HHsearch results for GI: 254780791 and protein with PDBid: 1jq5_A

>1jq5_A Glycerol dehydrogenase; oxidoreductase, NAD, glycerol metabolism; HET: NAD; 1.70A {Geobacillus stearothermophilus} SCOP: e.22.1.2 PDB: 1jpu_A* 1jqa_A*
Probab=91.63  E-value=0.41  Score=28.15  Aligned_cols=72  Identities=15%  Similarity=0.134  Sum_probs=45.7

Q ss_pred             CCEEEEEECCCHH--HHHHHHHHHHHCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCEEEEECCCCCHH
Q ss_conf             5289998478425--89999998630597589997210011110367999999997410035767775899951688844
Q gi|254780791|r  145 PKIIAVITSPTGA--VIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIE  222 (529)
Q Consensus       145 p~~i~vits~~~a--~~~D~~~~~~~r~p~~~~~~p~~vQG~~a~~~i~~ai~~~~~~~~~~~~~~~D~iii~RGGGS~e  222 (529)
                      -+|+.|||.+...  +..++.+.+.+.. +.+.  ...+.|+-...+|-++.+.+...       ++| .||+=||||.-
T Consensus        31 g~r~lvv~d~~~~~~~~~~v~~~L~~~~-i~~~--~~~~~~~~t~~~v~~~~~~~~~~-------~~D-~IvavGGGs~~   99 (370)
T 1jq5_A           31 GNKTVVIADEIVWKIAGHTIVNELKKGN-IAAE--EVVFSGEASRNEVERIANIARKA-------EAA-IVIGVGGGKTL   99 (370)
T ss_dssp             CSEEEEEECHHHHHHTHHHHHHHHHTTT-CEEE--EEECCSSCBHHHHHHHHHHHHHT-------TCS-EEEEEESHHHH
T ss_pred             CCEEEEEECCCHHHHHHHHHHHHHHHCC-CEEE--EEEECCCCCHHHHHHHHHHHHHC-------CCC-EEEECCCCCCC
T ss_conf             9959999897688999999999998779-9699--99959999999999999997604-------887-89973786302


Q ss_pred             HHHHC
Q ss_conf             42200
Q gi|254780791|r  223 DLWHF  227 (529)
Q Consensus       223 DL~~F  227 (529)
                      |+.-|
T Consensus       100 D~aK~  104 (370)
T 1jq5_A          100 DTAKA  104 (370)
T ss_dssp             HHHHH
T ss_pred             CHHHH
T ss_conf             01212