HHsearch alignment of GI: 254780791 and MMDB domain: 1xah_A_1-165

>1xah_A (A:1-165) Sadhqs, 3-dehydroquinate synthase; shikimate pathway, aromatic amino acid biosynthesis, open form, form B, domain movement, cyclase; HET: NAD; 2.20A {Staphylococcus aureus} PDB: 1xag_A* 1xai_A* 1xaj_A* 1xal_A*
Probab=91.15  E-value=0.91  Score=26.43  Aligned_cols=91  Identities=15%  Similarity=0.162  Sum_probs=55.0

Q ss_pred             CCCEEEEEECCCH-HHHHHHHHHHHHCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCEEEEECCCCCHH
Q ss_conf             6528999847842-589999998630597589997210011110367999999997410035767775899951688844
Q gi|254780791|r  144 IPKIIAVITSPTG-AVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIE  222 (529)
Q Consensus       144 ~p~~i~vits~~~-a~~~D~~~~~~~r~p~~~~~~p~~vQG~~a~~~i~~ai~~~~~~~~~~~~~~~D~iii~RGGGS~e  222 (529)
                      -.+++.|||.+.. .++.|-+...-++..+++.+|.. +.++-....+-++++.+....    ..++| .||+=||||.-
T Consensus        30 ~~~~~livtd~~~~~~~~~~i~~~L~~~~~~~~~~~~-~~~~p~~~~v~~~~~~~~~~~----~~~~d-~iiaiGGGs~~  103 (165)
T 1xah_A           30 QFDQSFLLIDEYVNQYFANKFDDILSYENVHKVIIPA-GEKTKTFEQYQETLEYILSHH----VTRNT-AIIAVGGGATG  103 (165)
T ss_dssp             TCSCEEEEEEHHHHHHHHHHHC------CEEEEEECS-GGGGCSHHHHHHHHHHHHTTC----CCTTC-EEEEEESHHHH
T ss_pred             HCCCEEEEECCCHHHHHHHHHHHHHHHCCCEEEEECC-CCCCCCHHHHHHHHHHHHHHH----HHCCC-CEEEECCHHHH
T ss_conf             3597999999857899999999999777957999728-876677878999888888765----41234-21452427888


Q ss_pred             HHHHCCHHHHHHHHHHCCCEEEE
Q ss_conf             42200769999999748904885
Q gi|254780791|r  223 DLWHFNDEMIVRAIANSSIPIIS  245 (529)
Q Consensus       223 DL~~FN~e~laraI~~~~iPVis  245 (529)
                      |++.|     +...+..++|+|+
T Consensus       104 D~ak~-----~a~~~~~~~p~i~  121 (165)
T 1xah_A          104 DFAGF-----VAATLLRGVHFIQ  121 (165)
T ss_dssp             HHHHH-----HHHHBTTCCEEEE
T ss_pred             HHHHH-----HHHHHCCCCCEEE
T ss_conf             78766-----0253237862477