HHsearch alignment of GI: 254780791 and MMDB domain: 3lft_A_118-235

>3lft_A (A:118-235) Uncharacterized protein; ABC, ATPase, cassette, L-Trp, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE TRP; 1.35A {Streptococcus pneumoniae}
Probab=92.36  E-value=1  Score=25.98  Aligned_cols=85  Identities=20%  Similarity=0.173  Sum_probs=60.1

Q ss_pred             CCCEEEEEECCC---HHHHHHHHHHHHHCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCEEEEECCCCC
Q ss_conf             652899984784---25899999986305975899972100111103679999999974100357677758999516888
Q gi|254780791|r  144 IPKIIAVITSPT---GAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGS  220 (529)
Q Consensus       144 ~p~~i~vits~~---~a~~~D~~~~~~~r~p~~~~~~p~~vQG~~a~~~i~~ai~~~~~~~~~~~~~~~D~iii~RGGGS  220 (529)
                      -.++|||+-+++   +...-+.++....++++++..+++.     .+.+|-.+++.+-.        .+|+|++.     
T Consensus        15 ~~k~vgvly~~~e~~s~~~~~~l~~~a~~~Gi~l~~~~v~-----~~~di~~~~~~~~~--------~~dai~~~-----   76 (118)
T 3lft_A           15 NVKTIGALYSSSEDNSKTQVEEFKAYAEKAGLTVETFAVP-----STNEIASTVTVXTS--------KVDAIWVP-----   76 (118)
T ss_dssp             TCCEEEEEEETTCHHHHHHHHHHHHHHHHTTCEEEEEEES-----SGGGHHHHHHHHTT--------TCSEEEEC-----
T ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHHHHHCCCEEEEECCC-----CHHHHHHHHHHCCC--------CCEEEEEC-----
T ss_conf             8864689669753129999999998666417568750466-----67999999983678--------86199973-----


Q ss_pred             HHHHHHC-CHHHHHHHHHHCCCEEEEEE
Q ss_conf             4442200-76999999974890488520
Q gi|254780791|r  221 IEDLWHF-NDEMIVRAIANSSIPIISAI  247 (529)
Q Consensus       221 ~eDL~~F-N~e~laraI~~~~iPVisgI  247 (529)
                       .|-..+ +-+.++......+||||++-
T Consensus        77 -~d~~v~s~~~~i~~~a~~~~iPv~~~~  103 (118)
T 3lft_A           77 -IDNTIASGFPTVVSSNQSSKKPIYPSA  103 (118)
T ss_dssp             -SCHHHHHTHHHHHHHTTTTCCCEEESS
T ss_pred             -CCHHHHHHHHHHHHHHCCCCCCEEEEE
T ss_conf             -870688899999985202478678631