HHsearch results for GI: 254780791 and protein with PDBid: 3bju_A

>3bju_A Lysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP- binding, cytoplasm, ligase, nucleotide-binding, phosphoprotein, polymorphism; HET: LYS ATP; 2.31A {Homo sapiens}
Probab=90.96  E-value=0.97  Score=24.82  Aligned_cols=104  Identities=18%  Similarity=0.275  Sum_probs=70.1

Q ss_pred             CCCCCCCCCCCCCCCCHHHHHHHHHHHHHH-CC--CCEEEEEEECCCCCCCCCCE-EEEEEECCCCEEEEEEECCCCCC-
Q ss_conf             998888888889862299999999999740-01--71899999705435688862-79998748947999997352105-
Q gi|254780791|r    1 MNPFSQKNSLDHPEYSVSELSYHLKHIVES-NL--SHVCVRGEISGYRGIHSSGH-AYFSLKDNHSRIDAIIWKGTLNK-   75 (529)
Q Consensus         1 ~~~~~~~~~~~~~~~svs~l~~~i~~~l~~-~~--~~~~v~gEis~~~~~~~sGH-~Yf~lkd~~a~i~~~~~~~~~~~-   75 (529)
                      ++|+|.+.   .+-.|+.++...-+.+-++ .+  ..|+|.|=|.+.|.  .+|. ++++|.|....|.||+=+..... 
T Consensus        24 ~~pyp~~~---~~t~s~~~~~~~~~~l~~~~~~~~~~V~v~Gwv~~~R~--~ggkl~Fi~LrD~sg~iQvv~~~~~~~~~   98 (521)
T 3bju_A           24 EDPYPHKF---HVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRA--SGGKLIFYDLRGEGVKLQVMANSRNYKSE   98 (521)
T ss_dssp             CCSSCSCC---CCCSCHHHHHHHHTTCCTTCBCSSCCEEEEEEEEEEEE--SSSSEEEEEEEETTEEEEEEEEGGGSSCH
T ss_pred             CCCCCCCC---CCCCCHHHHHHHHHCCCCCCCCCCCEEEEEEEEEEEEC--CCCCEEEEEEECCCEEEEEEEECCCCCCH
T ss_conf             99999878---48770999999850478765358988999899780777--99938999997798899999958867788


Q ss_pred             -----CCCCCCCCCEEEEEEEEEEECCCCEEEEEEEEEEE
Q ss_conf             -----86681459889999996675288437999997101
Q gi|254780791|r   76 -----IEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIP  110 (529)
Q Consensus        76 -----~~~~~~~G~~v~~~g~~~~y~~~g~~ql~v~~i~~  110 (529)
                           +.-.+.-|+-|.+.|.+. -.+.|.+.+.+.++..
T Consensus        99 ~~~~~~~~~l~~~~~v~v~g~~~-~~~~~elev~~~~i~v  137 (521)
T 3bju_A           99 EEFIHINNKLRRGDIIGVQGNPG-KTKKGELSIIPYEITL  137 (521)
T ss_dssp             HHHHHHHHHCCTTCEEEEEEEEE-ECTTCCEEEEEEEEEE
T ss_pred             HHHHHHHCEEEEEEEEEEEEEEC-CCCCCEEEEEEEEEEE
T ss_conf             99999738277766999985773-6787312111223466