HHsearch alignment of GI: 254780791 and MMDB domain: 1o1y_A_

>1o1y_A (A:) Conserved hypothetical protein TM1158; structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.70A {Thermotoga maritima}
Probab=90.79  E-value=0.71  Score=27.40  Aligned_cols=88  Identities=8%  Similarity=-0.003  Sum_probs=65.1

Q ss_pred             CCCCCCCCEEEEEECCCHHHHHHHHHHHHHCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCEEEEECCC
Q ss_conf             63102652899984784258999999863059758999721001111036799999999741003576777589995168
Q gi|254780791|r  139 NPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGG  218 (529)
Q Consensus       139 ~~lP~~p~~i~vits~~~a~~~D~~~~~~~r~p~~~~~~p~~vQG~~a~~~i~~ai~~~~~~~~~~~~~~~D~iii~RGG  218 (529)
                      -+-|..+.+|+||--..+..++.+.+.+..+- +++.+++...-.. .+                .....+|.|||.=|+
T Consensus         6 ~~~~~~~~~i~vid~~~~~~~~~~~~~l~~~g-~~~~v~~~~~~~~-~~----------------~~~~~~Dgiii~Gg~   67 (239)
T 1o1y_A            6 IHHHHHHVRVLAIRHVEIEDLGXXEDIFREKN-WSFDYLDTPKGEK-LE----------------RPLEEYSLVVLLGGY   67 (239)
T ss_dssp             ----CCCCEEEEECSSTTSSCTHHHHHHHHTT-CEEEEECGGGTCC-CS----------------SCGGGCSEEEECCCS
T ss_pred             CCCCCCCCEEEEEECCCCCCCHHHHHHHHHCC-CEEEEEECCCCCC-CC----------------CCHHHCCEEEECCCC
T ss_conf             44345640799997999889769999999788-9799998989877-87----------------674447989988999


Q ss_pred             CCHHH----HHHCCHHHHHHHHHHCCCEEE
Q ss_conf             88444----220076999999974890488
Q gi|254780791|r  219 GSIED----LWHFNDEMIVRAIANSSIPII  244 (529)
Q Consensus       219 GS~eD----L~~FN~e~laraI~~~~iPVi  244 (529)
                      +|..|    -|......+++..++..+||+
T Consensus        68 ~~~~~~~~~~~~~~~~~~i~~~~~~~~Pil   97 (239)
T 1o1y_A           68 XGAYEEEKYPFLKYEFQLIEEILKKEIPFL   97 (239)
T ss_dssp             CCTTCTTTCTHHHHHHHHHHHHHHHTCCEE
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHCCCCEE
T ss_conf             987777678322999999999997699999