HHsearch alignment of GI: 254780791 and MMDB domain: 3koj_A_

>3koj_A (A:) Uncharacterized protein YCF41; single-strand binding protein family, PF00436, SNR59A, NESG, structural genomics, PSI-2; 1.90A {Synechococcus elongatus pcc 6301}
Probab=90.69  E-value=0.49  Score=28.81  Aligned_cols=77  Identities=6%  Similarity=0.119  Sum_probs=54.0

Q ss_pred             CCCEEEEEEECC---CCCCCCCCE--EEEEEEC--------CCCEEEEEEECCCCCCCCCCCCCCCEEEEEEEEEEE--C
Q ss_conf             171899999705---435688862--7999874--------894799999735210586681459889999996675--2
Q gi|254780791|r   32 LSHVCVRGEISG---YRGIHSSGH--AYFSLKD--------NHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTF--P   96 (529)
Q Consensus        32 ~~~~~v~gEis~---~~~~~~sGH--~Yf~lkd--------~~a~i~~~~~~~~~~~~~~~~~~G~~v~~~g~~~~y--~   96 (529)
                      +..|-+.|-|.+   ++. ..+|.  +.|.+..        ...-++|++|...+..+.-.++-|+.|+|.|++..+  .
T Consensus        11 ~N~v~l~G~l~~dp~~~~-t~~g~~~~~~~~~~~~~~~~~~~~~~i~v~~wg~~Ae~~~~~l~KG~~V~V~G~l~~~~~~   89 (108)
T 3koj_A           11 XNSCILQATVVEAPQLRY-AQDNQTPVAEXVVQFPGLSSKDAPARLKVVGWGAVAQELQDRCRLNDEVVLEGRLRINSLL   89 (108)
T ss_dssp             CEEEEEEEEEEEEEEEEE-CTTSSSEEEEEEEEECC-----CCEEEEEEEETHHHHHHHHHCCTTCEEEEEEEEEEEC--
T ss_pred             CCEEEEEEEECCCCEEEE-CCCCCEEEEEEEEEECCCCCCCCCEEEEEEEEHHHHHHHHHHCCCCCEEEEEEEEECEEEE
T ss_conf             899999999877976888-2899879999999968984578976999999789999999860899999999998780789


Q ss_pred             -----CCCEEEEEEEEEE
Q ss_conf             -----8843799999710
Q gi|254780791|r   97 -----GSSKYQIIIESLI  109 (529)
Q Consensus        97 -----~~g~~ql~v~~i~  109 (529)
                           .+..++++++.|.
T Consensus        90 ~~dG~~~~~~~i~a~~i~  107 (108)
T 3koj_A           90 KPDGNREKQTELTVTRVH  107 (108)
T ss_dssp             ------CCEEEEEEEEEE
T ss_pred             CCCCCEEEEEEEEEEECC
T ss_conf             999989999999999716