HHSEARCH alignment of GI: 254780791 and SCOP domain: d1jq5a_

Alignment
>d1jq5a_ e.22.1.2 (A:) Glycerol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}
Probab=92.34  E-value=0.22  Score=28.38  Aligned_cols=89  Identities=16%  Similarity=0.150  Sum_probs=51.9

Q ss_pred             CCEEEEEECCCHH--HHHHHHHHHHHCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCEEEEECCCCCHH
Q ss_conf             5289998478425--89999998630597589997210011110367999999997410035767775899951688844
Q gi|254780791|r  145 PKIIAVITSPTGA--VIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIE  222 (529)
Q Consensus       145 p~~i~vits~~~a--~~~D~~~~~~~r~p~~~~~~p~~vQG~~a~~~i~~ai~~~~~~~~~~~~~~~D~iii~RGGGS~e  222 (529)
                      -+|+-|||.+...  +..++...+.... +.+.  ...+.|+-....+-++.+.+...       ++| +||+=||||.-
T Consensus        30 g~r~lvvtd~~~~~~~~~~l~~~L~~~~-i~~~--~~~~~~~p~~~~v~~~~~~~~~~-------~~D-~IiavGGGs~i   98 (366)
T d1jq5a_          30 GNKTVVIADEIVWKIAGHTIVNELKKGN-IAAE--EVVFSGEASRNEVERIANIARKA-------EAA-IVIGVGGGKTL   98 (366)
T ss_dssp             CSEEEEEECHHHHHHTHHHHHHHHHTTT-CEEE--EEECCSSCBHHHHHHHHHHHHHT-------TCS-EEEEEESHHHH
T ss_pred             CCEEEEEECCCHHHHHHHHHHHHHHHCC-CEEE--EEEECCCCCHHHHHHHHHHHHCC-------CCC-EEEEECCCCCC
T ss_conf             9948999898578999999999998779-9699--99818999999999999986203-------886-89981688644


Q ss_pred             HHHHCCHHHHHHHHHH-CCCE-----EEEEECCCCC
Q ss_conf             4220076999999974-8904-----8852057775
Q gi|254780791|r  223 DLWHFNDEMIVRAIAN-SSIP-----IISAIGHETD  252 (529)
Q Consensus       223 DL~~FN~e~laraI~~-~~iP-----VisgIGHE~D  252 (529)
                      |..        ++|+. .++|     ...|.|=|+.
T Consensus        99 D~a--------K~iA~~~~~p~i~IPTT~gtgse~t  126 (366)
T d1jq5a_          99 DTA--------KAVADELDAYIVIVPTAASTDAPTS  126 (366)
T ss_dssp             HHH--------HHHHHHHTCEEEEEESSCCSSCTTC
T ss_pred             CCH--------HEEEECCCCEEEEHHHHHHHHHCCC
T ss_conf             220--------0012046653540243443432001


SCOP domain information

class: Multi-domain proteins (alpha and beta)
fold: Dehydroquinate synthase-like
superfamily: Dehydroquinate synthase-like
family: Iron-containing alcohol dehydrogenase
domain: Glycerol dehydrogenase
species: Bacillus stearothermophilus [TaxId: 1422]