HHsearch results for GI: 254780791 and protein with PDBid: 2hpi_A

>2hpi_A DNA polymerase III alpha subunit; POL-beta-like nucleotidyltransferase fold; HET: DNA; 3.00A {Thermus aquaticus} PDB: 2hpm_A* 3e0d_A*
Probab=96.61  E-value=0.01  Score=42.56  Aligned_cols=53  Identities=13%  Similarity=0.391  Sum_probs=20.1

Q ss_pred             EEEECCCCEEEEEEECCCCCCCCCCCCCCCEEEEEEEEEEECCCCEEEEEEEEEEE
Q ss_conf             99874894799999735210586681459889999996675288437999997101
Q gi|254780791|r   55 FSLKDNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIP  110 (529)
Q Consensus        55 f~lkd~~a~i~~~~~~~~~~~~~~~~~~G~~v~~~g~~~~y~~~g~~ql~v~~i~~  110 (529)
                      |+|-|..+.+.|++|...+.+..-.+++|.-|++.|+++   .+++.+++|+.|.+
T Consensus      1068 ~tleD~tG~iev~vF~~~y~~~~~~L~~~~~l~v~G~v~---~~~~~~i~~~~i~~ 1120 (1220)
T 2hpi_A         1068 FTLSDETGALEVVVFGRAYEGVSPKLKEDIPLLVLAEVE---KGEELRVLAQAVWT 1120 (1220)
T ss_dssp             EEEEETTEEEEEC-------------CTTCEEEEEEEEC--------CEEEEEEEE
T ss_pred             EEEEECCCCEEEEECHHHHHHHHHHHCCCCEEEEEEEEE---ECCCEEEEEEECCC
T ss_conf             999989998899983799999988753598799999999---89944899835155