HHsearch alignment of GI: 254780791 and MMDB domain: 2hpi_A_1024-1128

>2hpi_A (A:1024-1128) DNA polymerase III alpha subunit; POL-beta-like nucleotidyltransferase fold; HET: DNA; 3.00A {Thermus aquaticus} PDB: 2hpm_A* 3e0d_A*
Probab=96.74  E-value=0.0065  Score=45.57  Aligned_cols=76  Identities=14%  Similarity=0.298  Sum_probs=64.9

Q ss_pred             CCEEEEEEECCCCCC-CCCCEE--EEEEECCCCEEEEEEECCCCCCCCCCCCCCCEEEEEEEEEEECCCCEEEEEEEEEE
Q ss_conf             718999997054356-888627--99987489479999973521058668145988999999667528843799999710
Q gi|254780791|r   33 SHVCVRGEISGYRGI-HSSGHA--YFSLKDNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLI  109 (529)
Q Consensus        33 ~~~~v~gEis~~~~~-~~sGH~--Yf~lkd~~a~i~~~~~~~~~~~~~~~~~~G~~v~~~g~~~~y~~~g~~ql~v~~i~  109 (529)
                      ..+++.|-|++++.. .++|..  +|+|-|..+.+.|++|...+....-.++.|.-|++.|+++ |  +++++|.++.+.
T Consensus        20 ~~v~i~G~v~~~~~~~tk~G~~~a~~~leD~tg~~e~~~F~~~~~~~~~~l~~~~~v~i~g~v~-~--~~~~~l~v~~i~   96 (105)
T 2hpi_A           20 PKVLLSGMVEEVVRKPTRSGGMMARFTLSDETGALEVVVFGRAYEGVSPKLKEDIPLLVLAEVE-K--GEELRVLAQAVW   96 (105)
T ss_dssp             CEEEEEEEECCC------------CEEEEETTEEEEEC-------------CTTCEEEEEEEEC--------CEEEEEEE
T ss_pred             CEEEEEEEEEEEEECCCCCCCEEEEEEEEECCCCEEEEECHHHHHHHHHHHCCCCEEEEEEEEE-E--CCCEEEEEEECC
T ss_conf             7899999998999701789997999999989987899984799999988851498799999999-7--895289996636


Q ss_pred             EC
Q ss_conf             16
Q gi|254780791|r  110 PS  111 (529)
Q Consensus       110 ~~  111 (529)
                      +-
T Consensus        97 ~l   98 (105)
T 2hpi_A           97 TL   98 (105)
T ss_dssp             EH
T ss_pred             CH
T ss_conf             59