs=62.8

Q ss_pred             EEEEEEECCCCCCCCCCEEEEEEECCCCEEEEEEECCCCCCCCCCCCCCCEEEEEEEEEEECCCCEEEEEEEEEEE
Q ss_conf             8999997054356888627999874894799999735210586681459889999996675288437999997101
Q gi|254780791|r   35 VCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIP  110 (529)
Q Consensus        35 ~~v~gEis~~~~~~~sGH~Yf~lkd~~a~i~~~~~~~~~~~~~~~~~~G~~v~~~g~~~~y~~~g~~ql~v~~i~~  110 (529)
T Consensus         1 v~v~G~V~~~~-~~~~~~~~~~l~D~tg~i~~~~~~~~~~~~~~~l~~g~~v~v~G~v~~~-~~~~~~i~~~~i~~   74 (75)
T pfam01336         1 VTVAGRVTSVR-RSGGKVAFLTLRDGTGSIQVVLFKEEAEKLAKKLKEGDVVLVTGKVKKR-PGGELELVVEEIEV   74 (75)
T ss_pred             CEEEEEEEEEE-ECCCCEEEEEEEECCEEEEEEEEHHHHHHHHHCCCCCCEEEEEEEEEEC-CCCCEEEEEEEEEE
T ss_conf             99999999518-8799989999997993999999523868886328989899999999997-49989999989997