HHsearch alignment of GI: 254780791 and MMDB domain: 1z9f_A_

>1z9f_A (A:) Single-strand binding protein; TM0604, single stranded DNA-binding protein, structural genomics, joint center for structural genomics, JCSG; 2.30A {Thermotoga maritima}
Probab=93.69  E-value=0.37  Score=29.95  Aligned_cols=81  Identities=12%  Similarity=0.157  Sum_probs=59.8

Q ss_pred             CCCCEEEEEEECC---CCCCCCCCEEE--EEE------ECCC-------CEEEEEEECCCCCCCCCCCCCCCEEEEEEEE
Q ss_conf             0171899999705---43568886279--998------7489-------4799999735210586681459889999996
Q gi|254780791|r   31 NLSHVCVRGEISG---YRGIHSSGHAY--FSL------KDNH-------SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKI   92 (529)
Q Consensus        31 ~~~~~~v~gEis~---~~~~~~sGH~Y--f~l------kd~~-------a~i~~~~~~~~~~~~~~~~~~G~~v~~~g~~   92 (529)
                      .+..|-+.|-|..   ++. ..+|..|  |+|      +|..       .-++|++|...+..+.-.++.|+.|+|.|++
T Consensus        15 ~mn~v~l~G~l~~dpei~~-~~~g~~~~~~~la~~~~~~~~~~~~~~~t~~~~v~~~g~~A~~~~~~l~KG~~V~V~G~l   93 (153)
T 1z9f_A           15 FFNKIILIGRLVRDPEERY-TLSGTPVTTFTIAVDRVPRKNAPDDAQTTDFFRIVTFGRLAEFARTYLTKGRLVLVEGEM   93 (153)
T ss_dssp             CCCCEEEEEEESSCCEEEE-CC--CEEEEEEEEEEC-----------CEEEEEEEEEHHHHHHHHHHCCTTCEEEEEEEE
T ss_pred             HCCEEEEEEEECCCCEEEE-CCCCCEEEEEEEEEECCCCCCCCCCCEEEEEEEEEECCCCCHHHHHHCCCCCEEEEEEEE
T ss_conf             4788999999377988998-899988999988770420146774210101244453000000111201588489999966


Q ss_pred             EE--EC-----CCCEEEEEEEEEEECC
Q ss_conf             67--52-----8843799999710168
Q gi|254780791|r   93 TT--FP-----GSSKYQIIIESLIPSG  112 (529)
Q Consensus        93 ~~--y~-----~~g~~ql~v~~i~~~g  112 (529)
                      ..  |.     .+..+.+.+++|....
T Consensus        94 ~~~~~~~~~G~~~~~~~i~a~~i~~l~  120 (153)
T 1z9f_A           94 RMRRWETPTGEKRVSPEVVANVVRFMD  120 (153)
T ss_dssp             EEEC-------CCCEEEEEEEEEEECC
T ss_pred             EEEEEECCCCCEEEEEEEEEEEEEECC
T ss_conf             643789999989999999994899876