HHsearch results for GI: 254780791 and protein with PDBid: 1oj7_A

>1oj7_A Hypothetical oxidoreductase YQHD; structural genomics; HET: NZQ; 2.0A {Escherichia coli} SCOP: e.22.1.2
Probab=94.30  E-value=0.075  Score=34.72  Aligned_cols=68  Identities=19%  Similarity=0.290  Sum_probs=47.2

Q ss_pred             CEEEEEECCCHHH----HHHHHHHHHHCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCEEEEECCCCCH
Q ss_conf             2899984784258----999999863059758999721001111036799999999741003576777589995168884
Q gi|254780791|r  146 KIIAVITSPTGAV----IRDILQRISCRFPLRVIIFPVKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSI  221 (529)
Q Consensus       146 ~~i~vits~~~a~----~~D~~~~~~~r~p~~~~~~p~~vQG~~a~~~i~~ai~~~~~~~~~~~~~~~D~iii~RGGGS~  221 (529)
                      +|+.|||+.....    +.++...|+   +.++.+|. -|.++-....+-++++.+...+       +|+ ||+=||||.
T Consensus        51 ~r~llV~~~~~~~~~g~~~~v~~~L~---g~~v~~f~-~v~~~P~~~~v~~~~~~~r~~~-------~D~-IIavGGGS~  118 (408)
T 1oj7_A           51 ARVLITYGGGSVKKTGVLDQVLDALK---GMDVLEFG-GIEPNPAYETLMNAVKLVREQK-------VTF-LLAVGGGSV  118 (408)
T ss_dssp             CEEEEEECSSHHHHHSHHHHHHHHTT---TSEEEEEC-CCCSSCBHHHHHHHHHHHHHHT-------CCE-EEEEESHHH
T ss_pred             CCEEEEECCCHHHHCCHHHHHHHHHC---CCCEEEEE-CCCCCCCHHHHHHHHHHHHHCC-------CCE-EEECCCCCH
T ss_conf             96899989527877539999999827---99179980-8237989999999999997559-------988-998089634


Q ss_pred             HHHH
Q ss_conf             4422
Q gi|254780791|r  222 EDLW  225 (529)
Q Consensus       222 eDL~  225 (529)
                      -|..
T Consensus       119 iD~A  122 (408)
T 1oj7_A          119 LDGT  122 (408)
T ss_dssp             HHHH
T ss_pred             HHHH
T ss_conf             3334