HHsearch results for GI: 254780791 and protein with PDBid: 1se8_A

>1se8_A Single-strand binding protein; DNA binding protein; 1.80A {Deinococcus radiodurans} SCOP: b.40.4.3
Probab=92.23  E-value=0.72  Score=25.96  Aligned_cols=81  Identities=17%  Similarity=0.145  Sum_probs=57.1

Q ss_pred             CCCCEEEEEEECC---CCCCCCCCEEE--EEE------ECCC-------CEEEEEEECCCCCCC-CCCCCCCCEEEEEEE
Q ss_conf             0171899999705---43568886279--998------7489-------479999973521058-668145988999999
Q gi|254780791|r   31 NLSHVCVRGEISG---YRGIHSSGHAY--FSL------KDNH-------SRIDAIIWKGTLNKI-EFLPEEGIEFLVIGK   91 (529)
Q Consensus        31 ~~~~~~v~gEis~---~~~~~~sGH~Y--f~l------kd~~-------a~i~~~~~~~~~~~~-~~~~~~G~~v~~~g~   91 (529)
                      .+..|-|.|-|..   ++. ..+|..|  |+|      ++..       --+.|++|...+..+ .-.++.|+.|.|.|+
T Consensus         4 ~mN~v~l~G~l~~dpe~~~-~~~g~~v~~f~lA~~~~~~~~~g~~~~~~~~~~v~~~g~~ae~~~~~~l~KG~~V~V~G~   82 (301)
T 1se8_A            4 GMNHVYLIGALARDPELRY-TGNGMAVFEATVAGEDRVIGNDGRERNLPWYHRVSILGKPAEWQAERNLKGGDAVVVEGT   82 (301)
T ss_dssp             CEEEEEEEEEESSCCEEEE-CTTSCEEEEEEEEEEEEC-------CEEEEEEEEEEESHHHHHHHHTCCCTTCEEEEEEE
T ss_pred             CCEEEEEEEEECCCCEEEE-CCCCCEEEEEEEEECCCEECCCCCEEECCEEEEEEEECHHHHHHHHHHCCCCCEEEEEEE
T ss_conf             5149999999366988998-899988999999978955879998973347999999887999999872566878999999


Q ss_pred             EE--EEC-----CCCEEEEEEEEEEECC
Q ss_conf             66--752-----8843799999710168
Q gi|254780791|r   92 IT--TFP-----GSSKYQIIIESLIPSG  112 (529)
Q Consensus        92 ~~--~y~-----~~g~~ql~v~~i~~~g  112 (529)
                      +.  .|.     .++.+.+++++|+.-+
T Consensus        83 l~~~~~~dkdG~~r~~~~i~a~~v~~l~  110 (301)
T 1se8_A           83 LEYRQWEAPEGGKRSAVNVKALRMEQLG  110 (301)
T ss_dssp             EEEEEEC-----CEEEEEEEEEEEEECS
T ss_pred             EEEEEEECCCCCEEEEEEEEEEEEEECC
T ss_conf             7851239899988999999998999815