BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780791|ref|YP_003065204.1| exodeoxyribonuclease VII large
subunit [Candidatus Liberibacter asiaticus str. psy62]
         (529 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780791|ref|YP_003065204.1| exodeoxyribonuclease VII large subunit [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040468|gb|ACT57264.1| exodeoxyribonuclease VII large subunit [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 529

 Score = 1080 bits (2794), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 529/529 (100%), Positives = 529/529 (100%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN
Sbjct: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
           HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL
Sbjct: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK
Sbjct: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS
Sbjct: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI
Sbjct: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD
Sbjct: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420
           FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI
Sbjct: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420

Query: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480
           KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA
Sbjct: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480

Query: 481 TKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
           TKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF
Sbjct: 481 TKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529


>gi|315122013|ref|YP_004062502.1| exodeoxyribonuclease VII large subunit [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495415|gb|ADR52014.1| exodeoxyribonuclease VII large subunit [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 533

 Score =  761 bits (1965), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/533 (71%), Positives = 445/533 (83%), Gaps = 4/533 (0%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           MN   QKNSL  PEYSVSELSYHLK+ VES   +V VRGEISGYRGIH+SGHAYFSLKDN
Sbjct: 1   MNSSPQKNSLTLPEYSVSELSYHLKNTVESKFPYVFVRGEISGYRGIHASGHAYFSLKDN 60

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            SRIDA+IWKGTL+KIE  PEEGIEFL +GKITTFPGSSKYQIIIESLIPSGSG L+T L
Sbjct: 61  KSRIDAVIWKGTLSKIEHPPEEGIEFLALGKITTFPGSSKYQIIIESLIPSGSGALMTIL 120

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           E+RKKKL EE LFSD++KNPIPF+PK IAVITSPTGAVIRDILQRISCRFP+RVI+FP K
Sbjct: 121 EERKKKLREEELFSDKYKNPIPFMPKNIAVITSPTGAVIRDILQRISCRFPVRVIVFPAK 180

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQGDECP+EI NAI+QLN LKE   CPRPDIIILARGGGSIEDLWHFNDE IVRAIANSS
Sbjct: 181 VQGDECPREIVNAIIQLNGLKEESICPRPDIIILARGGGSIEDLWHFNDETIVRAIANSS 240

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IPIISAIGHETDWTL+DYAADLRAPTPTGAAEMAVPVK  L SSL +LE+RLN+ I+RL 
Sbjct: 241 IPIISAIGHETDWTLSDYAADLRAPTPTGAAEMAVPVKHLLTSSLKSLESRLNHSIVRLT 300

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           K K+N LNSL+K LPNSDQ LSC RY+LDRL RELEHNLEIIIFRK R+FN+ I RIKSD
Sbjct: 301 KNKVNCLNSLIKILPNSDQILSCPRYQLDRLSRELEHNLEIIIFRKCRYFNNTIIRIKSD 360

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420
             +HNIQK RQ+I++KQ++IE  ++Q+LR I L+ ++K  +LHML EQTK+RI  LH HI
Sbjct: 361 VPMHNIQKYRQNIIKKQEYIEHQIEQYLRCIHLKTQQKGTMLHMLCEQTKSRITRLHAHI 420

Query: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480
           K  I RIE +LS+KI++CHTS+S   RIL+S A++N LKRGY++I+D NNN +T+   L+
Sbjct: 421 KDSINRIELMLSYKIQNCHTSISTPNRILKSLAHRNILKRGYSTIRDLNNNLLTKTNKLS 480

Query: 481 TKTRILINFFDGQANAIVINK----APPKEQPTKKCQLHNNKREKQGTQGELF 529
             T ILI+FF+GQA+AI+ NK     P +++ T+K + ++ K++    QG LF
Sbjct: 481 AGTNILIDFFEGQASAIITNKNHSVLPIEKKYTRKRKDNSQKKKNHEDQGSLF 533


>gi|116250050|ref|YP_765888.1| exodeoxyribonuclease VII large subunit [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|158564215|sp|Q1MMN0|EX7L_RHIL3 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|115254698|emb|CAK05772.1| putative exodeoxyribonuclease VII large subunit [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 526

 Score =  498 bits (1281), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 244/528 (46%), Positives = 335/528 (63%), Gaps = 4/528 (0%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           N F   +  +  EYSVSELS  +K  VE+    V VRGEISGYRG HSSGHAYF+LKD+ 
Sbjct: 3   NVFDGDSPTNLAEYSVSELSGSIKRTVETAFDQVRVRGEISGYRGPHSSGHAYFALKDDR 62

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           +RIDA+IWKGT ++++F PEEG+E +  GK+TTFPGSSKYQI+IE+L P+G+G L+  +E
Sbjct: 63  ARIDAVIWKGTFSRLKFRPEEGMEVIATGKVTTFPGSSKYQIVIETLEPAGAGALMALIE 122

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           +RK+KL  EGLF    K  +PF+P +I V+TSPTGAVIRDIL RIS RFP+ V+++PVKV
Sbjct: 123 ERKRKLGAEGLFDAARKKRLPFMPGVIGVVTSPTGAVIRDILHRISDRFPVHVLVWPVKV 182

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QG+   +E+ANAI   N L+   T PRPD++I+ARGGGS+EDLW FNDE++VRA A S+I
Sbjct: 183 QGEGSGEEVANAIRGFNALEPSGTIPRPDVLIVARGGGSLEDLWSFNDEIVVRAAAESAI 242

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETDWTL DYAAD+RAPTPTGAAEMAVPVK  L++    L ARL   + R + 
Sbjct: 243 PLISAVGHETDWTLIDYAADVRAPTPTGAAEMAVPVKAELEAQAAGLAARLQGCMNRQMD 302

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            +  ++ +L++ALP+ DQ L+  R R D     L   LE+    K R F  +   ++ D 
Sbjct: 303 QRRQSVRALMRALPSLDQLLALPRRRFDEAATGLGRGLELNTINKRRGFERVAAHLRPDL 362

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIK 421
           L   I + RQ + E+    E++V++ +           AIL  L  + K +       + 
Sbjct: 363 LAGRIAERRQTLNERMARAERMVERLIDRSKSRVDRAEAILASLPARLKTQTDRGRERLG 422

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLAT 481
            L    +  + H++    + +S   R+LQS +YKN LKRGY  I+D +N  ++Q  +L+ 
Sbjct: 423 NLSRHADTAVRHQLTRARSELSAQDRVLQSLSYKNVLKRGYAVIRDEDNRPVSQAAHLSA 482

Query: 482 KTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
              I I F DG+  A+      P     K+    + K  +   QG LF
Sbjct: 483 GMGIAIEFADGRVGAMTTEGGTPPAGAKKR----STKPAEPPKQGSLF 526


>gi|190889943|ref|YP_001976485.1| exodeoxyribonuclease VII protein, large subunit [Rhizobium etli
           CIAT 652]
 gi|226697598|sp|B3PYF6|EX7L_RHIE6 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|190695222|gb|ACE89307.1| exodeoxyribonuclease VII protein, large subunit [Rhizobium etli
           CIAT 652]
          Length = 526

 Score =  493 bits (1270), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 244/528 (46%), Positives = 330/528 (62%), Gaps = 4/528 (0%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           N F   +  +  EYSVSELS  +K  VE+    V VRGEISGYRG HSSGHAYF+LKD+ 
Sbjct: 3   NLFDSDSPTNLAEYSVSELSGSIKRTVETAFDQVRVRGEISGYRGPHSSGHAYFALKDDR 62

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           +RIDA+IWKGT ++++F PEEG+E +  GK+TTFPGSSKYQI+IE+L P+G+G L+  +E
Sbjct: 63  ARIDAVIWKGTFSRLKFRPEEGMEVIATGKVTTFPGSSKYQIVIETLEPAGAGALMALIE 122

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           +RK+KL  EGLF    K  +PF+PK+I V+TSPTGAVIRDIL RIS RFP+ V+++PVKV
Sbjct: 123 ERKRKLGAEGLFDAARKKRLPFMPKVIGVVTSPTGAVIRDILHRISDRFPVHVLVWPVKV 182

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QG+    E+ANAI   N L+ G    RPD++I+ARGGGS+EDLW FNDE++VRA A S I
Sbjct: 183 QGEGAGDEVANAIRGFNALEPGGAIARPDVLIVARGGGSLEDLWSFNDEIVVRAAAESRI 242

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETDWTL DYAAD+RAPTPTGAAEMAVPVK  L++    L ARL   I R + 
Sbjct: 243 PLISAVGHETDWTLIDYAADVRAPTPTGAAEMAVPVKAELEAQATALAARLQGCINRQMD 302

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            +  ++ +L++ALP+ DQ L+  R R D     L   LE+    K R F  + + ++ D 
Sbjct: 303 QRRQSVRALMRALPSLDQLLALPRRRFDEAAAGLGRGLELNTINKRRGFERVASHLRPDV 362

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIK 421
           L + I + RQ + ++    E+ V++ L           AIL  L  + K +       + 
Sbjct: 363 LSNRIAERRQLLNDRMARAERTVERLLDRSKSRIDRAEAILASLPTRLKTQTDRGRERLG 422

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLAT 481
            L    +  + H++      +S   R+LQS +YKN LKRGY  I+D ++  ++Q   L+ 
Sbjct: 423 NLTRHADTAIRHQLTRARAELSAQDRVLQSLSYKNVLKRGYAVIRDEDDRPVSQAAALSA 482

Query: 482 KTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
              I I F DG+  A+      P     K+      K      QG LF
Sbjct: 483 GMGIAIEFADGRVGAMTTEGGTPPAGAKKRSA----KPADPTKQGSLF 526


>gi|222084548|ref|YP_002543077.1| exodeoxyribonuclease VII, large subunit [Agrobacterium radiobacter
           K84]
 gi|221721996|gb|ACM25152.1| exodeoxyribonuclease VII, large subunit [Agrobacterium radiobacter
           K84]
          Length = 571

 Score =  489 bits (1259), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 250/538 (46%), Positives = 336/538 (62%), Gaps = 9/538 (1%)

Query: 1   MNPFSQKNSLDH-PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKD 59
           M+ F + +S  +  EYSVSELS  +K  VES    V VRGEISGYRG HSSGHAYFSLKD
Sbjct: 34  MSSFFENDSPSNLAEYSVSELSGSIKRTVESAFDQVRVRGEISGYRGPHSSGHAYFSLKD 93

Query: 60  NHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTA 119
           + +RIDA+IWKGT +K++F PEEG+E +  GK+TTFPGSSKYQI+IE+L P+G+G L+  
Sbjct: 94  DRARIDAVIWKGTFSKLKFRPEEGMEVIATGKVTTFPGSSKYQIVIETLEPAGAGALMAL 153

Query: 120 LEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPV 179
           LE+RK+KL  EGLF  + K  +PF+PK+I V+TSPTGAVIRDIL RIS RFP+ V+++PV
Sbjct: 154 LEERKRKLGAEGLFDAERKRRLPFMPKVIGVVTSPTGAVIRDILHRISDRFPVHVLVWPV 213

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
           KVQG+    E+ANAI   N +  G   PRPD++I+ARGGGS+EDLW FNDE +VRA A S
Sbjct: 214 KVQGEGSGDEVANAIRGFNEVAPGGPLPRPDVLIVARGGGSLEDLWSFNDEAVVRAAAAS 273

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
            IP+ISA+GHETDWTL DYAAD+RAPTPTGAAEMAVPVK  L++ L +  ARL   + R 
Sbjct: 274 EIPLISAVGHETDWTLIDYAADVRAPTPTGAAEMAVPVKADLEAQLASFAARLQGGVSRQ 333

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
           +  +   + +LL+ALP+ DQ L+  R R D     L   LE+    K R F    + ++ 
Sbjct: 334 MDQRRQAVRALLRALPSLDQLLALPRRRFDEAASGLGRGLELNTLNKRRTFERAASHLRP 393

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH 419
           D L + I + RQ + E+    E+ +++ +           A+   L  + + +       
Sbjct: 394 DVLSNRIVERRQMLSERMTRAERTIERMIDRARARIGRADAVFATLPSRLETQTGRARDL 453

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
           +  L  R +  + H++      ++   R+LQS +YKN LKRGY  ++D  +  ++    L
Sbjct: 454 LGNLSRRTDTAIRHQLVRARGELAAQERVLQSLSYKNVLKRGYAVVRDEADRPVSLAAAL 513

Query: 480 ATKTRILINFFDGQANAIVINK--AP-PKEQPT-----KKCQLHNNKREKQGTQGELF 529
           AT   I I F DG+  A+  +   AP P E PT     KK             QG LF
Sbjct: 514 ATGAAISIEFADGRVGAVTGDNSVAPAPTETPTGVPPQKKRVAKPAGSADPSNQGSLF 571


>gi|327191973|gb|EGE58954.1| exodeoxyribonuclease VII protein, large subunit [Rhizobium etli
           CNPAF512]
          Length = 526

 Score =  481 bits (1239), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 246/524 (46%), Positives = 331/524 (63%), Gaps = 3/524 (0%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           N F   +  +  EYSVSELS  +K  VE+    V VRGEISGYRG HSSGHAYFSLKD+ 
Sbjct: 3   NVFDSDSPTNLAEYSVSELSGSIKRTVETAFDQVRVRGEISGYRGPHSSGHAYFSLKDDR 62

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           +RIDA+IWKGT ++++F PEEG+E +  GK+TTFPGSSKYQI+IE+L P+G+G L+  +E
Sbjct: 63  ARIDAVIWKGTFSRLKFRPEEGMEVIATGKVTTFPGSSKYQIVIETLEPAGAGALMALIE 122

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           +RK++L  EGLF    K  +PF+PK+I V+TSPTGAVIRDIL RIS RFP+ V+++PVKV
Sbjct: 123 ERKRRLGAEGLFDAARKKRLPFMPKVIGVVTSPTGAVIRDILHRISDRFPVHVLVWPVKV 182

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QG+   +E+ANAI   N L+ G    RPD++I+ARGGGS+EDLW FNDE +VRA A S I
Sbjct: 183 QGEGSGEEVANAIRGFNALEPGGAIARPDVLIVARGGGSLEDLWSFNDETVVRAAAESRI 242

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETDWTL DYAAD+RAPTPTGAAEMAVPVK  L++    L ARL   + R + 
Sbjct: 243 PLISAVGHETDWTLIDYAADVRAPTPTGAAEMAVPVKAELEAQAAALAARLQGCMNRQMD 302

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            +  ++ +L++ALP+ DQ L+  R R D     L   LE+    K R F  + + ++ D 
Sbjct: 303 QRRQSVRALMRALPSLDQLLALPRRRFDEAAAGLGRGLELNTINKRRGFERVASHLRPDV 362

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIK 421
           L + I + RQ + E+    E+ V++ L           AIL  L  + K +       + 
Sbjct: 363 LSNRIAERRQLLSERMARAERTVERLLDRSKSRIDRAEAILASLPARLKTQTDRGRERLG 422

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLAT 481
            L    +  + H++      +S   R+LQS +YKN LKRGY  I+D ++  ++Q   L+ 
Sbjct: 423 NLTRHADTAIRHQLTRARAELSAQDRVLQSLSYKNVLKRGYAVIRDEDDRPVSQAAALSA 482

Query: 482 KTRILINFFDGQANAIVI-NKAPPKEQPTKKCQLHNNKREKQGT 524
              I I F DG+  A+     APP     KK         KQGT
Sbjct: 483 GMGIAIEFADGRVGAMTTEGGAPPAS--AKKRSAKPADPTKQGT 524


>gi|241207230|ref|YP_002978326.1| exodeoxyribonuclease VII large subunit [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240861120|gb|ACS58787.1| exodeoxyribonuclease VII, large subunit [Rhizobium leguminosarum
           bv. trifolii WSM1325]
          Length = 526

 Score =  479 bits (1233), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 243/529 (45%), Positives = 332/529 (62%), Gaps = 6/529 (1%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           N F   +  +  EYSVSELS  +K  VE+    V VRGEISGYRG HSSGHAYF+LKD+ 
Sbjct: 3   NVFDGDSPTNLAEYSVSELSGSIKRTVETAFDQVRVRGEISGYRGPHSSGHAYFALKDDR 62

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           +RIDA+IWKGT ++++F PEEG+E +  GK+TTFPGSSKYQI+IE+L P+G+G L+  +E
Sbjct: 63  ARIDAVIWKGTFSRLKFRPEEGMEVIATGKVTTFPGSSKYQIVIETLEPAGAGALMALIE 122

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           +RK+KL  EGLF    K  +PF+P +I V+TSPTGAVIRDIL RIS RFP+ V+++PVKV
Sbjct: 123 ERKRKLGAEGLFDAARKKRLPFMPGVIGVVTSPTGAVIRDILHRISDRFPVHVLVWPVKV 182

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QG+   +E+ANAI   N L+     PRPD++I+ARGGGS+EDLW FNDE++VRA A S I
Sbjct: 183 QGEGSGEEVANAIRGFNALEPSGAIPRPDVLIVARGGGSLEDLWSFNDEIVVRAAAESRI 242

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETDWTL DYAAD+RAPTPTGAAEMAVPVK  L++    L ARL   + R + 
Sbjct: 243 PLISAVGHETDWTLIDYAADVRAPTPTGAAEMAVPVKAELEAQAAALAARLQGCMNRQMD 302

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            +  ++ +L++ALP+ DQ L+  R R D     L   LE+    K R F  +   ++ D 
Sbjct: 303 QRRQSVRALMRALPSLDQLLALPRRRFDEAATGLGRGLELNTINKRRGFERVAAHLRPDL 362

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIK 421
           L   I + RQ + E+    E++V++ +           AIL  L  + K +       + 
Sbjct: 363 LAGRIAERRQTLNERMARAERMVERLIDRSKSRVDRAEAILASLPARLKTQTDRGRERLG 422

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLAT 481
            L    +  + H++      +S   R+LQS +YKN LKRGY  I+D +N  ++Q   L+ 
Sbjct: 423 NLSRHADTAVRHQLTRARAELSSQDRVLQSLSYKNVLKRGYAVIRDEDNRPVSQAAQLSA 482

Query: 482 KTRILINFFDGQANAIVI-NKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
              I I F DG+  A+     APP     +  +  +  +     QG LF
Sbjct: 483 GMGIAIEFADGRVGAMTTEGGAPPAGAKKRSARPADPPK-----QGSLF 526


>gi|150398684|ref|YP_001329151.1| exodeoxyribonuclease VII large subunit [Sinorhizobium medicae
           WSM419]
 gi|166232367|sp|A6UF86|EX7L_SINMW RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|150030199|gb|ABR62316.1| exodeoxyribonuclease VII, large subunit [Sinorhizobium medicae
           WSM419]
          Length = 526

 Score =  478 bits (1229), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 229/521 (43%), Positives = 327/521 (62%), Gaps = 1/521 (0%)

Query: 4   FSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSR 63
           F  ++  +  EYSVSELS  +K  +E    HV VRGEISGYRG HSSGHAYF+LKD+ +R
Sbjct: 5   FDSESPSNVAEYSVSELSGSIKRTIEQTFEHVRVRGEISGYRGPHSSGHAYFTLKDDRAR 64

Query: 64  IDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKR 123
           IDA++WKGT  +++F PEEG+E +  G++TTFPGSSKYQ++I++L P+G+G L+  +E+R
Sbjct: 65  IDAVVWKGTFARLKFRPEEGMEVIATGRVTTFPGSSKYQVVIDALEPAGAGALMALIEER 124

Query: 124 KKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQG 183
           K+KL  EGLF    K P+PF+PK+I V+TSPTGAVIRDIL RI+ RFP+ V+++PV+VQG
Sbjct: 125 KRKLAAEGLFDAGRKRPLPFMPKVIGVVTSPTGAVIRDILHRIADRFPVHVLVWPVRVQG 184

Query: 184 DECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPI 243
           D   +EI  AI   N L+ G    RPD++I+ARGGGS+EDLW FNDE +VRA A S+IP+
Sbjct: 185 DGACEEIVAAIEGFNALQPGGPIARPDVLIVARGGGSLEDLWCFNDEAMVRAAAGSAIPL 244

Query: 244 ISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYK 303
           ISA+GHETDWTL D+AAD RAPTPTGAAEMAVPVK  L++ L +L ARL    +R +  +
Sbjct: 245 ISAVGHETDWTLIDHAADQRAPTPTGAAEMAVPVKADLEAQLASLSARLKGAAVRQMDNR 304

Query: 304 INTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLI 363
             TL SL +ALP+ DQ L+  R R D     L   L++    K R F      ++ D L 
Sbjct: 305 RQTLRSLARALPSLDQLLALPRRRFDEAAAGLGRGLQMNTANKRRSFERSAAHLRPDLLT 364

Query: 364 HNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKL 423
             I   RQ +++     E+IV++ +           A L  L  +   ++      +  +
Sbjct: 365 ARIVDRRQRVVDAVNRAERIVERQVHRGAARVASADASLRALPSRLIGQVHRASDRVSAM 424

Query: 424 ITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKT 483
             R +  ++  ++   ++V+   R+LQS +Y+N L+RG+  ++D     + Q   + +  
Sbjct: 425 SRRADAAIAADLRRLKSAVAAQDRVLQSLSYRNVLQRGFALVRDAAGEPVKQAAAVHSGM 484

Query: 484 RILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGT 524
            + + F DG+  A+      P + P KK      +  KQG+
Sbjct: 485 ALSVEFADGRVAAVAGEDGTPSQAP-KKRPARAGEPTKQGS 524


>gi|227824137|ref|YP_002828110.1| exodeoxyribonuclease VII large subunit [Sinorhizobium fredii
           NGR234]
 gi|254783705|sp|C3MCQ9|EX7L_RHISN RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|227343139|gb|ACP27357.1| exodeoxyribonuclease VII, large subunit [Sinorhizobium fredii
           NGR234]
          Length = 527

 Score =  477 bits (1228), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 229/500 (45%), Positives = 326/500 (65%), Gaps = 1/500 (0%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           EYSVSELS  +K  +E    HV VRGEISGYRG HSSGHAYF+LKD+ +R++A+IWKGT 
Sbjct: 15  EYSVSELSGSIKRTLEQAFEHVRVRGEISGYRGPHSSGHAYFALKDDRARMEAVIWKGTF 74

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            +++  PEEG+E +  G++TTFPGSSKYQI+I+SL P+G+G L+  LE+RK+KL  EGLF
Sbjct: 75  ARLKLRPEEGMEVIATGRVTTFPGSSKYQIVIDSLEPAGAGALMALLEERKRKLAAEGLF 134

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
               K P+PF+PK+I V+TSPTGAVIRDIL RI+ RFP+ V+++PV+VQGD   +E+A A
Sbjct: 135 DAARKRPLPFMPKVIGVVTSPTGAVIRDILHRIADRFPVHVVVWPVRVQGDGASEEVAAA 194

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N L+EG   PRPD++I+ARGGGS+EDLW FNDE +VRA+A S IP+ISA+GHETDW
Sbjct: 195 IRGFNALEEGGPIPRPDVLIVARGGGSLEDLWGFNDEAVVRAVAASGIPLISAVGHETDW 254

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL DYA+D RAPTPTGAAEMAVPVK  L++ + NL ARL     R + ++ + L +L +A
Sbjct: 255 TLIDYASDQRAPTPTGAAEMAVPVKADLEAQVANLSARLQAAATRQMDHRRHALRALARA 314

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           LP+ DQ L+  R R D     L   L++    K R F  I   ++ + L   I++ R+H+
Sbjct: 315 LPSLDQLLALPRRRFDEAAAGLGRGLQMNTANKRRSFERIAAHLRPELLTTRIREQRRHL 374

Query: 374 LEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSH 433
           LE     E+ V++ +           A L  L  +   +I      +  L  R +  ++ 
Sbjct: 375 LEAINKAERCVERQIDRRQARVSAADASLRTLPSRLAGQIHRSSDRVSGLGRRADAAMAA 434

Query: 434 KIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDGQ 493
           +++    +++   R+LQS +Y+N L+RG+  ++D   + + Q   +     + + F DG+
Sbjct: 435 EMRRLKGALAAQDRVLQSLSYRNVLQRGFALVRDAAGDPVKQAAAVTAGMALSLEFADGR 494

Query: 494 ANAIVINK-APPKEQPTKKC 512
            +A+   + APP   P K+ 
Sbjct: 495 VSAVAGEEGAPPPAAPKKRA 514


>gi|325291705|ref|YP_004277569.1| exodeoxyribonuclease VII large subunit [Agrobacterium sp. H13-3]
 gi|325059558|gb|ADY63249.1| exodeoxyribonuclease VII large subunit [Agrobacterium sp. H13-3]
          Length = 534

 Score =  476 bits (1224), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 243/540 (45%), Positives = 345/540 (63%), Gaps = 24/540 (4%)

Query: 4   FSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSR 63
           FS     +  E+SVSELS  +K  VE+    V VRGEISGYRG HSSGHAYFSLKD+ +R
Sbjct: 5   FSNAALSNLAEFSVSELSGSIKRTVETAFDQVRVRGEISGYRGPHSSGHAYFSLKDDRAR 64

Query: 64  IDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKR 123
           IDA+IWKGT ++++F PEEG+E +  GK+TTFPGSSKYQI+IESL P+G+G L+  LE R
Sbjct: 65  IDAVIWKGTFSRLKFRPEEGMEVIATGKVTTFPGSSKYQIVIESLEPAGAGALMALLEDR 124

Query: 124 KKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQG 183
           +++L  EGLF  + K  +PF+P++I V+TSPTGAVIRDIL RIS RFP+ V+++PVKVQG
Sbjct: 125 RRRLAAEGLFDAERKRRLPFMPRVIGVVTSPTGAVIRDILHRISDRFPVHVVVWPVKVQG 184

Query: 184 DECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPI 243
           +   +E+ANAI   N L+ G    RPD++I+ARGGGS+EDLW FNDE++VRA A S IP+
Sbjct: 185 EGSGEEVANAIRGFNALQPGGEIARPDVLIVARGGGSLEDLWSFNDEIVVRAAAESEIPL 244

Query: 244 ISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYK 303
           ISA+GHETD TL DYAAD+RAPTPTGAAEMAVPV+  L++ L  L ARL+  + R +  +
Sbjct: 245 ISAVGHETDTTLIDYAADVRAPTPTGAAEMAVPVRAELEAQLSGLAARLSGSVSRQMDNR 304

Query: 304 INTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLI 363
              + +L++ALP+ DQ L+  R R D     L   LE+    K R F    + ++ + L+
Sbjct: 305 RQGVRALVRALPSLDQLLALPRRRFDEAASGLGRGLEMTTLNKRRAFERSASGLRPEILL 364

Query: 364 HNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILH-MLREQTKNRIFYLHTHIKK 422
           + ++++RQ + E+ Q  E +V++ L    L+ + +I+     LR      +  L    ++
Sbjct: 365 NGLRQHRQRVTERMQRAEALVERRL----LQAQSRISSTDSALRSLPARLLGQLERQKER 420

Query: 423 LIT---RIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
           ++T   R +  + H++    + ++   RILQS +YKN L RGY  I+D  N  +T+   +
Sbjct: 421 VVTATRRADTAVLHRMAQNRSGLAAHDRILQSLSYKNVLNRGYAVIRDEENRPLTRAAAI 480

Query: 480 ATKTRILINFFDGQANAIVINK----------APPKEQPTKKCQLHNNKREKQGTQGELF 529
           A+   + + F DG+  A+   +          A PK++P K            G QG LF
Sbjct: 481 ASGAVVSMEFADGRVAALTTGEATPSSDVQTPAAPKKKPVKPAS------SDPGNQGSLF 534


>gi|209551852|ref|YP_002283769.1| exodeoxyribonuclease VII large subunit [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|226697599|sp|B5ZYC6|EX7L_RHILW RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|209537608|gb|ACI57543.1| exodeoxyribonuclease VII, large subunit [Rhizobium leguminosarum
           bv. trifolii WSM2304]
          Length = 527

 Score =  475 bits (1222), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 239/523 (45%), Positives = 330/523 (63%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           N F   +  +  EYSVSELS  +K  VE+    V VRGEISGYRG HSSGHAYF+LKD+ 
Sbjct: 3   NVFDSDSPTNLAEYSVSELSGSIKRTVETAFDQVRVRGEISGYRGPHSSGHAYFALKDDR 62

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           +RIDA+IWKGT ++++F PEEG+E +  GK+TTFPGSSKYQI+IE+L P+G+G L+  +E
Sbjct: 63  ARIDAVIWKGTFSRLKFRPEEGMEVIATGKVTTFPGSSKYQIVIETLEPAGAGALMALIE 122

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           +RK+KL  EGLF    K  +PF+P++I V+TSPTGAVIRDIL RIS RFP+ V+++PVKV
Sbjct: 123 ERKRKLGAEGLFDAARKKRLPFMPRVIGVVTSPTGAVIRDILHRISDRFPVHVLVWPVKV 182

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QG+   +E+ANAI   N L+     PRPD++I+ARGGGS+EDLW FNDE++VRA A S I
Sbjct: 183 QGEGSGEEVANAIRGFNALEPAGLIPRPDVLIVARGGGSLEDLWSFNDEIVVRAAAESRI 242

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETDWTL DYAAD+RAPTPTGAAEMAVPVK  L++    L ARL   + R + 
Sbjct: 243 PLISAVGHETDWTLIDYAADVRAPTPTGAAEMAVPVKAELEAQAAALAARLQGCMNRQMD 302

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            +  ++ +L++ALP+ DQ L+  R R D     L   LE+    K R F  +   ++ D 
Sbjct: 303 QRRQSVRALMRALPSLDQLLALPRRRFDEAAAGLGRGLELNTINKRRGFERVGAHLRPDL 362

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIK 421
           L   I + RQ + E+    E++V++ +           AIL  L  + K +       + 
Sbjct: 363 LSGRIAERRQTLNERIVRAERMVERLIDRSKSRIDRAEAILASLPARFKTQTDRSREALA 422

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLAT 481
            L    +  + H++      +S   R+LQS +YKN LKRGY  I+D ++  ++Q   L+ 
Sbjct: 423 NLSRHGDTAIRHQLARARAELSAQDRVLQSLSYKNVLKRGYAVIRDEDDRPVSQAAALSA 482

Query: 482 KTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGT 524
            + + I F DG+  A+      P     K+         KQG+
Sbjct: 483 GSAVSIEFSDGRIGAVTTEGGAPPASLKKRPAREAGDPPKQGS 525


>gi|86355934|ref|YP_467826.1| exodeoxyribonuclease VII large subunit [Rhizobium etli CFN 42]
 gi|123513318|sp|Q2KDI7|EX7L_RHIEC RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|86280036|gb|ABC89099.1| exodeoxyribonuclease VII large subunit protein [Rhizobium etli CFN
           42]
          Length = 526

 Score =  474 bits (1220), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 240/528 (45%), Positives = 331/528 (62%), Gaps = 4/528 (0%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           N F   +  +  EYSVSELS  +K  +E+    V VRGEISGYRG HSSGHAYF+LKD+ 
Sbjct: 3   NLFDSDSPTNLAEYSVSELSGSIKRTIETAFDQVRVRGEISGYRGPHSSGHAYFALKDDR 62

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           +RIDA+IWKGT ++++F PEEG+E +  GK+TTFPGSSKYQI+IE+L P+G+G L+  +E
Sbjct: 63  ARIDAVIWKGTFSRLKFRPEEGMEVIATGKVTTFPGSSKYQIVIETLEPAGAGALMALIE 122

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           +RK++L  EGLF    K  +PF+P +I V+TSPTGAVIRDIL RIS RFP+ V+++PVKV
Sbjct: 123 ERKRRLGAEGLFDAARKKRLPFMPHVIGVVTSPTGAVIRDILHRISDRFPVHVLVWPVKV 182

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QG+   +E+ANAI   N L+      RPD++I+ARGGGS+EDLW FNDE++VRA A S I
Sbjct: 183 QGEGSGEEVANAIRGFNALEPASAISRPDVLIVARGGGSLEDLWSFNDEIVVRAAAESRI 242

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETDWTL DYAAD+RAPTPTGAAEMAVPVK  L++    L ARL   + R + 
Sbjct: 243 PLISAVGHETDWTLIDYAADVRAPTPTGAAEMAVPVKAELEAQAAALAARLQGCMNRQMD 302

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            +  ++ SL++A P+ DQ L+  R R D     L   LE+    K R F  +I  ++ D 
Sbjct: 303 QRRQSVRSLMRAFPSLDQLLALPRRRFDEAAAGLGRGLELNTINKRRGFERVIAHLRPDL 362

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIK 421
           L   I + RQ + E+    E++V++ +       +   AIL  L  + K +       + 
Sbjct: 363 LSGRISERRQMLNERMVRAERMVERLIDRSASRVERAEAILASLPARLKAQTDRSRERLG 422

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLAT 481
            L    +  + H++      +S   R+LQS +YKN L+RGY  I+D +N  ++Q   L+ 
Sbjct: 423 NLTRHADTAIRHQLTRARAELSAQDRVLQSLSYKNVLRRGYAVIRDEDNRPVSQAAALSA 482

Query: 482 KTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
              I I F DG+  A+      P     K+    + K  +   QG LF
Sbjct: 483 GMGIAIEFADGRIGAMTTEGGTPPGGAKKR----STKPAEPTKQGSLF 526


>gi|159184239|ref|NP_353300.2| exodeoxyribonuclease VII large subunit [Agrobacterium tumefaciens
           str. C58]
 gi|23814089|sp|Q8UIM4|EX7L_AGRT5 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|159139567|gb|AAK86085.2| exodeoxyribonuclease VII large subunit [Agrobacterium tumefaciens
           str. C58]
          Length = 532

 Score =  470 bits (1209), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 242/522 (46%), Positives = 338/522 (64%), Gaps = 10/522 (1%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           E+SVSELS  +K  VE+    V VRGEISGYRG HSSGHAYFSLKD+ +RIDA+IWKGT 
Sbjct: 15  EFSVSELSGSIKRTVETAFEQVRVRGEISGYRGPHSSGHAYFSLKDDRARIDAVIWKGTF 74

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
           ++++F PEEG+E +  GKITTFPGSSKYQI+IESL P+G+G L+  LE R+++L  EGLF
Sbjct: 75  SRLKFRPEEGMEVIATGKITTFPGSSKYQIVIESLEPAGAGALMALLEDRRRRLAAEGLF 134

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
               K P+PF+P++I V+TSPTGAVIRDIL RIS RFP+ V+++PVKVQG+   +E+ANA
Sbjct: 135 DSARKRPLPFMPRVIGVVTSPTGAVIRDILHRISDRFPVHVVVWPVKVQGEGSGEEVANA 194

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N LK G    RPD++I+ARGGGS+EDLW FNDE++VRA A S IP+ISA+GHETD 
Sbjct: 195 IRGFNALKPGGDIARPDVLIVARGGGSLEDLWSFNDEIVVRAAAESEIPLISAVGHETDT 254

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL DYAAD+RAPTPTGAAEMAVPV+  L++ L  L ARL+  + R +  +   + +L++A
Sbjct: 255 TLIDYAADVRAPTPTGAAEMAVPVRAELEAQLSGLAARLSGSVSRQMDNRRQGVRALVRA 314

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           LP+ DQ L+  R R D     L   LE+    K R F    + ++ + L++ ++ +RQ I
Sbjct: 315 LPSLDQLLALPRRRFDEAASGLGRGLELTTLNKRRAFERSASGLRPETLLNGLKHHRQRI 374

Query: 374 LEKQQHIEQIVKQHLRYIFLEKKEKI-AILHMLREQTKNRIFYLHTHIKKLIT---RIEF 429
            E+    E +V++ L    L+ K ++ +    LR      +  L    ++++T   R + 
Sbjct: 375 TERMHRAETLVERRL----LQGKGRVDSFDSALRSLPARLLGQLERQKERVVTAARRADT 430

Query: 430 ILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINF 489
            + H++    + ++   RILQS +YKN L RGY  I+D  N  +T+   +A+   + + F
Sbjct: 431 AVLHRMAQNRSGLAAHDRILQSLSYKNVLNRGYAVIRDEENRPLTRAAAIASGAAVSMEF 490

Query: 490 FDGQANAIVINKAPPKEQPTKKCQLHNNKREKQ--GTQGELF 529
            DG+ +AI   +  P  +     +    K      G QG LF
Sbjct: 491 ADGRVSAITTGEGTPAPETAAAPKKKPAKPASSDPGNQGNLF 532


>gi|15964051|ref|NP_384404.1| exodeoxyribonuclease VII large subunit [Sinorhizobium meliloti
           1021]
 gi|307301196|ref|ZP_07580958.1| exodeoxyribonuclease VII, large subunit [Sinorhizobium meliloti
           BL225C]
 gi|307321097|ref|ZP_07600502.1| exodeoxyribonuclease VII, large subunit [Sinorhizobium meliloti
           AK83]
 gi|22095673|sp|Q92SR7|EX7L_RHIME RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|15073227|emb|CAC41735.1| Putative exodeoxyribonuclease 7 large subunit [Sinorhizobium
           meliloti 1021]
 gi|306893269|gb|EFN24050.1| exodeoxyribonuclease VII, large subunit [Sinorhizobium meliloti
           AK83]
 gi|306903652|gb|EFN34239.1| exodeoxyribonuclease VII, large subunit [Sinorhizobium meliloti
           BL225C]
          Length = 526

 Score =  465 bits (1196), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 230/521 (44%), Positives = 327/521 (62%), Gaps = 1/521 (0%)

Query: 4   FSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSR 63
           F  ++  +  EYSVSELS  +K  VE    HV VRGEISGYRG HSSGHAYF+LKD+ +R
Sbjct: 5   FDSESPSNVAEYSVSELSGSIKRTVEQAFEHVRVRGEISGYRGPHSSGHAYFALKDDRAR 64

Query: 64  IDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKR 123
           IDA++WK T  +++F PEEG+E +  G++TTFPGSSKYQI+I+SL P+G+G L+  +E+R
Sbjct: 65  IDAVVWKTTFARLKFRPEEGMEVIATGRVTTFPGSSKYQIVIDSLEPAGAGALMALIEER 124

Query: 124 KKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQG 183
           K+KL  EGLF    K P+PF+P+++ V+TSPTGAVIRDIL RI+ RFP+ VI++PV+VQG
Sbjct: 125 KRKLAAEGLFDAGRKRPLPFMPRVVGVVTSPTGAVIRDILHRIADRFPVHVIVWPVRVQG 184

Query: 184 DECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPI 243
           D   +EI  AI   N L+ G + PRPD++I+ARGGGS+EDLW FNDE +VRA A S+IP+
Sbjct: 185 DGACEEIVAAIEGFNALQPGGSIPRPDVLIVARGGGSLEDLWCFNDEAMVRAAAASAIPL 244

Query: 244 ISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYK 303
           ISA+GHETDWTL D+AAD RAPTPTGAAEMAVPVK  L++ L +L ARL     R +  +
Sbjct: 245 ISAVGHETDWTLIDHAADQRAPTPTGAAEMAVPVKADLEAQLASLAARLKGAAARQMDNR 304

Query: 304 INTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLI 363
             TL SL +ALP+ DQ L+  R R D     L   L++    K R F      ++ + L 
Sbjct: 305 RQTLRSLARALPSLDQLLALPRRRFDEAAAGLGRGLQMNTANKRRSFERNAAHLRPELLT 364

Query: 364 HNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKL 423
             I   RQ +L+     E+IV++ ++          A L +L  +   +I      +  L
Sbjct: 365 ARIVDRRQRVLDAVNRAERIVERKVQRGAQRISSADASLRVLPSRLIGQIHRASDRVSSL 424

Query: 424 ITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKT 483
             R +  ++  ++   ++++   R+LQS +Y + L+RG+  ++D     + Q   +    
Sbjct: 425 GRRGDAAIAADLRRMKSALAAQDRVLQSLSYHSVLQRGFALVRDAAGEPVKQAAAVHPGM 484

Query: 484 RILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGT 524
            + + F DG+  A+        + P KK    + +  KQG+
Sbjct: 485 ALSLEFADGRIAAVAGEDGTAPQSP-KKRPARSGEPTKQGS 524


>gi|163757587|ref|ZP_02164676.1| putative exodeoxyribonuclease VII large subunit [Hoeflea
           phototrophica DFL-43]
 gi|162285089|gb|EDQ35371.1| putative exodeoxyribonuclease VII large subunit [Hoeflea
           phototrophica DFL-43]
          Length = 530

 Score =  451 bits (1160), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 227/535 (42%), Positives = 330/535 (61%), Gaps = 11/535 (2%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M+     +  +  E++VSELS  ++  VE    +V VRGEISGYRG HSSGHAYFSLKD+
Sbjct: 1   MSSLLDDSPTNAAEFTVSELSGSIRRTVEDAFGNVRVRGEISGYRGPHSSGHAYFSLKDD 60

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            +RI+A+IWKG  ++++  PEEG+E +  GKITT+ GSSKYQI+IES+ P+G+G L+  +
Sbjct: 61  RARIEAVIWKGVFSRLKHRPEEGLEVIATGKITTYAGSSKYQIVIESIEPAGAGALMALI 120

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           E+R+ KL  EGLF +  K  +P++P +I V+TSPTGAVIRDIL RI  RFP+ VI++PV+
Sbjct: 121 EERRCKLAAEGLFDEARKQLLPYMPLVIGVVTSPTGAVIRDILHRIEDRFPVHVIVWPVR 180

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQGD    E+ANAI   N L  G    RPD+II+ARGGGS+EDLW FNDE +VRA A S 
Sbjct: 181 VQGDTSGNEVANAITGFNALAPGGRIKRPDLIIVARGGGSLEDLWGFNDEAVVRAAAESD 240

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP+ISA+GHETDWTL D+A+D RAPTPTGAAEMAVPVK  L++ L  L ARL +   R++
Sbjct: 241 IPLISAVGHETDWTLIDHASDRRAPTPTGAAEMAVPVKADLEAHLAGLAARLKSAQSRML 300

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
             +   +  L +ALP  D  L+  R RLDR  + L   L++    + R F     RI   
Sbjct: 301 DRRREAVRGLTRALPTLDSVLALPRQRLDRSGQGLGQALQLNTANRRRGFERQAARITPI 360

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420
            L+  I++ RQ + ++    ++ +++ +  +    +    +L  +      RI    TH 
Sbjct: 361 ALVSAIREKRQVLRDRATRADRSLERRVEVLRTGLERHALVLSAV----PRRITETQTHA 416

Query: 421 KKLIT----RIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQK 476
           ++ +T    R E  L+  I     ++    R+L+S +Y++ L RGY  +++ +   +++ 
Sbjct: 417 RERLTGLGRRGETALTQLIGQHKRALGAQARMLKSLSYQSVLGRGYAVVRNQDRKLLSRA 476

Query: 477 RNLATKTRILINFFDGQANAIV--INKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
             + +   I + F DG+ +A+V       P  +P K+ +   NK  + G QG LF
Sbjct: 477 EQVQSGEMIGVEFADGEVSALVNGTGAEAPSSKPKKQTRTKANKTPEPG-QGSLF 530


>gi|239833509|ref|ZP_04681837.1| exodeoxyribonuclease VII, large subunit [Ochrobactrum intermedium
           LMG 3301]
 gi|239821572|gb|EEQ93141.1| exodeoxyribonuclease VII, large subunit [Ochrobactrum intermedium
           LMG 3301]
          Length = 529

 Score =  443 bits (1140), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 224/519 (43%), Positives = 320/519 (61%), Gaps = 10/519 (1%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           EYSVSE+S  LK  VE    HV VRGEISGYRG HSSGHAYF+LKD+ SR++A+IW+G++
Sbjct: 18  EYSVSEISGALKRTVEDVFGHVRVRGEISGYRGPHSSGHAYFALKDDRSRLEAVIWRGSM 77

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
           +++ F PEEG+E +  GK+TT+PGSSKYQI+IE + P+G+G L+  LE+RK++L  EGLF
Sbjct: 78  SRLRFRPEEGMEVIATGKLTTYPGSSKYQIVIEQMEPAGAGALMALLEERKRRLASEGLF 137

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
               K  +PF+P++I V+TSPTGAVIRD++ RI+ R+PL VI++PV+VQG+    E+A A
Sbjct: 138 DPAVKQLLPFMPRVIGVVTSPTGAVIRDVIHRIADRYPLHVIVWPVRVQGETSGPEVATA 197

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           +   NTL EG   PRPD++I+ARGGGS+EDLW FNDE++VRA+A S IP+ISA+GHETDW
Sbjct: 198 VHGFNTLPEGGAIPRPDVVIVARGGGSLEDLWGFNDEIVVRAVAASHIPVISAVGHETDW 257

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D AAD+RAPTPTGAAEMAVPVK  L ++L    ARL++ I R I  K  +  S  +A
Sbjct: 258 TLIDLAADIRAPTPTGAAEMAVPVKADLLAALAGQSARLSSAISRFIDLKRRSHRSAARA 317

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           LP++DQ L+  R R D     L   L +   +K  HF   + ++    L     +  + I
Sbjct: 318 LPSADQLLALPRRRFDEAASRLTRALFVNTQKKRVHFEGHVRQLSPRLLQRRFTELERGI 377

Query: 374 LEKQQHIEQIVKQHL---RYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFI 430
               Q + + ++  L   R  F  +  +++   +LR     R       +++L  R +  
Sbjct: 378 SVLGQRLPRALETFLRERRTTFTHRANRLSAEPILR-----RTKLATNSMEQLDRRRDQA 432

Query: 431 LSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFF 490
           +   I+          R++++ +Y++ L+RG+  + D     I Q   ++    + I F 
Sbjct: 433 VRILIERAKRRGQELERLMRTLSYESVLERGFAVVFDAEGKPIKQAATVSAGDALSIRFR 492

Query: 491 DGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
           DG  +  VI       +P K  Q    +    G QG LF
Sbjct: 493 DG--DVAVIADEGGGSEPAKPVQTKKVQSPGSGNQGSLF 529


>gi|222147129|ref|YP_002548086.1| exodeoxyribonuclease VII large subunit [Agrobacterium vitis S4]
 gi|254783685|sp|B9JYI6|EX7L_AGRVS RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|221734119|gb|ACM35082.1| exodeoxyribonuclease VII large subunit [Agrobacterium vitis S4]
          Length = 543

 Score =  441 bits (1134), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 233/529 (44%), Positives = 329/529 (62%), Gaps = 13/529 (2%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           E+SVSELS  +K  +E+    V VRGEISG+RG HSSGHAYFSLKD+ +RIDA+IWKG+ 
Sbjct: 15  EFSVSELSGSIKRTIETAFDQVRVRGEISGFRGQHSSGHAYFSLKDDKARIDAVIWKGSF 74

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
           +K+++ PEEG+E +  G+ITTFPGSSKYQI+IE + P+G+G L+  +E+RK++   EGLF
Sbjct: 75  SKLKYRPEEGMEVIATGRITTFPGSSKYQIVIEQMEPAGAGALMALIEERKRRFTAEGLF 134

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
               K  +PF+PK+I V+TSPTGAVIRDIL RIS RFP+ V+++PVKVQG+    E+ANA
Sbjct: 135 DPATKQLLPFMPKVIGVVTSPTGAVIRDILHRISDRFPVHVLVWPVKVQGEGSGDEVANA 194

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N  +     PRPD++I+ARGGGS+EDLW FNDE +VRA A S+IP+ISA+GHETDW
Sbjct: 195 INGFNAFQPDGVIPRPDVLIVARGGGSLEDLWSFNDEAVVRAAAASAIPLISAVGHETDW 254

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL DYAAD+RAPTPTGAAEMAVPVK  L++ L  L ARL   + R + ++   L +L +A
Sbjct: 255 TLIDYAADVRAPTPTGAAEMAVPVKADLEAQLAGLAARLAGAVNRQMDHRRQNLRALARA 314

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           LP+ DQ L+  R R D     L  +LE+    K + F     ++  D L+  + + RQ +
Sbjct: 315 LPSLDQLLALPRRRFDEAASGLGRSLELNTMTKRQSFERAAAKLSPDMLVRRLVERRQRV 374

Query: 374 LEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSH 433
            E+    ++I+++ +           A L  +  + K +       +     R +  + +
Sbjct: 375 SERAALSDRIIERLIERQKANLGRIDATLTAVPARLKAQTGRSRDRLDSFSRRADSAVIN 434

Query: 434 KIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDGQ 493
            ++   ++VS   R+LQS +YKN L RGY  I+  ++  +++   L     I I F DG+
Sbjct: 435 DLRRARSTVSAHDRMLQSLSYKNVLMRGYAVIRGQDDRPLSRAAGLEDGRAIAIEFADGR 494

Query: 494 ANAIV--INKAPPKEQ---------PTKKCQLHNN--KREKQGTQGELF 529
            +A+    +KA P  Q         P +   L  +  K E    QG LF
Sbjct: 495 VSAVTGEGDKASPPPQAASATTTPAPGRPNPLPKSPKKSEPPAGQGSLF 543


>gi|294853461|ref|ZP_06794133.1| exodeoxyribonuclease VII [Brucella sp. NVSL 07-0026]
 gi|294819116|gb|EFG36116.1| exodeoxyribonuclease VII [Brucella sp. NVSL 07-0026]
          Length = 513

 Score =  437 bits (1125), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 211/488 (43%), Positives = 312/488 (63%), Gaps = 8/488 (1%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           EYSVSE+S  LK  VE    HV VRGEISGYRG HSSGHAYF+LKD+ +R++A+IW+G++
Sbjct: 18  EYSVSEISGALKRTVEDTFGHVRVRGEISGYRGPHSSGHAYFALKDDRARLEAVIWRGSM 77

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
           +++ F PEEG+E +  GK+TT+PGSSKYQI+IE + P+G+G L+  LE+RK++L  EGLF
Sbjct: 78  SRLRFRPEEGMEVIATGKLTTYPGSSKYQIVIEQMEPAGAGALMALLEERKQRLAAEGLF 137

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
               K  +PF+P++I V+TSPTGAVIRDI+ RIS R+PLRVI++PV+VQGD C  E+A A
Sbjct: 138 DPALKQLLPFMPRVIGVVTSPTGAVIRDIIHRISDRYPLRVIVWPVRVQGDTCGPEVATA 197

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           +   NTL +    PRPD++I+ARGGGS+EDLW FNDE++VRA+A S IP+ISA+GHETDW
Sbjct: 198 VNGFNTLPDDGPIPRPDVLIVARGGGSLEDLWGFNDEIVVRAVAASHIPVISAVGHETDW 257

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D AAD+RAPTPTGAAEMAVPVK  LQ+SL +  ARL++ + R    K     + ++A
Sbjct: 258 TLIDLAADMRAPTPTGAAEMAVPVKADLQASLASQSARLSSAMSRFFDQKRQAHRAAVRA 317

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           +P++DQ L+  R R D     L   L +   +K  HF+    ++    L   + +  + +
Sbjct: 318 MPSADQLLALPRRRFDEAASRLTRALFVNTQKKRVHFDGHARQLSPRLLQRRLVELERGV 377

Query: 374 LEKQQHIEQIVKQHL---RYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFI 430
               Q + + ++  L   R  F  +  +++   +LR     R     + +++L  R +  
Sbjct: 378 TMLGQRLPRALEAFLRERRTAFTHRANRLSPEPILR-----RTRLTGSTLEQLDRRRDQA 432

Query: 431 LSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFF 490
           +   I+          R++++ +Y++ L+RG+  + D     + Q   ++    + + F 
Sbjct: 433 VRLLIERVKRRSQELDRLMRTLSYESVLERGFAVVFDAQGKPVKQAAAVSPGDALSVRFR 492

Query: 491 DGQANAIV 498
           DG    + 
Sbjct: 493 DGDVGVVA 500


>gi|153010319|ref|YP_001371533.1| exodeoxyribonuclease VII large subunit [Ochrobactrum anthropi ATCC
           49188]
 gi|166232359|sp|A6X3A0|EX7L_OCHA4 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|151562207|gb|ABS15704.1| exodeoxyribonuclease VII, large subunit [Ochrobactrum anthropi ATCC
           49188]
          Length = 527

 Score =  436 bits (1120), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 217/519 (41%), Positives = 322/519 (62%), Gaps = 10/519 (1%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           EYSVSE+S  LK  VE    HV VRGEISGYRG HSSGHAYF+LKD+ +R++A+IW+G++
Sbjct: 16  EYSVSEISGALKRTVEDTFGHVRVRGEISGYRGPHSSGHAYFALKDDRARLEAVIWRGSM 75

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
           +++ F PEEG+E +  GK+TT+PGSSKYQI+IE + P+G+G L+  LE+RK++L  EGLF
Sbjct: 76  SRLRFRPEEGMEVIATGKLTTYPGSSKYQIVIEQMEPAGAGALMALLEERKRRLATEGLF 135

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
               K  +PF+P++I V+TSPTGAVIRDI+ RI+ R+PL VI++PV+VQG+    E+A A
Sbjct: 136 DPAVKQLLPFMPRVIGVVTSPTGAVIRDIIHRIADRYPLHVIVWPVRVQGETSGPEVAAA 195

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           +   N L +    PRPD++I+ARGGGS+EDLW FNDE++VRA+A S IP+ISA+GHETDW
Sbjct: 196 VDGFNALPDEGNIPRPDVLIVARGGGSLEDLWGFNDEIVVRAVAASHIPVISAVGHETDW 255

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D AAD+RAPTPTGAAEMAVPVK  L ++L    ARL++ + R I  K     S  +A
Sbjct: 256 TLIDLAADIRAPTPTGAAEMAVPVKADLLATLAGQSARLSSAMSRFIDLKRQAHRSAARA 315

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           LP++DQ L+  R R D     L   L +   +K  HF+    ++    L     + ++ +
Sbjct: 316 LPSADQLLALPRRRFDEAAARLTRALFVNTQKKRVHFDGHARQLSPRLLQRRFTELQRDV 375

Query: 374 LEKQQHIEQIVKQHL---RYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFI 430
               Q + + ++  L   R  F+ +  +++   +LR     R       I++L  R +  
Sbjct: 376 SALGQRLPRALEAFLRERRTAFIHRANRLSAEPILR-----RTKLTSVAIEQLDRRRDQA 430

Query: 431 LSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFF 490
           +   I+          R++++ +Y++ L+RG+  + D     + Q  +++    + I F 
Sbjct: 431 VRLLIERAKRRGQELERLMRTLSYESVLERGFAVVFDEEGKPVKQAGSVSAGDALSIRFR 490

Query: 491 DGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
           DG+   +  ++   + +P K  Q    +    G QG LF
Sbjct: 491 DGEVAVVAGDE--DESEPAKLVQTKKVQSPGSGNQGSLF 527


>gi|225686532|ref|YP_002734504.1| exodeoxyribonuclease VII large subunit [Brucella melitensis ATCC
           23457]
 gi|256262331|ref|ZP_05464863.1| exodeoxyribonuclease 7 large subunit [Brucella melitensis bv. 2
           str. 63/9]
 gi|254783692|sp|C0RLR7|EX7L_BRUMB RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|225642637|gb|ACO02550.1| exodeoxyribonuclease VII, large subunit [Brucella melitensis ATCC
           23457]
 gi|263092059|gb|EEZ16356.1| exodeoxyribonuclease 7 large subunit [Brucella melitensis bv. 2
           str. 63/9]
 gi|326410913|gb|ADZ67977.1| exodeoxyribonuclease VII large subunit [Brucella melitensis M28]
 gi|326554204|gb|ADZ88843.1| exodeoxyribonuclease VII large subunit [Brucella melitensis M5-90]
          Length = 511

 Score =  434 bits (1116), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 212/488 (43%), Positives = 311/488 (63%), Gaps = 8/488 (1%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           EYSVSE+S  LK  VE    HV VRGEISGYRG HSSGHAYF+LKD+ +R++A+IW+G++
Sbjct: 16  EYSVSEISGALKRTVEDTFGHVRVRGEISGYRGPHSSGHAYFALKDDRARLEAVIWRGSM 75

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
           +++ F PEEG+E +  GK+TT+PGSSKYQI+IE + P+G+G L+  LE+RK++L  EGLF
Sbjct: 76  SRLRFRPEEGMEVIATGKLTTYPGSSKYQIVIEQMEPAGAGALMALLEERKQRLAAEGLF 135

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
               K  +PF+P++I V+TSPTGAVIRDI+ RIS R+PLRVI++PV+VQGD C  E+A A
Sbjct: 136 DPALKQLLPFMPRVIGVVTSPTGAVIRDIIHRISDRYPLRVIVWPVRVQGDTCGPEVATA 195

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           +   NTL +    PRPD++I+ARGGGS+EDLW FNDE++VRA+A S IP+ISA+GHETDW
Sbjct: 196 VNGFNTLPDDGPIPRPDVLIVARGGGSLEDLWGFNDEIVVRAVAASHIPVISAVGHETDW 255

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D AAD+RAPTPTGAAEMAVPVK  LQ+SL +  ARL++ + R    K     +  +A
Sbjct: 256 TLIDLAADMRAPTPTGAAEMAVPVKADLQASLASQSARLSSAMSRFFDQKRQAHRAAARA 315

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           +P++DQ L+  R R D     L   L +   +K  HF+    ++    L   + +  + +
Sbjct: 316 MPSADQLLALPRRRFDEAASRLTRALFVNTQKKRVHFDGHARQLSPRLLQRRLVELERGV 375

Query: 374 LEKQQHIEQIVKQHL---RYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFI 430
               Q + + ++  L   R  F  +  +++   +LR     R     + +++L  R +  
Sbjct: 376 TMLGQRLPRALEAFLRERRTAFTHRANRLSPEPILR-----RTRLTGSTLEQLDRRRDQA 430

Query: 431 LSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFF 490
           +   I+          R++++ +Y++ L+RG+  + D     + Q   ++    + I F 
Sbjct: 431 VRLLIERVKRRSQELDRLMRTLSYESVLERGFAVVFDAQGKPVKQAAAVSPGDALSIRFR 490

Query: 491 DGQANAIV 498
           DG    + 
Sbjct: 491 DGDVGVVA 498


>gi|254695790|ref|ZP_05157618.1| exodeoxyribonuclease VII large subunit [Brucella abortus bv. 3 str.
           Tulya]
 gi|254705758|ref|ZP_05167586.1| exodeoxyribonuclease VII large subunit [Brucella pinnipedialis
           M163/99/10]
 gi|254710990|ref|ZP_05172801.1| exodeoxyribonuclease VII large subunit [Brucella pinnipedialis
           B2/94]
 gi|256029372|ref|ZP_05442986.1| exodeoxyribonuclease VII large subunit [Brucella pinnipedialis
           M292/94/1]
 gi|256043639|ref|ZP_05446564.1| exodeoxyribonuclease VII large subunit [Brucella melitensis bv. 1
           str. Rev.1]
 gi|256111324|ref|ZP_05452350.1| exodeoxyribonuclease VII large subunit [Brucella melitensis bv. 3
           str. Ether]
 gi|256157564|ref|ZP_05455482.1| exodeoxyribonuclease VII large subunit [Brucella ceti M490/95/1]
 gi|256253461|ref|ZP_05458997.1| exodeoxyribonuclease VII large subunit [Brucella ceti B1/94]
 gi|260167540|ref|ZP_05754351.1| exodeoxyribonuclease VII large subunit [Brucella sp. F5/99]
 gi|260564829|ref|ZP_05835314.1| exodeoxyribonuclease 7 large subunit [Brucella melitensis bv. 1
           str. 16M]
 gi|261220588|ref|ZP_05934869.1| exodeoxyribonuclease 7 large subunit [Brucella ceti B1/94]
 gi|261313179|ref|ZP_05952376.1| exodeoxyribonuclease 7 large subunit [Brucella pinnipedialis
           M163/99/10]
 gi|261318571|ref|ZP_05957768.1| exodeoxyribonuclease 7 large subunit [Brucella pinnipedialis B2/94]
 gi|261756959|ref|ZP_06000668.1| exodeoxyribonuclease 7 large subunit [Brucella sp. F5/99]
 gi|265986371|ref|ZP_06098928.1| exodeoxyribonuclease 7 large subunit [Brucella pinnipedialis
           M292/94/1]
 gi|265990059|ref|ZP_06102616.1| exodeoxyribonuclease 7 large subunit [Brucella melitensis bv. 1
           str. Rev.1]
 gi|265992830|ref|ZP_06105387.1| exodeoxyribonuclease 7 large subunit [Brucella melitensis bv. 3
           str. Ether]
 gi|265996065|ref|ZP_06108622.1| exodeoxyribonuclease 7 large subunit [Brucella ceti M490/95/1]
 gi|31563442|sp|Q8YCK1|EX7L_BRUME RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|260152472|gb|EEW87565.1| exodeoxyribonuclease 7 large subunit [Brucella melitensis bv. 1
           str. 16M]
 gi|260919172|gb|EEX85825.1| exodeoxyribonuclease 7 large subunit [Brucella ceti B1/94]
 gi|261297794|gb|EEY01291.1| exodeoxyribonuclease 7 large subunit [Brucella pinnipedialis B2/94]
 gi|261302205|gb|EEY05702.1| exodeoxyribonuclease 7 large subunit [Brucella pinnipedialis
           M163/99/10]
 gi|261736943|gb|EEY24939.1| exodeoxyribonuclease 7 large subunit [Brucella sp. F5/99]
 gi|262550362|gb|EEZ06523.1| exodeoxyribonuclease 7 large subunit [Brucella ceti M490/95/1]
 gi|262763700|gb|EEZ09732.1| exodeoxyribonuclease 7 large subunit [Brucella melitensis bv. 3
           str. Ether]
 gi|263000728|gb|EEZ13418.1| exodeoxyribonuclease 7 large subunit [Brucella melitensis bv. 1
           str. Rev.1]
 gi|264658568|gb|EEZ28829.1| exodeoxyribonuclease 7 large subunit [Brucella pinnipedialis
           M292/94/1]
          Length = 511

 Score =  434 bits (1115), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 211/488 (43%), Positives = 311/488 (63%), Gaps = 8/488 (1%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           EYSVSE+S  LK  VE    HV VRGEISGYRG HSSGHAYF+LKD+ +R++A+IW+G++
Sbjct: 16  EYSVSEISGALKRTVEDTFGHVRVRGEISGYRGPHSSGHAYFALKDDRARLEAVIWRGSM 75

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
           +++ F PEEG+E +  GK+TT+PGSSKYQI+IE + P+G+G L+  LE+RK++L  EGLF
Sbjct: 76  SRLRFRPEEGMEVIATGKLTTYPGSSKYQIVIEQMEPAGAGALMALLEERKQRLAAEGLF 135

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
               K  +PF+P++I V+TSPTGAVIRDI+ RIS R+PLRVI++PV+VQGD C  E+A A
Sbjct: 136 DPALKQLLPFMPRVIGVVTSPTGAVIRDIIHRISDRYPLRVIVWPVRVQGDTCGPEVATA 195

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           +   NTL +    PRPD++I+ARGGGS+EDLW FNDE++VRA+A S IP+ISA+GHETDW
Sbjct: 196 VNGFNTLPDDGPIPRPDVLIVARGGGSLEDLWGFNDEIVVRAVAASHIPVISAVGHETDW 255

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D AAD+RAPTPTGAAEMAVPVK  LQ+SL +  ARL++ + R    K     +  +A
Sbjct: 256 TLIDLAADMRAPTPTGAAEMAVPVKADLQASLASQSARLSSAMSRFFDQKRQAHRAAARA 315

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           +P++DQ L+  R R D     L   L +   +K  HF+    ++    L   + +  + +
Sbjct: 316 MPSADQLLALPRRRFDEAASRLTRALFVNTQKKRVHFDGHARQLSPRLLQRRLVELERGV 375

Query: 374 LEKQQHIEQIVKQHL---RYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFI 430
               Q + + ++  L   R  F  +  +++   +LR     R     + +++L  R +  
Sbjct: 376 TMLGQRLPRALEAFLRERRTAFTHRANRLSPEPILR-----RTRLTGSTLEQLDRRRDQA 430

Query: 431 LSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFF 490
           +   I+          R++++ +Y++ L+RG+  + D     + Q   ++    + + F 
Sbjct: 431 VRLLIERVKRRSQELDRLMRTLSYESVLERGFAVVFDAQGKPVKQAAAVSPGDALSVRFR 490

Query: 491 DGQANAIV 498
           DG    + 
Sbjct: 491 DGDVGVVA 498


>gi|161620822|ref|YP_001594708.1| exodeoxyribonuclease VII large subunit [Brucella canis ATCC 23365]
 gi|254703100|ref|ZP_05164928.1| exodeoxyribonuclease VII large subunit [Brucella suis bv. 3 str.
           686]
 gi|260567971|ref|ZP_05838440.1| exodeoxyribonuclease 7 large subunit [Brucella suis bv. 4 str. 40]
 gi|261753717|ref|ZP_05997426.1| exodeoxyribonuclease 7 large subunit [Brucella suis bv. 3 str. 686]
 gi|189037854|sp|A9MC50|EX7L_BRUC2 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|161337633|gb|ABX63937.1| exodeoxyribonuclease VII, large subunit [Brucella canis ATCC 23365]
 gi|260154636|gb|EEW89717.1| exodeoxyribonuclease 7 large subunit [Brucella suis bv. 4 str. 40]
 gi|261743470|gb|EEY31396.1| exodeoxyribonuclease 7 large subunit [Brucella suis bv. 3 str. 686]
          Length = 511

 Score =  434 bits (1115), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 211/488 (43%), Positives = 311/488 (63%), Gaps = 8/488 (1%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           EYSVSE+S  LK  VE    HV VRGEISGYRG HSSGHAYF+LKD+ +R++A+IW+G++
Sbjct: 16  EYSVSEISGALKRTVEDTFGHVRVRGEISGYRGPHSSGHAYFALKDDRARLEAVIWRGSM 75

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
           +++ F PEEG+E +  GK+TT+PGSSKYQI+IE + P+G+G L+  LE+RK++L  EGLF
Sbjct: 76  SRLRFRPEEGMEVIATGKLTTYPGSSKYQIVIEQMEPAGAGALMALLEERKQRLAAEGLF 135

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
               K  +PF+P++I V+TSPTGAVIRDI+ RIS R+PLRVI++PV+VQGD C  E+A A
Sbjct: 136 DPALKQLLPFMPRVIGVVTSPTGAVIRDIIHRISDRYPLRVIVWPVRVQGDTCGPEVATA 195

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           +   NTL +    PRPD++I+ARGGGS+EDLW FNDE++VRA+A S IP+ISA+GHETDW
Sbjct: 196 VNGFNTLPDDGPIPRPDVLIVARGGGSLEDLWGFNDEIVVRAVAASHIPVISAVGHETDW 255

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D AAD+RAPTPTGAAEMAVPVK  LQ+SL +  ARL++ + R    K     +  +A
Sbjct: 256 TLIDLAADMRAPTPTGAAEMAVPVKADLQASLASQSARLSSAMSRFFDQKRQAHRAAARA 315

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           +P++DQ L+  R R D     L   L +   +K  HF+    ++    L   + +  + +
Sbjct: 316 MPSADQLLALPRRRFDEAASRLTRALFVNTQKKRVHFDGHARQLSPRLLQRRLVELERGV 375

Query: 374 LEKQQHIEQIVKQHLR---YIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFI 430
               Q + + ++  LR     F  +  +++   +LR     R     + +++L  R +  
Sbjct: 376 TMLGQRLPRALEAFLRERQTAFTHRANRLSPEPILR-----RTRLTGSTLEQLDRRRDQA 430

Query: 431 LSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFF 490
           +   I+          R++++ +Y++ L+RG+  + D     + Q   ++    + + F 
Sbjct: 431 VRLLIERVKRRSQELDRLMRTLSYESVLERGFAVVFDAQGKPVKQAAAVSPGDALSVRFR 490

Query: 491 DGQANAIV 498
           DG    + 
Sbjct: 491 DGDVGVVA 498


>gi|17988872|ref|NP_541505.1| exodeoxyribonuclease VII large subunit [Brucella melitensis bv. 1
           str. 16M]
 gi|225629238|ref|ZP_03787271.1| exodeoxyribonuclease VII, large subunit [Brucella ceti str. Cudo]
 gi|261216208|ref|ZP_05930489.1| exodeoxyribonuclease VII large subunit [Brucella abortus bv. 3 str.
           Tulya]
 gi|17984697|gb|AAL53769.1| exodeoxyribonuclease vii large subunit [Brucella melitensis bv. 1
           str. 16M]
 gi|225615734|gb|EEH12783.1| exodeoxyribonuclease VII, large subunit [Brucella ceti str. Cudo]
 gi|260917815|gb|EEX84676.1| exodeoxyribonuclease VII large subunit [Brucella abortus bv. 3 str.
           Tulya]
          Length = 513

 Score =  434 bits (1115), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 211/488 (43%), Positives = 311/488 (63%), Gaps = 8/488 (1%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           EYSVSE+S  LK  VE    HV VRGEISGYRG HSSGHAYF+LKD+ +R++A+IW+G++
Sbjct: 18  EYSVSEISGALKRTVEDTFGHVRVRGEISGYRGPHSSGHAYFALKDDRARLEAVIWRGSM 77

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
           +++ F PEEG+E +  GK+TT+PGSSKYQI+IE + P+G+G L+  LE+RK++L  EGLF
Sbjct: 78  SRLRFRPEEGMEVIATGKLTTYPGSSKYQIVIEQMEPAGAGALMALLEERKQRLAAEGLF 137

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
               K  +PF+P++I V+TSPTGAVIRDI+ RIS R+PLRVI++PV+VQGD C  E+A A
Sbjct: 138 DPALKQLLPFMPRVIGVVTSPTGAVIRDIIHRISDRYPLRVIVWPVRVQGDTCGPEVATA 197

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           +   NTL +    PRPD++I+ARGGGS+EDLW FNDE++VRA+A S IP+ISA+GHETDW
Sbjct: 198 VNGFNTLPDDGPIPRPDVLIVARGGGSLEDLWGFNDEIVVRAVAASHIPVISAVGHETDW 257

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D AAD+RAPTPTGAAEMAVPVK  LQ+SL +  ARL++ + R    K     +  +A
Sbjct: 258 TLIDLAADMRAPTPTGAAEMAVPVKADLQASLASQSARLSSAMSRFFDQKRQAHRAAARA 317

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           +P++DQ L+  R R D     L   L +   +K  HF+    ++    L   + +  + +
Sbjct: 318 MPSADQLLALPRRRFDEAASRLTRALFVNTQKKRVHFDGHARQLSPRLLQRRLVELERGV 377

Query: 374 LEKQQHIEQIVKQHL---RYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFI 430
               Q + + ++  L   R  F  +  +++   +LR     R     + +++L  R +  
Sbjct: 378 TMLGQRLPRALEAFLRERRTAFTHRANRLSPEPILR-----RTRLTGSTLEQLDRRRDQA 432

Query: 431 LSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFF 490
           +   I+          R++++ +Y++ L+RG+  + D     + Q   ++    + + F 
Sbjct: 433 VRLLIERVKRRSQELDRLMRTLSYESVLERGFAVVFDAQGKPVKQAAAVSPGDALSVRFR 492

Query: 491 DGQANAIV 498
           DG    + 
Sbjct: 493 DGDVGVVA 500


>gi|256015528|ref|YP_003105537.1| exodeoxyribonuclease VII large subunit [Brucella microti CCM 4915]
 gi|255998188|gb|ACU49875.1| exodeoxyribonuclease VII large subunit [Brucella microti CCM 4915]
          Length = 511

 Score =  433 bits (1114), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 211/488 (43%), Positives = 311/488 (63%), Gaps = 8/488 (1%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           EYSVSE+S  LK  VE    HV VRGEISGYRG HSSGHAYF+LKD+ +R++A+IW+G++
Sbjct: 16  EYSVSEISGALKRTVEDTFGHVRVRGEISGYRGPHSSGHAYFALKDDRARLEAVIWRGSM 75

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
           +++ F PEEG+E +  GK+TT+PGSSKYQI+IE + P+G+G L+  LE+RK++L  EGLF
Sbjct: 76  SRLRFRPEEGMEVIATGKLTTYPGSSKYQIVIEQMEPAGAGALMALLEERKQRLAAEGLF 135

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
               K  +PF+P++I V+TSPTGAVIRDI+ RIS R+PLRVI++PV+VQGD C  E+A A
Sbjct: 136 DPALKQLLPFMPRVIGVVTSPTGAVIRDIIHRISDRYPLRVIVWPVRVQGDTCGPEVATA 195

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           +   NTL +    PRPD++I+ARGGGS+EDLW FNDE++VRA+A S IP+ISA+GHETDW
Sbjct: 196 VNGFNTLPDDGPIPRPDVLIVARGGGSLEDLWGFNDEIVVRAVAASHIPVISAVGHETDW 255

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D AAD+RAPTPTGAAEMAVPVK  LQ+SL +  ARL++ + R    K     +  +A
Sbjct: 256 TLIDLAADMRAPTPTGAAEMAVPVKADLQASLASQSARLSSAMSRFFDQKRQAHRAAARA 315

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           +P++DQ L+  R R D     L   L +   +K  HF+    ++    L   + +  + +
Sbjct: 316 MPSADQLLALPRRRFDEAASRLTRALFVNTQKKRVHFDGHARQLSPRLLQRRLVELERGV 375

Query: 374 LEKQQHIEQIVKQHL---RYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFI 430
               Q + + ++  L   R  F  +  +++   +LR     R     + +++L  R +  
Sbjct: 376 TMLGQRLPRALEAFLRERRTAFTHRANRLSPEPILR-----RTRLTGSTLEQLDRRRDQA 430

Query: 431 LSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFF 490
           +   I+          R++++ +Y++ L+RG+  + D     + Q   ++    + + F 
Sbjct: 431 VRLLIERVKRRSQELDRLMRTLSYESVLERGFAVVFDAQGKPVKQAAAVSPGDALSVRFR 490

Query: 491 DGQANAIV 498
           DG    + 
Sbjct: 491 DGDVGVVA 498


>gi|237816952|ref|ZP_04595944.1| exodeoxyribonuclease VII, large subunit [Brucella abortus str. 2308
           A]
 gi|260756483|ref|ZP_05868831.1| exodeoxyribonuclease VII large subunit [Brucella abortus bv. 6 str.
           870]
 gi|260759915|ref|ZP_05872263.1| exodeoxyribonuclease VII large subunit [Brucella abortus bv. 4 str.
           292]
 gi|260763153|ref|ZP_05875485.1| exodeoxyribonuclease VII large subunit [Brucella abortus bv. 2 str.
           86/8/59]
 gi|237787765|gb|EEP61981.1| exodeoxyribonuclease VII, large subunit [Brucella abortus str. 2308
           A]
 gi|260670233|gb|EEX57173.1| exodeoxyribonuclease VII large subunit [Brucella abortus bv. 4 str.
           292]
 gi|260673574|gb|EEX60395.1| exodeoxyribonuclease VII large subunit [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260676591|gb|EEX63412.1| exodeoxyribonuclease VII large subunit [Brucella abortus bv. 6 str.
           870]
          Length = 513

 Score =  433 bits (1114), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 211/488 (43%), Positives = 311/488 (63%), Gaps = 8/488 (1%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           EYSVSE+S  LK  VE    HV VRGEISGYRG HSSGHAYF+LKD+ +R++A+IW+G++
Sbjct: 18  EYSVSEISGALKRTVEDTFGHVRVRGEISGYRGPHSSGHAYFALKDDRARLEAVIWRGSM 77

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
           +++ F PEEG+E +  GK+TT+PGSSKYQI+IE + P+G+G L+  LE+RK++L  EGLF
Sbjct: 78  SRLRFRPEEGMEVIATGKLTTYPGSSKYQIVIEQMEPAGAGALMALLEERKQRLAAEGLF 137

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
               K  +PF+P++I V+TSPTGAVIRDI+ RIS R+PLRVI++PV+VQGD C  E+A A
Sbjct: 138 DPTLKQLLPFMPRVIGVVTSPTGAVIRDIIHRISDRYPLRVIVWPVRVQGDTCGPEVATA 197

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           +   NTL +    PRPD++I+ARGGGS+EDLW FNDE++VRA+A S IP+ISA+GHETDW
Sbjct: 198 VNGFNTLPDDGPIPRPDVLIVARGGGSLEDLWGFNDEIVVRAVAASHIPVISAVGHETDW 257

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D AAD+RAPTPTGAAEMAVPVK  LQ+SL +  ARL++ + R    K     +  +A
Sbjct: 258 TLIDLAADMRAPTPTGAAEMAVPVKADLQASLASQSARLSSAMSRFFDQKRQAHRAAARA 317

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           +P++DQ L+  R R D     L   L +   +K  HF+    ++    L   + +  + +
Sbjct: 318 MPSADQLLALPRRRFDEAASRLTRALFVNTQKKRVHFDGHARQLSPRLLQRRLVELERGV 377

Query: 374 LEKQQHIEQIVKQHL---RYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFI 430
               Q + + ++  L   R  F  +  +++   +LR     R     + +++L  R +  
Sbjct: 378 TMLGQRLPRALEAFLRERRTAFTHRANRLSPEPILR-----RTRLTGSTLEQLDRRRDQA 432

Query: 431 LSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFF 490
           +   I+          R++++ +Y++ L+RG+  + D     + Q   ++    + + F 
Sbjct: 433 VRLLIERVKRRSQELDRLMRTLSYESVLERGFAVVFDAQGKPVKQAAAVSPGDALSVRFR 492

Query: 491 DGQANAIV 498
           DG    + 
Sbjct: 493 DGDVGVVA 500


>gi|62317398|ref|YP_223251.1| exodeoxyribonuclease VII large subunit [Brucella abortus bv. 1 str.
           9-941]
 gi|83269378|ref|YP_418669.1| exodeoxyribonuclease VII large subunit [Brucella melitensis biovar
           Abortus 2308]
 gi|189022653|ref|YP_001932394.1| exodeoxyribonuclease VII large subunit [Brucella abortus S19]
 gi|254690900|ref|ZP_05154154.1| exodeoxyribonuclease VII large subunit [Brucella abortus bv. 6 str.
           870]
 gi|254698681|ref|ZP_05160509.1| exodeoxyribonuclease VII large subunit [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254732128|ref|ZP_05190706.1| exodeoxyribonuclease VII large subunit [Brucella abortus bv. 4 str.
           292]
 gi|256256085|ref|ZP_05461621.1| exodeoxyribonuclease VII large subunit [Brucella abortus bv. 9 str.
           C68]
 gi|260544636|ref|ZP_05820457.1| exonuclease VII [Brucella abortus NCTC 8038]
 gi|260882304|ref|ZP_05893918.1| exodeoxyribonuclease 7 large subunit [Brucella abortus bv. 9 str.
           C68]
 gi|297249439|ref|ZP_06933140.1| exodeoxyribonuclease VII, large subunit [Brucella abortus bv. 5
           str. B3196]
 gi|81309307|sp|Q578P4|EX7L_BRUAB RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|123546037|sp|Q2YL15|EX7L_BRUA2 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|226694639|sp|B2SAR1|EX7L_BRUA1 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|62197591|gb|AAX75890.1| XseA, exodeoxyribonuclease VII, large subunit [Brucella abortus bv.
           1 str. 9-941]
 gi|82939652|emb|CAJ12641.1| Exonuclease VII, large subunit:OB-fold nucleic acid binding domain
           [Brucella melitensis biovar Abortus 2308]
 gi|189021227|gb|ACD73948.1| Exonuclease VII, large subunit [Brucella abortus S19]
 gi|260097907|gb|EEW81781.1| exonuclease VII [Brucella abortus NCTC 8038]
 gi|260871832|gb|EEX78901.1| exodeoxyribonuclease 7 large subunit [Brucella abortus bv. 9 str.
           C68]
 gi|297173308|gb|EFH32672.1| exodeoxyribonuclease VII, large subunit [Brucella abortus bv. 5
           str. B3196]
          Length = 511

 Score =  433 bits (1114), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 211/488 (43%), Positives = 311/488 (63%), Gaps = 8/488 (1%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           EYSVSE+S  LK  VE    HV VRGEISGYRG HSSGHAYF+LKD+ +R++A+IW+G++
Sbjct: 16  EYSVSEISGALKRTVEDTFGHVRVRGEISGYRGPHSSGHAYFALKDDRARLEAVIWRGSM 75

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
           +++ F PEEG+E +  GK+TT+PGSSKYQI+IE + P+G+G L+  LE+RK++L  EGLF
Sbjct: 76  SRLRFRPEEGMEVIATGKLTTYPGSSKYQIVIEQMEPAGAGALMALLEERKQRLAAEGLF 135

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
               K  +PF+P++I V+TSPTGAVIRDI+ RIS R+PLRVI++PV+VQGD C  E+A A
Sbjct: 136 DPTLKQLLPFMPRVIGVVTSPTGAVIRDIIHRISDRYPLRVIVWPVRVQGDTCGPEVATA 195

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           +   NTL +    PRPD++I+ARGGGS+EDLW FNDE++VRA+A S IP+ISA+GHETDW
Sbjct: 196 VNGFNTLPDDGPIPRPDVLIVARGGGSLEDLWGFNDEIVVRAVAASHIPVISAVGHETDW 255

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D AAD+RAPTPTGAAEMAVPVK  LQ+SL +  ARL++ + R    K     +  +A
Sbjct: 256 TLIDLAADMRAPTPTGAAEMAVPVKADLQASLASQSARLSSAMSRFFDQKRQAHRAAARA 315

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           +P++DQ L+  R R D     L   L +   +K  HF+    ++    L   + +  + +
Sbjct: 316 MPSADQLLALPRRRFDEAASRLTRALFVNTQKKRVHFDGHARQLSPRLLQRRLVELERGV 375

Query: 374 LEKQQHIEQIVKQHL---RYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFI 430
               Q + + ++  L   R  F  +  +++   +LR     R     + +++L  R +  
Sbjct: 376 TMLGQRLPRALEAFLRERRTAFTHRANRLSPEPILR-----RTRLTGSTLEQLDRRRDQA 430

Query: 431 LSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFF 490
           +   I+          R++++ +Y++ L+RG+  + D     + Q   ++    + + F 
Sbjct: 431 VRLLIERVKRRSQELDRLMRTLSYESVLERGFAVVFDAQGKPVKQAAAVSPGDALSVRFR 490

Query: 491 DGQANAIV 498
           DG    + 
Sbjct: 491 DGDVGVVA 498


>gi|254712538|ref|ZP_05174349.1| exodeoxyribonuclease VII large subunit [Brucella ceti M644/93/1]
 gi|254715610|ref|ZP_05177421.1| exodeoxyribonuclease VII large subunit [Brucella ceti M13/05/1]
 gi|261217358|ref|ZP_05931639.1| exodeoxyribonuclease 7 large subunit [Brucella ceti M13/05/1]
 gi|261320231|ref|ZP_05959428.1| exodeoxyribonuclease 7 large subunit [Brucella ceti M644/93/1]
 gi|260922447|gb|EEX89015.1| exodeoxyribonuclease 7 large subunit [Brucella ceti M13/05/1]
 gi|261292921|gb|EEX96417.1| exodeoxyribonuclease 7 large subunit [Brucella ceti M644/93/1]
          Length = 511

 Score =  433 bits (1114), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 211/488 (43%), Positives = 311/488 (63%), Gaps = 8/488 (1%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           EYSVSE+S  LK  VE    HV VRGEISGYRG HSSGHAYF+LKD+ +R++A+IW+G++
Sbjct: 16  EYSVSEISGALKRTVEDTFGHVRVRGEISGYRGPHSSGHAYFALKDDRARLEAVIWRGSM 75

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
           +++ F PEEG+E +  GK+TT+PGSSKYQI+IE + P+G+G L+  LE+RK++L  EGLF
Sbjct: 76  SRLRFRPEEGMEVIATGKLTTYPGSSKYQIVIEQMEPAGAGALMALLEERKQRLAAEGLF 135

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
               K  +PF+P++I V+TSPTGAVIRDI+ RIS R+PLRVI++PV+VQGD C  E+A A
Sbjct: 136 DPALKQLLPFMPRVIGVVTSPTGAVIRDIIHRISDRYPLRVIVWPVRVQGDTCGPEVATA 195

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           +   NTL +    PRPD++I+ARGGGS+EDLW FNDE++VRA+A S IP+ISA+GHETDW
Sbjct: 196 VNGFNTLPDDGPIPRPDVLIVARGGGSLEDLWGFNDEIVVRAVAASHIPVISAVGHETDW 255

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D AAD+RAPTPTGAAEMAVPVK  LQ+SL +  ARL++ + R    K     +  +A
Sbjct: 256 TLIDLAADMRAPTPTGAAEMAVPVKADLQASLASQSARLSSAMSRFFDQKRQAHRAAARA 315

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           +P++DQ L+  R R D     L   L +   +K  HF+    ++    L   + +  + +
Sbjct: 316 MPSADQLLALPRRRFDEAASRLTRALFVNTQKKRVHFDGHARQLSPRLLQRRLVELERGV 375

Query: 374 LEKQQHIEQIVKQHL---RYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFI 430
               Q + + ++  L   R  F  +  +++   +LR     R     + +++L  R +  
Sbjct: 376 TMLGQRLPRALEAFLRERRTAFTHRANRLSPEPILR-----RTRLTGSTLEQLDRRRDQA 430

Query: 431 LSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFF 490
           +   I+          R++++ +Y++ L+RG+  + D     + Q   ++    + + F 
Sbjct: 431 VRLLIERVKRRSQELDRLMRTLSYESVLERGFAVVFDAQGKPVKQAAAVSPGNALSVRFR 490

Query: 491 DGQANAIV 498
           DG    + 
Sbjct: 491 DGDVGVVA 498


>gi|256059060|ref|ZP_05449269.1| exodeoxyribonuclease VII large subunit [Brucella neotomae 5K33]
 gi|261323005|ref|ZP_05962202.1| exodeoxyribonuclease 7 large subunit [Brucella neotomae 5K33]
 gi|261298985|gb|EEY02482.1| exodeoxyribonuclease 7 large subunit [Brucella neotomae 5K33]
          Length = 511

 Score =  433 bits (1113), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 211/488 (43%), Positives = 311/488 (63%), Gaps = 8/488 (1%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           EYSVSE+S  LK  VE    HV VRGEISGYRG HSSGHAYF+LKD+ +R++A+IW+G++
Sbjct: 16  EYSVSEISGALKRTVEDTFGHVRVRGEISGYRGPHSSGHAYFALKDDRARLEAVIWRGSM 75

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
           +++ F PEEG+E +  GK+TT+PGSSKYQI+IE + P+G+G L+  LE+RK++L  EGLF
Sbjct: 76  SRLRFRPEEGMEVIATGKLTTYPGSSKYQIVIEQMEPAGAGALMALLEERKQRLAAEGLF 135

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
               K  +PF+P++I V+TSPTGAVIRDI+ RIS R+PLRVI++PV+VQGD C  E+A A
Sbjct: 136 DPALKQLLPFMPRVIGVVTSPTGAVIRDIIHRISDRYPLRVIVWPVRVQGDTCGPEVATA 195

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           +   NTL +    PRPD++I+ARGGGS+EDLW FNDE++VRA+A S IP+ISA+GHETDW
Sbjct: 196 VNGFNTLPDDGLIPRPDVLIVARGGGSLEDLWGFNDEIVVRAVAASHIPVISAVGHETDW 255

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D AAD+RAPTPTGAAEMAVPVK  LQ+SL +  ARL++ + R    K     +  +A
Sbjct: 256 TLIDLAADMRAPTPTGAAEMAVPVKADLQASLASQSARLSSAMSRFFDQKRQAHRAAARA 315

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           +P++DQ L+  R R D     L   L +   +K  HF+    ++    L   + +  + +
Sbjct: 316 MPSADQLLALPRRRFDEAASRLTRALFVNTQKKRVHFDGHARQLSPRLLQRRLVELERGV 375

Query: 374 LEKQQHIEQIVKQHL---RYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFI 430
               Q + + ++  L   R  F  +  +++   +LR     R     + +++L  R +  
Sbjct: 376 TMLGQRLPRALEAFLRERRTAFTHRANRLSPEPILR-----RTRLTGSTLEQLDRRRDQA 430

Query: 431 LSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFF 490
           +   I+          R++++ +Y++ L+RG+  + D     + Q   ++    + + F 
Sbjct: 431 VRLLIERVKRRSQELDRLMRTLSYESVLERGFAVVFDAQGKPVKQAAAVSPGDALSVRFR 490

Query: 491 DGQANAIV 498
           DG    + 
Sbjct: 491 DGDVGVVA 498


>gi|254699977|ref|ZP_05161805.1| exodeoxyribonuclease VII large subunit [Brucella suis bv. 5 str.
           513]
          Length = 511

 Score =  433 bits (1113), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 211/488 (43%), Positives = 311/488 (63%), Gaps = 8/488 (1%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           EYSVSE+S  LK  VE    HV VRGEISGYRG HSSGHAYF+LKD+ +R++A+IW+G++
Sbjct: 16  EYSVSEISGALKRTVEDTFGHVRVRGEISGYRGPHSSGHAYFALKDDRARLEAVIWRGSM 75

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
           +++ F PEEG+E +  GK+TT+PGSSKYQI+IE + P+G+G L+  LE+RK++L  EGLF
Sbjct: 76  SRLRFRPEEGMEVIATGKLTTYPGSSKYQIVIEQMEPAGAGALMALLEERKQRLAAEGLF 135

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
               K  +PF+P++I V+TSPTGAVIRDI+ RIS R+PLRVI++PV+VQGD C  E+A A
Sbjct: 136 DPALKQLLPFMPRVIGVVTSPTGAVIRDIIHRISDRYPLRVIVWPVRVQGDTCGPEVATA 195

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           +   NTL +    PRPD++I+ARGGGS+EDLW FNDE++VRA+A S IP+ISA+GHETDW
Sbjct: 196 VNGFNTLPDDGPIPRPDVLIVARGGGSLEDLWGFNDEIVVRAVAASHIPVISAVGHETDW 255

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D AAD+RAPTPTGAAEMAVPVK  LQ+SL +  ARL++ + R    K     +  +A
Sbjct: 256 TLIDLAADMRAPTPTGAAEMAVPVKADLQASLASQSARLSSAMSRFFDQKRQAHRAAARA 315

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           +P++DQ L+  R R D     L   L +   +K  HF+    ++    L   + +  + +
Sbjct: 316 MPSADQLLALPRRRFDEAVSRLTRALFVNTQKKRVHFDGHARQLSPRLLQRRLVELERGV 375

Query: 374 LEKQQHIEQIVKQHL---RYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFI 430
               Q + + ++  L   R  F  +  +++   +LR     R     + +++L  R +  
Sbjct: 376 TMLGQRLPRALEAFLRERRTAFTHRANRLSPEPILR-----RTRLTGSTLEQLDRRRDQA 430

Query: 431 LSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFF 490
           +   I+          R++++ +Y++ L+RG+  + D     + Q   ++    + + F 
Sbjct: 431 VRLLIERVKRRSQELDRLMRTLSYESVLERGFAVVFDAQGKPVKQAAAVSPGDALSVRFR 490

Query: 491 DGQANAIV 498
           DG    + 
Sbjct: 491 DGDVGVVA 498


>gi|148557887|ref|YP_001257710.1| exodeoxyribonuclease VII large subunit [Brucella ovis ATCC 25840]
 gi|158513787|sp|A5VV55|EX7L_BRUO2 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|148369172|gb|ABQ62044.1| exodeoxyribonuclease VII, large subunit [Brucella ovis ATCC 25840]
          Length = 511

 Score =  433 bits (1113), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 211/488 (43%), Positives = 311/488 (63%), Gaps = 8/488 (1%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           EYSVSE+S  LK  VE    HV VRGEISGYRG HSSGHAYF+LKD+ +R++A+IW+G++
Sbjct: 16  EYSVSEISGALKRTVEDMFGHVRVRGEISGYRGPHSSGHAYFALKDDRARLEAVIWRGSM 75

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
           +++ F PEEG+E +  GK+TT+PGSSKYQI+IE + P+G+G L+  LE+RK++L  EGLF
Sbjct: 76  SRLRFRPEEGMEVIATGKLTTYPGSSKYQIVIEQMEPAGAGALMALLEERKQRLAAEGLF 135

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
               K  +PF+P++I V+TSPTGAVIRDI+ RIS R+PLRVI++PV+VQGD C  E+A A
Sbjct: 136 DPALKQLLPFMPRVIGVVTSPTGAVIRDIIHRISDRYPLRVIVWPVRVQGDTCGPEVATA 195

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           +   NTL +    PRPD++I+ARGGGS+EDLW FNDE++VRA+A S IP+ISA+GHETDW
Sbjct: 196 VNGFNTLPDDGPIPRPDVLIVARGGGSLEDLWGFNDEIVVRAVAASHIPVISAVGHETDW 255

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D AAD+RAPTPTGAAEMAVPVK  LQ+SL +  ARL++ + R    K     +  +A
Sbjct: 256 TLIDLAADMRAPTPTGAAEMAVPVKADLQASLASQSARLSSAMSRFFDQKRQAHRAAARA 315

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           +P++DQ L+  R R D     L   L +   +K  HF+    ++    L   + +  + +
Sbjct: 316 MPSADQLLALPRRRFDEAASRLTRALFVNTQKKRVHFDGHARQLSPRLLQRRLVELERGV 375

Query: 374 LEKQQHIEQIVKQHL---RYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFI 430
               Q + + ++  L   R  F  +  +++   +LR     R     + +++L  R +  
Sbjct: 376 TMLGQRLPRALEAFLRERRTAFTHRANRLSPEPILR-----RTRLTGSTLEQLDRRRDQA 430

Query: 431 LSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFF 490
           +   I+          R++++ +Y++ L+RG+  + D     + Q   ++    + + F 
Sbjct: 431 VRLLIERVKRRSQELDRLMRTLSYESVLERGFAVVFDAQGKPVKQAAAVSPDDALSVRFR 490

Query: 491 DGQANAIV 498
           DG    + 
Sbjct: 491 DGDVGVVA 498


>gi|261750459|ref|ZP_05994168.1| exodeoxyribonuclease 7 large subunit [Brucella suis bv. 5 str. 513]
 gi|261740212|gb|EEY28138.1| exodeoxyribonuclease 7 large subunit [Brucella suis bv. 5 str. 513]
          Length = 513

 Score =  433 bits (1113), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 211/488 (43%), Positives = 311/488 (63%), Gaps = 8/488 (1%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           EYSVSE+S  LK  VE    HV VRGEISGYRG HSSGHAYF+LKD+ +R++A+IW+G++
Sbjct: 18  EYSVSEISGALKRTVEDTFGHVRVRGEISGYRGPHSSGHAYFALKDDRARLEAVIWRGSM 77

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
           +++ F PEEG+E +  GK+TT+PGSSKYQI+IE + P+G+G L+  LE+RK++L  EGLF
Sbjct: 78  SRLRFRPEEGMEVIATGKLTTYPGSSKYQIVIEQMEPAGAGALMALLEERKQRLAAEGLF 137

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
               K  +PF+P++I V+TSPTGAVIRDI+ RIS R+PLRVI++PV+VQGD C  E+A A
Sbjct: 138 DPALKQLLPFMPRVIGVVTSPTGAVIRDIIHRISDRYPLRVIVWPVRVQGDTCGPEVATA 197

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           +   NTL +    PRPD++I+ARGGGS+EDLW FNDE++VRA+A S IP+ISA+GHETDW
Sbjct: 198 VNGFNTLPDDGPIPRPDVLIVARGGGSLEDLWGFNDEIVVRAVAASHIPVISAVGHETDW 257

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D AAD+RAPTPTGAAEMAVPVK  LQ+SL +  ARL++ + R    K     +  +A
Sbjct: 258 TLIDLAADMRAPTPTGAAEMAVPVKADLQASLASQSARLSSAMSRFFDQKRQAHRAAARA 317

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           +P++DQ L+  R R D     L   L +   +K  HF+    ++    L   + +  + +
Sbjct: 318 MPSADQLLALPRRRFDEAVSRLTRALFVNTQKKRVHFDGHARQLSPRLLQRRLVELERGV 377

Query: 374 LEKQQHIEQIVKQHL---RYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFI 430
               Q + + ++  L   R  F  +  +++   +LR     R     + +++L  R +  
Sbjct: 378 TMLGQRLPRALEAFLRERRTAFTHRANRLSPEPILR-----RTRLTGSTLEQLDRRRDQA 432

Query: 431 LSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFF 490
           +   I+          R++++ +Y++ L+RG+  + D     + Q   ++    + + F 
Sbjct: 433 VRLLIERVKRRSQELDRLMRTLSYESVLERGFAVVFDAQGKPVKQAAAVSPGDALSVRFR 492

Query: 491 DGQANAIV 498
           DG    + 
Sbjct: 493 DGDVGVVA 500


>gi|23500501|ref|NP_699941.1| exodeoxyribonuclease VII large subunit [Brucella suis 1330]
 gi|31563165|sp|Q8FVR1|EX7L_BRUSU RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|23464131|gb|AAN33946.1| exodeoxyribonuclease VII, large subunit [Brucella suis 1330]
          Length = 511

 Score =  432 bits (1111), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 211/488 (43%), Positives = 310/488 (63%), Gaps = 8/488 (1%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           EYSVSE+S  LK  VE    HV VRGEISGYRG HSSGHAYF+LKD+ +R++A+IW+G++
Sbjct: 16  EYSVSEISGALKRTVEDTFGHVRVRGEISGYRGPHSSGHAYFALKDDRARLEAVIWRGSM 75

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
           +++ F PEEG+E +  GK+TT+PGSSKYQI+IE + P+G+G L+  LE+RK++L  EGLF
Sbjct: 76  SRLRFRPEEGMEVIATGKLTTYPGSSKYQIVIEQMEPAGAGALMALLEERKQRLAAEGLF 135

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
               K  +PF+P++I V+TSPTGAVIRDI+ RIS R+PLRVI++PV+VQGD C  E+A A
Sbjct: 136 DPALKQLLPFMPRVIGVVTSPTGAVIRDIIHRISDRYPLRVIVWPVRVQGDTCGPEVATA 195

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           +   NTL +    PRPD++I+ARGGGS+EDLW FNDE++VRA+A S IP+ISA+GHETDW
Sbjct: 196 VNGFNTLPDDGPIPRPDVLIVARGGGSLEDLWGFNDEIVVRAVAASHIPVISAVGHETDW 255

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D AAD+RAPTPTGAAEMAVPVK  LQ+SL +  ARL++ + R    K     +  +A
Sbjct: 256 TLIDLAADMRAPTPTGAAEMAVPVKADLQASLASQSARLSSAMSRFFDQKRQAHRAAARA 315

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           +P++DQ L+  R R D     L   L +   +K  HF+    ++    L   + +  + +
Sbjct: 316 MPSADQLLALPRRRFDEAASRLTRALFVNTQKKRVHFDGHARQLSPRLLQRRLVELERGV 375

Query: 374 LEKQQHIEQIVKQHL---RYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFI 430
               Q + + ++  L   R  F  +  +++   +LR     R     + +++L  R +  
Sbjct: 376 TMLGQRLPRALEAFLRERRTAFTHRANRLSPEPILR-----RTRLTGSTLEQLDRRRDQA 430

Query: 431 LSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFF 490
           +   I+          R++++ +Y++ L+RG+  + D     + Q   +     + + F 
Sbjct: 431 VRLLIERVKRRSQELDRLMRTLSYESVLERGFAVVFDAQGKPVKQAAAVLPGDALSVRFR 490

Query: 491 DGQANAIV 498
           DG    + 
Sbjct: 491 DGDVGVVA 498


>gi|13475744|ref|NP_107311.1| exodeoxyribonuclease VII large subunit [Mesorhizobium loti
           MAFF303099]
 gi|22095676|sp|Q987V3|EX7L_RHILO RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|14026500|dbj|BAB53097.1| exodeoxyribonuclease VII large subunit [Mesorhizobium loti
           MAFF303099]
          Length = 521

 Score =  431 bits (1107), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 217/536 (40%), Positives = 324/536 (60%), Gaps = 22/536 (4%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M+  + ++  +  EY+VSE+S  LK  VE    +V VRGEISGYRG HSSGHAYF+LKD+
Sbjct: 1   MSEAASESRTNATEYTVSEISGALKRTVEDVFGNVRVRGEISGYRGPHSSGHAYFALKDD 60

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            +R+DA++WKGT+++++F PEEG+E +  GK+TT+PG S YQI+I++L P+G+G L+  L
Sbjct: 61  RARLDAVVWKGTMSRLKFRPEEGMEVIATGKLTTYPGKSNYQIVIDNLEPAGAGALMALL 120

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           E+RK++L  EGLF    K  +PF+P+ I V+TSPTG+VIRDI+ RI  RFPL V+++PV+
Sbjct: 121 EERKRRLQAEGLFDAGRKRRLPFMPRTIGVVTSPTGSVIRDIIHRIKDRFPLHVLVWPVR 180

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQGD    E+ NA+   N L    +  RPD++I+ARGGGS+EDLW FNDE + RA+A S 
Sbjct: 181 VQGDTASAEVTNAVTGFNALAWDGSIQRPDLLIVARGGGSLEDLWGFNDEALARAVAASG 240

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP+ISA+GHETDWTL D  AD+RAPTPTGAAE+AVPVK  L+++L +L ARL   ++R  
Sbjct: 241 IPVISAVGHETDWTLIDLVADVRAPTPTGAAEIAVPVKADLEATLASLGARLKAAVLRNF 300

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           + K     +  +ALP+ DQ L+  R RLD     L   L + + RK         R+   
Sbjct: 301 ERKRQAARAAARALPSPDQLLALPRRRLDEATSRLGRGLSVSVDRKRARLQG--QRLTPA 358

Query: 361 FLIHNIQKNR----QHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYL 416
            L   I + R    + +   Q     IV++  R  F     +++   + R Q        
Sbjct: 359 TLSRRINEARTLTGRDLARAQAAFFAIVRER-RARFARTATRLSPAPIARRQK-----LQ 412

Query: 417 HTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQK 476
              +  L  R + ++S +++     +S   R+L + ++K  L RG+  +++ +   I Q 
Sbjct: 413 ADTLAALARRQDRVISLRLERLRGQLSQAERLLTTLSHKAVLARGFALVKNADGAVIKQA 472

Query: 477 RNLATKTRILINFFDGQANAIVINKAP---PKEQPTKKCQLHNNKREKQGTQGELF 529
            ++ +   + + F DG A+A+  + A    P  +P+ K +       + G QG LF
Sbjct: 473 ADVVSGMALTLEFADGTADAVATSGAARPKPAAKPSTKAK-------EPGNQGSLF 521


>gi|254720127|ref|ZP_05181938.1| exodeoxyribonuclease VII large subunit [Brucella sp. 83/13]
 gi|265985133|ref|ZP_06097868.1| exodeoxyribonuclease 7 large subunit [Brucella sp. 83/13]
 gi|306839035|ref|ZP_07471855.1| exodeoxyribonuclease VII, large subunit [Brucella sp. NF 2653]
 gi|264663725|gb|EEZ33986.1| exodeoxyribonuclease 7 large subunit [Brucella sp. 83/13]
 gi|306405858|gb|EFM62117.1| exodeoxyribonuclease VII, large subunit [Brucella sp. NF 2653]
          Length = 511

 Score =  430 bits (1106), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 209/488 (42%), Positives = 309/488 (63%), Gaps = 8/488 (1%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           EYSVSE+S  LK  VE    HV VRGEISGYRG HSSGHAYF+LKD+ +R++A+IW+G++
Sbjct: 16  EYSVSEISGALKRTVEDTFGHVRVRGEISGYRGPHSSGHAYFALKDDRARLEAVIWRGSM 75

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            ++ F PEEG+E +  GK+TT+PGSSKYQI+IE + P+G+G L+  LE+RK++L  EGLF
Sbjct: 76  GRLRFRPEEGMEVIATGKLTTYPGSSKYQIVIEQMEPAGAGALMALLEERKQRLAAEGLF 135

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
               K  +PF+P++I V+TSPTGAVIRDI+ RIS R+PL VI++PV+VQGD C  E+A A
Sbjct: 136 DPALKQLLPFMPRVIGVVTSPTGAVIRDIIHRISDRYPLGVIVWPVRVQGDTCGPEVATA 195

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           +   N L +  + PRPD++I+ARGGGS+EDLW FNDE++VRA+A S IP+ISA+GHETDW
Sbjct: 196 VNGFNALPDDGSIPRPDVLIVARGGGSLEDLWGFNDEIVVRAVAASHIPVISAVGHETDW 255

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D AAD+RAPTPTGAAEMAVPVK  LQ++L +  ARL++ + R    K     +  +A
Sbjct: 256 TLIDLAADMRAPTPTGAAEMAVPVKADLQAALASQSARLSSAMSRFFDQKRQAHRAAARA 315

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           +P++DQ L+  R R D     L   L +   +K  HF+    ++   FL   + +  + +
Sbjct: 316 MPSADQLLALPRRRFDEAASRLTRALFVNTQKKRVHFDGHARQLSPRFLQRRLVELERGV 375

Query: 374 LEKQQHIEQIVKQHL---RYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFI 430
               Q + + ++  L   R  F  +  +++   +LR     R     + +++L  R +  
Sbjct: 376 TMLGQRLPRALEAFLRERRTAFTHRANRLSPEPILR-----RTRLTGSTLEQLDRRRDQA 430

Query: 431 LSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFF 490
           +   I+          R++ + +Y++ L+RG+  + D     + Q   ++    + + F 
Sbjct: 431 VRLLIERVKRRSQELDRLMSTLSYESVLERGFAVVFDAQGKPVKQAGAVSPGDALSVRFR 490

Query: 491 DGQANAIV 498
           DG    + 
Sbjct: 491 DGDVGVVA 498


>gi|163844893|ref|YP_001622548.1| exodeoxyribonuclease VII large subunit [Brucella suis ATCC 23445]
 gi|189037853|sp|A9WZ60|EX7L_BRUSI RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|163675616|gb|ABY39726.1| exodeoxyribonuclease VII, large subunit [Brucella suis ATCC 23445]
          Length = 511

 Score =  429 bits (1102), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 210/488 (43%), Positives = 310/488 (63%), Gaps = 8/488 (1%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           EYSVSE+S  LK  VE    HV VRGEISGYRG HSSGHAYF+LKD+ +R++A+IW+G++
Sbjct: 16  EYSVSEISGALKRTVEDTFGHVRVRGEISGYRGPHSSGHAYFALKDDRARLEAVIWRGSM 75

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
           +++ F PEEG+E +  GK+TT+PGSSKYQI+IE + P+G+G L+  LE+RK++L  EGLF
Sbjct: 76  SRLRFRPEEGMEVIATGKLTTYPGSSKYQIVIEQMEPAGAGALMALLEERKQRLAAEGLF 135

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
               K  +PF+P++I V+TSPTGAVIRDI+ RIS R+PLRVI++PV+VQGD C  E+A A
Sbjct: 136 DPALKQLLPFMPRVIGVVTSPTGAVIRDIIHRISDRYPLRVIVWPVRVQGDTCGPEVATA 195

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           +   NTL +     RPD++I+ARGGGS+EDLW FNDE++VRA+A S IP+ISA+GHETDW
Sbjct: 196 VNGFNTLPDDGPILRPDVLIVARGGGSLEDLWGFNDEIVVRAVAASHIPVISAVGHETDW 255

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D AAD+RAPTPTGAAEMAVPVK  LQ+SL +  ARL++ + R    K     +  +A
Sbjct: 256 TLIDLAADMRAPTPTGAAEMAVPVKADLQASLASQSARLSSAMSRFFDQKRQAHRAAARA 315

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           +P++DQ L+  R R D     L   L +   +K  HF+    ++    L   + +  + +
Sbjct: 316 MPSADQLLALPRRRFDEAASRLTRALFVNTQKKRVHFDGHARQLSPRLLQRRLVELERGV 375

Query: 374 LEKQQHIEQIVKQHL---RYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFI 430
               Q + + ++  L   R  F  +  +++   +LR     R     + +++L  R +  
Sbjct: 376 TMLGQRLPRALEAFLRERRTAFTHRANRLSPEPILR-----RTRLTGSTLEQLDRRRDQA 430

Query: 431 LSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFF 490
           +   I+          R++++ +Y++ L+RG+  + D     + Q   ++    + + F 
Sbjct: 431 VRLLIERVKRRSQELDRLMRTLSYESVLERGFAVVFDAQGKPVKQAAAVSPGDALSVRFR 490

Query: 491 DGQANAIV 498
           DG    + 
Sbjct: 491 DGDVGVVA 498


>gi|306845981|ref|ZP_07478548.1| exodeoxyribonuclease VII, large subunit [Brucella sp. BO1]
 gi|306273616|gb|EFM55461.1| exodeoxyribonuclease VII, large subunit [Brucella sp. BO1]
          Length = 511

 Score =  426 bits (1094), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 208/488 (42%), Positives = 308/488 (63%), Gaps = 8/488 (1%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           EYSVSE+S  LK  VE    HV VRGEIS YRG HSSGHAYF+LKD+ +R++A+IW+G++
Sbjct: 16  EYSVSEISGALKRTVEDTFGHVRVRGEISDYRGPHSSGHAYFALKDDRARLEAVIWRGSM 75

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            ++ F PEEG+E +  GK+TT+PGSSKYQI+IE + P+G+G L+  LE+RK++L  EGLF
Sbjct: 76  GRLRFRPEEGMEVIATGKLTTYPGSSKYQIVIEQMEPAGAGALMALLEERKQRLAAEGLF 135

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
               K  +PF+P++I V+TSPTGAVIRDI+ RIS R+PLRVI++PV+VQGD C  E+A A
Sbjct: 136 DPALKQLLPFMPRVIGVVTSPTGAVIRDIIHRISDRYPLRVIVWPVRVQGDTCGPEVAMA 195

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           +   N L +    PRPD++I+ARGGGS+EDLW FNDE++VRA+A S IP+ISA+GHETDW
Sbjct: 196 VNGFNALPDHGPIPRPDVLIVARGGGSLEDLWGFNDEIVVRAVAASHIPVISAVGHETDW 255

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D AAD+RAPTPTGAAEMAVPVK  LQ++L +  ARL++ + R    K     +  +A
Sbjct: 256 TLIDLAADMRAPTPTGAAEMAVPVKADLQAALASQSARLSSAMSRFFDQKRQAHRAAARA 315

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           +P++DQ L+  R R D     L   L +   +K  HF+    ++    L   + +  + +
Sbjct: 316 MPSADQLLALPRRRFDEAASRLTRALFVNTQKKRVHFDGHARQLSPRLLQRRLVELERGV 375

Query: 374 LEKQQHIEQIVKQHL---RYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFI 430
               Q + + ++  L   R  F  +  +++   +LR     R     + +++L  R +  
Sbjct: 376 TMLGQRLPRALEAFLRERRTAFTHRANRLSPEPILR-----RTRLTGSTLEQLDRRRDQA 430

Query: 431 LSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFF 490
           +   I+          R++++ +Y++ L+RG+  + D     + Q   ++    + + F 
Sbjct: 431 VRLLIERVKRRSQELDRLMRTLSYESVLERGFAVVFDAQGKPVKQAAAVSPGDALSVRFR 490

Query: 491 DGQANAIV 498
           DG    + 
Sbjct: 491 DGDVGVVA 498


>gi|49475937|ref|YP_033978.1| exodeoxyribonuclease VII large subunit [Bartonella henselae str.
           Houston-1]
 gi|81827691|sp|Q6G2I3|EX7L_BARHE RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|49238745|emb|CAF28004.1| Exodeoxyribonuclease large subunit [Bartonella henselae str.
           Houston-1]
          Length = 475

 Score =  421 bits (1083), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 218/498 (43%), Positives = 306/498 (61%), Gaps = 50/498 (10%)

Query: 1   MNPFSQK-NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKD 59
           MN F +K  + +  E+SVSE++  LK +VE    +V VRGEISGYRG H+SGHAYF+LKD
Sbjct: 1   MNLFFEKTGATNVAEFSVSEIAGALKRVVEEKFGYVRVRGEISGYRGAHASGHAYFALKD 60

Query: 60  NHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTA 119
           + +R++A+IW+G + K++F PEEG+E + +GK+TT+PGSSKYQI+IE+L P+G G L+T 
Sbjct: 61  DKARLEAVIWRGIMEKLKFPPEEGMEVIAVGKLTTYPGSSKYQIVIEALEPTGVGALMTL 120

Query: 120 LEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPV 179
           LE RKKK  EEGLF ++ K P+P++PKII V+TSPTGAVIRDI+ RIS RFPL ++++PV
Sbjct: 121 LENRKKKFAEEGLFDEEKKKPLPYMPKIIGVVTSPTGAVIRDIIHRISDRFPLHILVWPV 180

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
           +VQG+   +E+A A+   N L      P+PD++I+ARGGGS+EDLW FNDE++VRA+  S
Sbjct: 181 RVQGETSGREVAAAVKGFNVLPLEGLIPKPDLLIVARGGGSLEDLWGFNDEVVVRAVYES 240

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
           S+P+ISA+GHETDWTL DY AD RAPTPT AAE AVPVK  L+  +++L ARL   + R 
Sbjct: 241 SLPVISAVGHETDWTLIDYVADWRAPTPTAAAEKAVPVKIDLEVYVVSLGARLRTGLARY 300

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
             +    L ++++ALP +DQ  +  R   D +   LE  L +   +K  +F+ +  R   
Sbjct: 301 FDFHQQKLRAIIRALPTADQLFALPRRGFDEISSRLERALCVSCDKKRLYFHTLAIRFTP 360

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH 419
             L            EK QH                KE  A LH        R F     
Sbjct: 361 RLL----------NTEKAQH--------------SAKEYTARLH--------RAFV---- 384

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
                        H ++     + I  R+L+S +Y+N L+RG+      NN  I +   +
Sbjct: 385 -------------HIVEKQRAQLEIAFRLLKSTSYQNILERGFVLALGQNNKPIKRLAQI 431

Query: 480 ATKTRILINFFDGQANAI 497
             K +I + FFDG+ + I
Sbjct: 432 PEKEQINLRFFDGEISVI 449


>gi|110632544|ref|YP_672752.1| exodeoxyribonuclease VII large subunit [Mesorhizobium sp. BNC1]
 gi|123354046|sp|Q11LY8|EX7L_MESSB RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|110283528|gb|ABG61587.1| Exodeoxyribonuclease VII large subunit [Chelativorans sp. BNC1]
          Length = 519

 Score =  420 bits (1079), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 227/523 (43%), Positives = 321/523 (61%), Gaps = 14/523 (2%)

Query: 1   MNPFSQKNSLDH-PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKD 59
           M    + +SL +  EYSVSE+S+ LK  +E    HV VRGEISG+RG HSSGH YFSLKD
Sbjct: 1   MEEAKKDDSLSNVAEYSVSEISHALKRTIEDTFGHVRVRGEISGFRGAHSSGHCYFSLKD 60

Query: 60  NHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTA 119
             +R++A+IWK T  ++ F P+EG+E +  G++TTFPGSSKYQI+IESL P+G+G L+  
Sbjct: 61  ERARMEAVIWKTTFARLRFPPQEGLEVIATGRLTTFPGSSKYQIVIESLEPAGAGALMAL 120

Query: 120 LEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPV 179
           LE+RK+KL  EGLF++  K P+PF+P +I V+TSPTGAVIRDI+ RI+ RFP+ V+++PV
Sbjct: 121 LEERKRKLAAEGLFAESRKRPLPFMPHVIGVVTSPTGAVIRDIIHRITDRFPVHVVVWPV 180

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
           +VQG+    E+A AI   N L+ G T PRPDI+I+ARGGGS+EDLW FNDE +VRA A S
Sbjct: 181 RVQGETTGAEVAAAISGFNALQPGGTIPRPDILIVARGGGSLEDLWGFNDEAVVRAAAAS 240

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
           +IP+ISA+GHETDWTL D AAD RAPTPTGAAE+AVPVK  L++++  L ARL   I R 
Sbjct: 241 AIPLISAVGHETDWTLIDLAADRRAPTPTGAAEVAVPVKAELEANIARLSARLKGAISRC 300

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
           +  +     SL +ALP+ DQ  +  R R D     L   L+     K  H N +   I +
Sbjct: 301 LDRRRQETRSLARALPSPDQLFALPRRRFDEAAGRLGRALQTSTQGKRLHLNAVRVSIAT 360

Query: 360 -DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHT 418
            D  I   +++     E+   + Q + +H R  F     +++    L      RI  L  
Sbjct: 361 LDRRIAQARRDANQCGERLPLVYQGLVRHRRARFDRDAARVSPRVTL-----QRITTLGE 415

Query: 419 HIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRN 478
            +K  I R +  +S +++   T      R+ +S +YK+ L+RG+  ++D  +  + +  +
Sbjct: 416 RLKIAIARKDRAVSLRVERARTVYEQAVRLAESLSYKSVLERGFALVRDGEDRPLKRASD 475

Query: 479 LATKTRILINFFDGQANAIVIN-------KAPPKEQPTKKCQL 514
           +     + + F DG   AI          K+ P  +P K+  L
Sbjct: 476 VKPGETLRLQFADGNIGAISTGKSSNTNRKSAPAREPGKQGSL 518


>gi|260462651|ref|ZP_05810857.1| exodeoxyribonuclease VII, large subunit [Mesorhizobium
           opportunistum WSM2075]
 gi|259031557|gb|EEW32827.1| exodeoxyribonuclease VII, large subunit [Mesorhizobium
           opportunistum WSM2075]
          Length = 548

 Score =  419 bits (1076), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 219/553 (39%), Positives = 330/553 (59%), Gaps = 29/553 (5%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M+  + ++  +  EY+VSE+S  LK  VE    +V VRGEISGYRG HSSGHAYF+LKD+
Sbjct: 1   MSDAASESRTNATEYTVSEISGALKRTVEDVFGNVRVRGEISGYRGPHSSGHAYFALKDD 60

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            +R+DA++WKGT+++++F PEEG+E +  GK+TT+PG S YQI+I++L P+G+G L+  L
Sbjct: 61  RARLDAVVWKGTMSRLKFRPEEGMEVIATGKLTTYPGKSNYQIVIDNLEPAGAGALMALL 120

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           E+RK++L  EGLF    K  +PF+P++I V+TSPTG+VIRDI+ RI  RFPL V+++PV+
Sbjct: 121 EERKRRLQGEGLFDAGRKRRLPFMPRVIGVVTSPTGSVIRDIIHRIKDRFPLHVLVWPVR 180

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQG+    E+ NA+   N L       RPD++I+ARGGGS+EDLW FNDE + RA+A S 
Sbjct: 181 VQGETSGVEVTNAVAGFNALAWDGAIQRPDLLIVARGGGSLEDLWGFNDEALARAVAASG 240

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP+ISA+GHETDWTL D  AD+RAPTPTGAAE+AVPVK  L+++L +L ARL   ++R  
Sbjct: 241 IPVISAVGHETDWTLIDLVADVRAPTPTGAAEIAVPVKADLEATLASLGARLKAAVLRNF 300

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           + K     +  +ALP+ DQ L+  R RLD     L   L +   RK     ++  ++   
Sbjct: 301 ERKRQAARAAARALPSPDQLLALPRRRLDEATSRLGRGLMVSTERK--RARYVAVKLTPT 358

Query: 361 FLIHNIQK----NRQHILEKQ---------------QHIEQIVKQHLRYIFLEKKEKIAI 401
            L   I +    N +++L  Q               +  +Q+ K   R      ++++A+
Sbjct: 359 MLSQRIAEARRTNERNLLRAQGALRALARARRAELNRAADQLPK-CARASLQRHRQQLAL 417

Query: 402 LH--MLREQTKNRIFYLHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLK 459
           L   +  E T  R       +  L  R    +  +++     V    R+L + ++K  L 
Sbjct: 418 LQGRITIEPTARRQRVQRDLLTALTRRGGQAMLIRLERLRGRVVQADRLLATLSHKAVLA 477

Query: 460 RGYTSIQDTNNNFITQKRNLATKTRILINFFDGQANAIVINKAP---PKEQPTKKCQLHN 516
           RG+  ++D +   I Q  ++A+   + + F DG A+A+  + A    P  +P+ K  +  
Sbjct: 478 RGFALVKDADGAVIKQAADVASGMALSLEFADGIADAVATSGAARPKPAAKPSAKTPVAK 537

Query: 517 NKREKQGTQGELF 529
            +  + G QG LF
Sbjct: 538 TR--EPGNQGSLF 548


>gi|304393145|ref|ZP_07375073.1| exodeoxyribonuclease VII, large subunit [Ahrensia sp. R2A130]
 gi|303294152|gb|EFL88524.1| exodeoxyribonuclease VII, large subunit [Ahrensia sp. R2A130]
          Length = 558

 Score =  419 bits (1076), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 217/514 (42%), Positives = 300/514 (58%), Gaps = 23/514 (4%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           E SVSELS  LK  VE    HV VRGEISGYRG HSSGH+YF+LKD+ +RIDAIIWKG  
Sbjct: 15  EVSVSELSGKLKRTVEDQFGHVRVRGEISGYRGPHSSGHSYFALKDDRARIDAIIWKGQN 74

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            K+   PEEG+E +  GK+TT+PG S YQI+I+ + P+G+G L+  LE+RKK L  EGLF
Sbjct: 75  AKLAHKPEEGLEVIASGKLTTYPGRSSYQIVIDHIEPAGAGALMALLEQRKKALASEGLF 134

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
           +D+ K  IPF+P++I V+TSPTGAVIRDIL R+  R+P+ VI++PV+VQG+   +E+AN 
Sbjct: 135 ADERKQLIPFMPRVIGVVTSPTGAVIRDILHRLMDRYPVHVIVWPVRVQGETSGREVANG 194

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           + QLN   +G   P+PD+II+ARGGGS+EDLW FNDE +VR++A S IP+ISA+GHETDW
Sbjct: 195 VYQLNRFGDGTDWPKPDLIIVARGGGSLEDLWGFNDEALVRSVAASDIPVISAVGHETDW 254

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL DYAADLR PTPT AAE AVP+K  L++ L NL ARL   + R+ + +  +L +  + 
Sbjct: 255 TLVDYAADLRMPTPTAAAEKAVPIKADLEAHLANLSARLRAAVSRVAETRRTSLRATSRG 314

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFL----------- 362
           LP+ D  L+  R   D     L  NL   + R    +      ++   L           
Sbjct: 315 LPSLDNLLALPRRAFDEAAAGLGRNLVQRVERASFSYERAAGGLRPLLLEKRLAASGELL 374

Query: 363 ---IHNIQKN-RQHILEKQQHIEQIVKQHL-----RYIFLEKKEKIAILHMLR-EQTKNR 412
              I N Q+  R     K+Q  +    +       R I + ++      + LR E    R
Sbjct: 375 ARQIENHQRALRNATRSKRQRFDDRAGRLSPDVLNRPISMAQRNLSQAANKLRPEPLVQR 434

Query: 413 IFYLHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNF 472
           +        K   R++ + +  +           R+ +S +YK+ ++RGY  ++D     
Sbjct: 435 VSAGRDASNKAFARVDRLTTASLAQAKERFERAERMRESLSYKSVIQRGYAVLRDDAGAL 494

Query: 473 ITQKRNLATKTRILINFFDGQ--ANAIVINKAPP 504
           +    N+A    I +   DG   AN    N APP
Sbjct: 495 VDNASNVAVGDNIHVEMRDGSFGANVTDTNAAPP 528


>gi|92118640|ref|YP_578369.1| exodeoxyribonuclease VII large subunit [Nitrobacter hamburgensis
           X14]
 gi|91801534|gb|ABE63909.1| Exodeoxyribonuclease VII large subunit [Nitrobacter hamburgensis
           X14]
          Length = 541

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 215/529 (40%), Positives = 311/529 (58%), Gaps = 12/529 (2%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           PEY+VSELS  LK  VE+   HV VRGEISG+RG H SGH YF+LKD  ++I+A+IWKG 
Sbjct: 13  PEYTVSELSSALKRTVENAYGHVRVRGEISGFRGPHGSGHCYFALKDESAKIEAVIWKGV 72

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
             ++ F P+EG+E +  GK+TT+PGSSKYQI+IE+L P+G G L+  +E+RKKKL  EGL
Sbjct: 73  HGRMRFKPQEGLEVIATGKLTTYPGSSKYQIVIEALEPAGIGALMALMEERKKKLAAEGL 132

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F +  K  +P++P++I V+TSPTGAVIRDIL R+  RFP RV+++PV+VQG+   ++IA 
Sbjct: 133 FDEARKQLLPWLPEVIGVVTSPTGAVIRDILHRLEDRFPRRVLVWPVRVQGEGSAEQIAA 192

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N L EG   PRPD++I+ARGGGS+EDLW FN+E++VRA A+S IP+ISA+GHETD
Sbjct: 193 AIDGFNALPEGGHVPRPDLLIVARGGGSLEDLWSFNEEIVVRAAASSMIPLISAVGHETD 252

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            TL D+AAD RAPTPT AAEMAVPV+  L   +    AR      R    +   L S  +
Sbjct: 253 VTLIDFAADKRAPTPTAAAEMAVPVRTELFVEVSGFAARAIVAWRRGHDDRRTELRSAAR 312

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
           ALP + + L+  R +LD +   L   L       +R F  I   +    L   +   +Q 
Sbjct: 313 ALPGAGELLAIPRQKLDGVAAALPRVLRASTHLHHRRFTEISRGLTLRVLRAQVAHAKQS 372

Query: 373 IL---EKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQT-KNRIFYLHTHIKKLITRIE 428
           +     +  H  Q+V +H R  F+    ++    +   Q  ++RI   +   ++L  R  
Sbjct: 373 VAATGARLAHGTQVVLRHRRDRFVGLAIRLKASRLANAQAQRDRIARANERTQRLAERTR 432

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
             L+  ++     ++ + ++L +F+Y+  L RG+  ++D     +     +    R+ + 
Sbjct: 433 RALATLLQRHEARITYSGQLLAAFSYRGVLARGFALVRDDAGQALRSASAVGPGARLTLE 492

Query: 489 FFDGQANAI-------VINKAPPKEQPTKKCQLHNNKR-EKQGTQGELF 529
           F DG+  A          + AP    P  + +  + KR  K   QG LF
Sbjct: 493 FTDGRVAATADDDQSAATSSAPTGSNPRGRPKPASGKRAAKAADQGSLF 541


>gi|49474517|ref|YP_032559.1| exodeoxyribonuclease VII large subunit [Bartonella quintana str.
           Toulouse]
 gi|81827591|sp|Q6FZ30|EX7L_BARQU RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|49240021|emb|CAF26437.1| Exodeoxyribonuclease large subunit [Bartonella quintana str.
           Toulouse]
          Length = 475

 Score =  414 bits (1065), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 212/494 (42%), Positives = 303/494 (61%), Gaps = 50/494 (10%)

Query: 1   MNPFSQKN-SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKD 59
           MN F +K  + +  E+SVSE++  LK +VE    +V VRGEISGYRG H+SGH YFSLKD
Sbjct: 1   MNLFFEKTEATNVAEFSVSEIAGALKRVVEERFGYVRVRGEISGYRGAHASGHVYFSLKD 60

Query: 60  NHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTA 119
           + +R++A+IW+G + K++F PEEG+E + +GK+TT+PGSSKYQI+IE+L P+G G L+T 
Sbjct: 61  DKARLEAVIWRGIMEKLKFPPEEGMEVIAVGKLTTYPGSSKYQIVIEALEPTGVGALMTL 120

Query: 120 LEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPV 179
           LE RKKKL +EGLF +  K P+P++P+II V+TSPTGAVIRDI+ RIS RFPL ++++PV
Sbjct: 121 LENRKKKLADEGLFDEAKKKPLPYMPRIIGVVTSPTGAVIRDIIHRISDRFPLHILVWPV 180

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
           +VQGD   +E+A+A+   N L  G   P+PD+II+ARGGGS+EDLW FNDE +VRA+  S
Sbjct: 181 RVQGDTSGREVADALKGFNALPFGGLVPKPDLIIVARGGGSLEDLWGFNDEAVVRAVYES 240

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
           ++P+ISA+GHETDWTL DY AD RAPTPTGAAE AVPVK  L+  + +L ARL   + R 
Sbjct: 241 ALPVISAVGHETDWTLIDYVADWRAPTPTGAAERAVPVKLDLEVQVASLGARLRMGLARY 300

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
             +    L +L++ LP  DQ  +  R   D +   L+  L +   +K  +F+ +  R+  
Sbjct: 301 FDFHQQKLRALVRGLPTVDQLFALPRRGFDEISSRLQRALCVSCDKKRFYFHGLNLRLSP 360

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH 419
             L  N +K  ++                       KE  A LH  R   +N        
Sbjct: 361 RLL--NTEKELRNT----------------------KEYTARLH--RAFVRN-------- 386

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
                          ++     + + +R+L+S +Y+N L+RG+      +N  I +    
Sbjct: 387 ---------------VEKQRAQLEVASRLLKSTSYQNILERGFVLALGPDNKLIKRLVQF 431

Query: 480 ATKTRILINFFDGQ 493
               +I + FFDG+
Sbjct: 432 PETGQINLRFFDGE 445


>gi|319782228|ref|YP_004141704.1| exodeoxyribonuclease VII large subunit [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317168116|gb|ADV11654.1| exodeoxyribonuclease VII, large subunit [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 543

 Score =  411 bits (1056), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 211/521 (40%), Positives = 316/521 (60%), Gaps = 24/521 (4%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M+  + ++  +  EY+VSE+S  LK  VE    +V VRGEISGYRG HSSGHAYF+LKD+
Sbjct: 1   MSEVASESRTNAAEYTVSEISGALKRTVEDVFGNVRVRGEISGYRGPHSSGHAYFALKDD 60

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            +R+DA++WKGT+++++F PEEG+E +  GK+TT+PG S YQI+I++L P+G+G L+  L
Sbjct: 61  RARLDAVVWKGTMSRLKFRPEEGMEVIATGKLTTYPGKSNYQIVIDNLEPAGAGALMALL 120

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           E+RK++L  EGLF    K  +PF+P++I V+TSPTG+VIRDI+ RI  RFPL V+++PV+
Sbjct: 121 EERKRRLQAEGLFDTGRKRLLPFMPRVIGVVTSPTGSVIRDIIHRIKDRFPLHVLVWPVR 180

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQG+    E+  A+   N L       RPD++I+ARGGGS+EDLW FNDE + RA+A S 
Sbjct: 181 VQGETSGAEVTAAVNGFNALAWDGAIQRPDLLIVARGGGSLEDLWGFNDEALARAVAASG 240

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP+ISA+GHETDWTL D  AD+RAPTPTGAAE+AVPVK  L+++L +L ARL   ++R  
Sbjct: 241 IPVISAVGHETDWTLIDLVADVRAPTPTGAAEIAVPVKADLEATLASLGARLKAAVLRNF 300

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           + K     +  +ALP+ DQ L+  R RLD     L   L +   RK   F  +  ++   
Sbjct: 301 ERKRQAARAAARALPSPDQLLALPRRRLDEATSRLGRGLLVSTERKRARFFAV--KLTPA 358

Query: 361 FLIHNIQK----NRQHILEKQ---------------QHIEQIVKQHLRYIFLEKKEKIAI 401
            L   I +    N +++L  Q               +  +Q+ K   R      K+++A+
Sbjct: 359 MLSQRIAEARRTNERNLLRAQGALRAMARARRAELNRAADQLPK-CARASLQRHKQQLAM 417

Query: 402 LH--MLREQTKNRIFYLHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLK 459
           L   +  E T  R       +  L  R    +  +++     V    R++ S ++K  L 
Sbjct: 418 LQGRITIEPTARRQRVQRDLLTALTRRGTQAVVLRLERLRGRVVQADRLMASLSHKAVLA 477

Query: 460 RGYTSIQDTNNNFITQKRNLATKTRILINFFDGQANAIVIN 500
           RG+  ++D +   + Q  ++A+   + + F DG A+A+ I+
Sbjct: 478 RGFALVRDADGAVVKQAADVASGMALSLEFADGTADAVAIS 518


>gi|319408943|emb|CBI82600.1| exodeoxyribonuclease VII large subunit [Bartonella schoenbuchensis
           R1]
          Length = 471

 Score =  410 bits (1053), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 224/518 (43%), Positives = 309/518 (59%), Gaps = 63/518 (12%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           E+SVSE+S  LK I+E   +++ VRGEISGYRG+H+SGHAYF+LKD+ +R++A+IW+  +
Sbjct: 15  EFSVSEVSSALKRIIEDKFAYIRVRGEISGYRGVHASGHAYFALKDDKARLEAVIWRSLM 74

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            K++F PEEG+E + +GK+TT+PGSSKYQI+I++L P+G G L+T LE RKKKL +EGLF
Sbjct: 75  EKLKFPPEEGMEVIAVGKLTTYPGSSKYQIVIDALEPTGVGALMTLLENRKKKLADEGLF 134

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
            +  K P+P++P+II V+TSPTGAVI DI+ RIS RFPL ++++PV+VQG+   +E+A A
Sbjct: 135 DEAKKRPLPYMPQIIGVVTSPTGAVIHDIIHRISDRFPLHILVWPVRVQGETSGREVACA 194

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N L  G    +PD+II+ARGGGS+EDLW FNDE +VRA+  S+IP+ISA+GHETDW
Sbjct: 195 IEGFNALPLGGVLLKPDLIIVARGGGSLEDLWGFNDEAVVRAVHASTIPVISAVGHETDW 254

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL DYAAD RAPTPTGAAE AVPVK  L+  L +L ARL   + R   +    L ++ + 
Sbjct: 255 TLIDYAADWRAPTPTGAAERAVPVKIDLEVQLASLGARLRAGLTRYFSFHQQKLRAISRG 314

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           L  +DQ L+  R   D +   L+  L I   +K  +F  +  R     L  N +K R ++
Sbjct: 315 LLTADQLLALPRRGFDEISSRLQRALCISYEKKLFYFRALSVRFSPRLL--NSEKARYNV 372

Query: 374 LEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSH 433
             K   I      HLR  FL   EK       R Q +                       
Sbjct: 373 --KGYTI------HLRRAFLRNVEK------QRAQAE----------------------- 395

Query: 434 KIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDGQ 493
                     +  R+L+S +Y+N L+RG+      +N  + +   L    R+ + FFDG+
Sbjct: 396 ----------MAFRLLKSTSYQNILERGFVLALGQDNKPVKRLVQLPKTGRMSLRFFDGE 445

Query: 494 ANAIVINKAPPKEQPTKKCQLHNNKREKQ--GTQGELF 529
            N   +N A              NKR KQ    QG LF
Sbjct: 446 INVSTLNCA------------SKNKRIKQQKDDQGTLF 471


>gi|319406793|emb|CBI80426.1| exodeoxyribonuclease VII large subunit [Bartonella sp. 1-1C]
          Length = 477

 Score =  409 bits (1052), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 219/527 (41%), Positives = 313/527 (59%), Gaps = 55/527 (10%)

Query: 1   MNPFSQKN-SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKD 59
           M+ F +K+ + +  E+SVSE++  LK IVE    +V VRGEISGYRG+H+SGHAYF+LKD
Sbjct: 1   MDLFLEKSVATNVAEFSVSEIAGALKRIVEEKFGYVRVRGEISGYRGVHASGHAYFALKD 60

Query: 60  NHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTA 119
           + +R++A+IW+G + K++F PEEG+E + +GK+TT+ GSSKYQIII+SL P+G G L+T 
Sbjct: 61  DKARLEAVIWRGVVEKLQFPPEEGMEVVAVGKLTTYQGSSKYQIIIDSLEPTGVGALMTL 120

Query: 120 LEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPV 179
           LE RKKK  +EGLF +  K  +P++P++I V+TSPTGAVIRDI+ RIS RFPL ++++PV
Sbjct: 121 LENRKKKFADEGLFDEAKKKKLPYMPRVIGVVTSPTGAVIRDIIHRISDRFPLHILVWPV 180

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
           +VQG+   +E+A AI   N L       +PD+II+ARGGGS+EDLW FNDE +VRA++ S
Sbjct: 181 RVQGETSGQEVAAAIAGFNALPLENAISKPDLIIVARGGGSLEDLWGFNDEAVVRAVSVS 240

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
           +IPIISA+GHETDWTL DY AD RAPTPTGAAE AVPVK  L++ L +L  R      R 
Sbjct: 241 AIPIISAVGHETDWTLIDYVADWRAPTPTGAAEKAVPVKFDLETHLASLSLRFRVGAARY 300

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
             +    L+++++ LP +DQ  +  R   D +   L+  L +   +K  +F  ++ R+  
Sbjct: 301 FSFYKQKLSAVVRGLPTADQLFALPRRSFDEISSRLQRALCVNYDKKRFYFYTLVIRLSP 360

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILH--MLREQTKNRIFYLH 417
             L  N +K +Q+                       KE    LH   LR   K R     
Sbjct: 361 RLL--NTKKAQQNT----------------------KEYTVRLHHAFLRNVEKKR----- 391

Query: 418 THIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKR 477
                                 T + +T R+L+S +Y++ L+RG+    +  N  I +  
Sbjct: 392 ----------------------TQIKMTFRLLKSTSYQSILERGFVLALEQENKPIKRLA 429

Query: 478 NLATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGT 524
                 +I + FFDG+ N    N    K  P  K +L   + + QGT
Sbjct: 430 QFPKTGQISLRFFDGKINVSTCNSV-SKNVPKPKKRLKQWQDDDQGT 475


>gi|319898458|ref|YP_004158551.1| exodeoxyribonuclease VII large subunit [Bartonella clarridgeiae 73]
 gi|319402422|emb|CBI75963.1| exodeoxyribonuclease VII large subunit [Bartonella clarridgeiae 73]
          Length = 475

 Score =  409 bits (1051), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 221/527 (41%), Positives = 313/527 (59%), Gaps = 57/527 (10%)

Query: 1   MNPFSQKNSLDH-PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKD 59
           M+ F +K+ + +  E+SVSE++  LK +VE    +V VRGEISGYRG+H+SGHAYF+LKD
Sbjct: 1   MDLFIEKSVVTNVAEFSVSEIAGALKRVVEEKFGYVRVRGEISGYRGVHASGHAYFALKD 60

Query: 60  NHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTA 119
           + +R++A+IW+G + K++F PEEGIE + +GK+TT+ GSSKYQIIIE+L P+G G L+T 
Sbjct: 61  DKARLEAVIWRGVIEKLQFPPEEGIEVVAVGKLTTYQGSSKYQIIIETLEPTGVGALMTL 120

Query: 120 LEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPV 179
           LE RKKKL +EG F D  K  +P++P+II VITSPTGAVIRDI+ RIS RFPL ++++PV
Sbjct: 121 LENRKKKLADEGFFDDAKKKTLPYMPRIIGVITSPTGAVIRDIIHRISDRFPLHILVWPV 180

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
           +VQG+   +E+A AI   N L       +PD+II+ARGGGS+EDLW FNDE +V A++ S
Sbjct: 181 RVQGETSGREVAAAITGFNALPLDGVLSKPDLIIVARGGGSLEDLWGFNDEAVVHAVSAS 240

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
           +IPIISA+GHETDWTL DY AD RAPTPTGAAE AVPVK  L++ L +L  R    + R 
Sbjct: 241 AIPIISAVGHETDWTLIDYVADWRAPTPTGAAERAVPVKFDLETRLASLSLRFRVGLARY 300

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
             +    L+S+++ LP  DQ  +  R   D +   L+  L +   +K  +F  ++ R+  
Sbjct: 301 FSFYKQKLSSVVRGLPTVDQLFALPRRSFDEISSRLQRALCVNYDKKRFYFYTLVIRLCP 360

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILH--MLREQTKNRIFYLH 417
             L  NI+  +Q+                       KE    LH   LR   K R+    
Sbjct: 361 RLL--NIETAQQN----------------------TKEYTVRLHHAFLRSVEKQRV---- 392

Query: 418 THIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKR 477
                                   + +  R+L++ +Y++ L+RG+       N  I +  
Sbjct: 393 -----------------------QIEMAFRLLKNTSYQSILERGFVLALGQENKPIKRLV 429

Query: 478 NLATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGT 524
                 +I + FFDG+ N    N A PK+ P  K +    +R+ QGT
Sbjct: 430 QFPRAVKISLRFFDGEINVSTCNSA-PKQFP--KPRRLKQQRDDQGT 473


>gi|298293951|ref|YP_003695890.1| exodeoxyribonuclease VII large subunit [Starkeya novella DSM 506]
 gi|296930462|gb|ADH91271.1| exodeoxyribonuclease VII, large subunit [Starkeya novella DSM 506]
          Length = 514

 Score =  408 bits (1048), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 210/495 (42%), Positives = 301/495 (60%), Gaps = 28/495 (5%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           P+++VSELS  LK  VE    HV VRGEISGYRG HSSGHAYFSLKD ++R+DA++WKG 
Sbjct: 14  PDWTVSELSGALKRTVEDAFGHVRVRGEISGYRGPHSSGHAYFSLKDQNARLDAVVWKGV 73

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
             +++  PEEG+E + IG+ITTFPG S YQI+I+ L  +G+G ++  LE+RK++L  EGL
Sbjct: 74  FGRLKVRPEEGLEVVAIGRITTFPGKSSYQIVIDQLEFAGAGAIMAMLEERKRRLAAEGL 133

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F+ + K   PF+P +I V+TSPTGAVIRDIL R+S RFP  V+++PV+VQGD C  E+  
Sbjct: 134 FAGERKRRPPFLPVVIGVVTSPTGAVIRDILHRLSDRFPRHVLVWPVRVQGDTCGAEVTA 193

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N L  G   PRPD++I+ARGGGS+EDL  F++E +VRA A S+IP+ISA+GHETD
Sbjct: 194 AIRGFNALTPGGPIPRPDVLIVARGGGSLEDLLGFSEESVVRAAAESAIPLISAVGHETD 253

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            TL D+AAD+RAPTPT AAEMAVPV+  L + +  L ARL     R +  +   L SL +
Sbjct: 254 VTLIDFAADVRAPTPTAAAEMAVPVRADLIAEVAGLHARLRACFARGLDRRATDLRSLSR 313

Query: 313 ALPNSDQTLSCSRYRLD----RLPRELEHNLEIIIFRKYR-HFNHIINRIKSDFLIHNIQ 367
            LP++D  L+  R RLD    RLPR L+ N        +R        R+    L   ++
Sbjct: 314 LLPSADALLALPRQRLDIAGQRLPRALKANAA-----AHRLALTRAEGRLAPQRLAVLVE 368

Query: 368 KNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRI 427
           + R    E+ +     +   LR      +E+I       ++ + R+  +H  +   + R 
Sbjct: 369 RRR----ERFELFAGRLSSALRANANAHRERI-------DRARERVNGVHARLAPCLRRG 417

Query: 428 EFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILI 487
               + K++S         +++Q+ +YK  L RGY  ++D N   +     +A+   + I
Sbjct: 418 HEERARKLRSLE-------QLMQALSYKGVLARGYALVRDANGEPLHAAAEVASGQALEI 470

Query: 488 NFFDGQANAIVINKA 502
            F DG+ +A+   + 
Sbjct: 471 EFRDGRVSAVATGEG 485


>gi|163868905|ref|YP_001610131.1| exodeoxyribonuclease VII large subunit [Bartonella tribocorum CIP
           105476]
 gi|189037855|sp|A9IXA1|EX7L_BART1 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|161018578|emb|CAK02136.1| exodeoxyribonuclease VII large subunit [Bartonella tribocorum CIP
           105476]
          Length = 476

 Score =  407 bits (1047), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 217/530 (40%), Positives = 308/530 (58%), Gaps = 56/530 (10%)

Query: 1   MNPFSQKNS-LDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKD 59
           +N  S+K S  +  E++VSE++  LK +VE    +V VRGEISGYRG H+SGHAYF+LKD
Sbjct: 2   VNLLSEKTSGTNVAEFTVSEIAGALKRVVEEKFGYVRVRGEISGYRGAHASGHAYFALKD 61

Query: 60  NHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTA 119
           + +R++A+IW+G + K++F PEEG+E + +GK+TT+PGSSKYQI+IE+L P+G G L+T 
Sbjct: 62  DKARLEAVIWRGVMEKLKFPPEEGMEVVAVGKLTTYPGSSKYQIVIEALEPTGVGALMTL 121

Query: 120 LEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPV 179
           LE RKKK  EEGLF +  K P+P++P+II V+TSPTGAVIRDI+ RIS RFPL V+++PV
Sbjct: 122 LENRKKKFAEEGLFDEAKKKPLPYMPRIIGVVTSPTGAVIRDIIHRISDRFPLHVLVWPV 181

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
           +VQG+    E+A A+   N L      P+PD+II+ARGGGS+EDLW FNDE +VRA+  S
Sbjct: 182 RVQGETSGSEVAAAVEGFNALASEGHIPKPDLIIVARGGGSLEDLWGFNDEAVVRAVYAS 241

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
            +PIISA+GHETDWTL DY AD RAPTPTGAAE AVPVK  L+  + +L ARL   + R 
Sbjct: 242 DLPIISAVGHETDWTLIDYVADWRAPTPTGAAEKAVPVKLDLEVCVASLGARLRKGLARS 301

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
             +    L +  + LP++DQ  S  R   D +   L+  L              ++  K 
Sbjct: 302 FDFHQQKLCAARRGLPSADQLFSLPRRGFDEISSRLQRAL-------------CVSYDKK 348

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH 419
            F  H +                    HLR              +L+ +   R      H
Sbjct: 349 RFSFHAL--------------------HLRL----------SPRLLKSEKAQR------H 372

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
            K+   R+       ++   +++ +  R+L+S +Y+N L+RG+  +   N+  I +    
Sbjct: 373 TKEYTARLYRAFMRSVEKKRSALELACRLLKSTSYQNILERGFVLVLGQNHKPIKRLAQF 432

Query: 480 ATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
               +I + FFDG  +  V  + P     +K    H   +     QG LF
Sbjct: 433 PESGQINLRFFDGDIH--VATQEPFSAARSK----HKKIKSPSDDQGTLF 476


>gi|319405222|emb|CBI78827.1| exodeoxyribonuclease VII large subunit [Bartonella sp. AR 15-3]
          Length = 475

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 224/532 (42%), Positives = 314/532 (59%), Gaps = 60/532 (11%)

Query: 1   MNPFSQKN-SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKD 59
           M+ F +K+ + +  E+SVSE++  L+ IVE    +V VRGEISGYRG+H+SGHAYF+LKD
Sbjct: 1   MDLFLEKSVATNVAEFSVSEIAGALRRIVEEKFGYVRVRGEISGYRGVHASGHAYFALKD 60

Query: 60  NHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTA 119
           + +R++A+IW+G + K++F PEEG+E + +GK+TT+ GSSKYQIII++L P+G G L+T 
Sbjct: 61  DKARLEAVIWRGVIEKLQFPPEEGMEVVAVGKLTTYQGSSKYQIIIDTLEPTGVGALMTL 120

Query: 120 LEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPV 179
           LE RKKK  +EGLF D  K  +P++P+II V+TSPTGAVIRDI+ RIS RFPL ++++PV
Sbjct: 121 LENRKKKFADEGLFDDAKKKKLPYMPRIIGVVTSPTGAVIRDIIHRISDRFPLHILVWPV 180

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
           +VQG+   +E+A AI   N L  G    +PD+II+ARGGGS+EDLW FNDE +VRA++ S
Sbjct: 181 RVQGETSGQEVAAAIAGFNALPLGNVLSKPDLIIVARGGGSLEDLWGFNDEAVVRAVSAS 240

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
           +IPIISA+GHETDWTL DY AD RAPTPTGAAE AVPVK  L++ L +L  R      R 
Sbjct: 241 AIPIISAVGHETDWTLIDYVADWRAPTPTGAAERAVPVKLDLETQLASLNLRFFVGSARY 300

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
             +    L+++++ LP  DQ  +  R   D +   L+  L +   +K   F  ++ R+  
Sbjct: 301 FSFYKQKLSAVVRGLPTVDQLFALPRRNFDEISSRLQRALCVNYDKKRFCFYTLVIRLSP 360

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILH--MLREQTKNRIFYLH 417
             L  N +K +Q+                       KE    LH   LR   K R+    
Sbjct: 361 RLL--NTKKAQQNT----------------------KEYTVRLHHAFLRNVEKQRV---- 392

Query: 418 THIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKR 477
                                   + +  R+L+S +Y++ L+RG+       NN I +  
Sbjct: 393 -----------------------QIEMAFRLLKSTSYQSILERGFVLALGQENNPIKRLV 429

Query: 478 NLATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
                 +I + FFDG+ N    N    K  P  K QL   KR+K   QG LF
Sbjct: 430 QFPRTGQISLRFFDGEVNVSTCNSV-SKNSPNSK-QL---KRQKD-DQGTLF 475


>gi|319403786|emb|CBI77370.1| exodeoxyribonuclease VII large subunit [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 477

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 217/527 (41%), Positives = 309/527 (58%), Gaps = 55/527 (10%)

Query: 1   MNPFSQKN-SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKD 59
           M+ F +K+ + +  E+SVSE++  LK IVE    +V VRGEISGYRG+H+SGHAYF+LKD
Sbjct: 1   MDLFLEKSVATNAAEFSVSEIAGALKRIVEEKFGYVRVRGEISGYRGVHASGHAYFALKD 60

Query: 60  NHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTA 119
           + +R++A+IW+G + K++F PEEG+E + +GK+TT+ GSSKYQIII+SL P+G G L+T 
Sbjct: 61  DKARLEAVIWRGVIEKLQFPPEEGMEVVAVGKLTTYQGSSKYQIIIDSLEPTGVGALMTL 120

Query: 120 LEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPV 179
           LE RKKK  +EGLF +  K  +P++P++I V+TSPTGAVIRDI+ RIS RFPL + ++PV
Sbjct: 121 LENRKKKFADEGLFDEAKKKKLPYMPRVIGVVTSPTGAVIRDIIHRISDRFPLHIFVWPV 180

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
           +VQG+   +E+A AI   N L       +PD+II+ARGGGS+EDLW FNDE +VRA++ S
Sbjct: 181 RVQGETSGQEVAAAIAGFNALPLESAISKPDLIIVARGGGSLEDLWGFNDEAVVRAVSVS 240

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
           +IPIISA+GHETDWTL DY AD RAPTPTGAAE AVPVK  L++ L +L  R      R 
Sbjct: 241 AIPIISAVGHETDWTLIDYVADWRAPTPTGAAEKAVPVKFDLETHLASLSLRFRVGAARY 300

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
             +    L+++++ LP +DQ  +  R   D +   L+  L +   +K  +F  ++ R+  
Sbjct: 301 FSFYKQKLSTVVRGLPTADQLFALPRRSFDEISSRLQRALCVNYDKKRFYFYTLVIRLSP 360

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILH--MLREQTKNRIFYLH 417
             L  N +K +Q+                       KE    LH   LR   K R     
Sbjct: 361 RLL--NTKKAQQNT----------------------KEYTVRLHHAFLRNVEKKR----- 391

Query: 418 THIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKR 477
                                   + +  R+L+S +Y++ L+RG+       N  I +  
Sbjct: 392 ----------------------AQIKMAFRLLKSTSYQSILERGFVLALGQENKPIKRLA 429

Query: 478 NLATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGT 524
                 +I + FFDG+ N    N    K  P  K +L   + + QGT
Sbjct: 430 QFPKTGQISLRFFDGEINVSTCNSV-SKSVPKPKKRLKQWQDDDQGT 475


>gi|85717179|ref|ZP_01048137.1| exodeoxyribonuclease VII large subunit [Nitrobacter sp. Nb-311A]
 gi|85696012|gb|EAQ33912.1| exodeoxyribonuclease VII large subunit [Nitrobacter sp. Nb-311A]
          Length = 541

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 216/535 (40%), Positives = 313/535 (58%), Gaps = 20/535 (3%)

Query: 11  DHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           + PEY+VSELS  LK  VE+   HV VRGEISG+RG H+SGH YF+LKD  ++I+A+IWK
Sbjct: 11  NSPEYTVSELSSALKRTVENAYGHVRVRGEISGFRGPHASGHCYFALKDESAKIEAVIWK 70

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           G   ++ F P+EG+E +  GK+TT+PGSSKYQI+IE++ P+G G L+  +E+RKKKL  E
Sbjct: 71  GVHGRMRFKPQEGLEVIATGKLTTYPGSSKYQIVIEAIEPAGIGALMALMEERKKKLAAE 130

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEI 190
           GLF +  K  +P++P++I V+TSPTGAVIRDIL R+  RFP RV+++PV+VQG+   ++I
Sbjct: 131 GLFDEARKQLLPWLPEVIGVVTSPTGAVIRDILHRLEDRFPRRVLVWPVRVQGEGSAEQI 190

Query: 191 ANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHE 250
           A AI   N   +G   PRPD++I+ARGGGS+EDLW FN+E++VRA A S IP+ISA+GHE
Sbjct: 191 AAAIDGFNARPDGGPVPRPDLLIVARGGGSLEDLWSFNEEIVVRAAAASMIPLISAVGHE 250

Query: 251 TDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSL 310
           TD TL D+AAD RAPTPT AAEMAVPV+  L   + NL AR      R    +   L S 
Sbjct: 251 TDVTLIDFAADQRAPTPTAAAEMAVPVRSDLLVEVSNLAARALVAWKRGHDDRRTELRSS 310

Query: 311 LKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNR 370
            +ALP + + L+  R +LD     L   L       +R F  I + +    L   +   +
Sbjct: 311 ARALPGAFELLAIPRQKLDNAAAALPRALRASTHVHHRRFTQISSGLTLRVLRAQVAHAK 370

Query: 371 QHIL---EKQQHIEQIVKQHLRYIFLE-----KKEKIAILHMLREQTKNRIFYLHTHIKK 422
           Q +     +  H  Q+V +H R  F       K  ++A +   REQ    I       ++
Sbjct: 371 QSVAATGARLTHCTQVVLRHRRDRFAGLAARLKASRLANVQAQREQ----ISRAEERTRR 426

Query: 423 LITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATK 482
           L  R    +   ++     ++ ++++L + +Y+  L RG+  ++D   + +     + + 
Sbjct: 427 LFERAHRAVVTSLQRHEARIAHSSQLLAAVSYRGVLARGFALVRDETGHALRSAAAVGSG 486

Query: 483 TRILINFFDGQANAIV-INKAPPKEQPTKKCQ-------LHNNKREKQGTQGELF 529
           TR+ + F DGQ NA    ++  P    T +             +R K   QG LF
Sbjct: 487 TRLTLEFIDGQVNATSDTDQTAPAASSTTESNPGSPPRPASGKRRAKIADQGSLF 541


>gi|158424009|ref|YP_001525301.1| exodeoxyribonuclease VII large subunit [Azorhizobium caulinodans
           ORS 571]
 gi|172047959|sp|A8I6A9|EX7L_AZOC5 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|158330898|dbj|BAF88383.1| exodeoxyribonuclease VII large subunit [Azorhizobium caulinodans
           ORS 571]
          Length = 537

 Score =  405 bits (1042), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 209/524 (39%), Positives = 305/524 (58%), Gaps = 35/524 (6%)

Query: 3   PFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHS 62
           P ++ N+   PE++VSELS+ L+  VE    HV VRGEISGYRG HSSGHAYFS+KD  +
Sbjct: 10  PETRANA---PEWTVSELSFALRRTVEDAYGHVRVRGEISGYRGPHSSGHAYFSIKDEGA 66

Query: 63  RIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEK 122
           R+DA+IWK    +++  PEEG+E + +GK+TT+PG S YQI+IESL  +G+G ++  LE+
Sbjct: 67  RLDAVIWKSAFARLKLRPEEGLEVVAVGKLTTYPGKSGYQIVIESLEFAGAGAIMAMLEE 126

Query: 123 RKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQ 182
           RK++L  EGLF    K  +PF+PK+I V+TSPTGAVIRDIL R+S RFP +VI++PV+VQ
Sbjct: 127 RKRRLAAEGLFDAARKQELPFLPKVIGVVTSPTGAVIRDILHRLSDRFPRQVIVWPVRVQ 186

Query: 183 GDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIP 242
           G+    E+A AI   N L EG   PRPD++I+ARGGGS+EDL  F+DE +VRA A S IP
Sbjct: 187 GETSAAEVAEAIRGFNALPEGGPIPRPDVLIVARGGGSLEDLLGFSDEAVVRAAAESFIP 246

Query: 243 IISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKY 302
           ++SA+GHETD TL D+AAD+RAPTPT AAEM VPV+  L + +     RL+    RL++ 
Sbjct: 247 LVSAVGHETDVTLIDFAADVRAPTPTAAAEMVVPVRADLLAGIDAYGERLSAAPRRLLER 306

Query: 303 KINTLNSLLKALPNSDQTLSCSRYRLD----RLPRELEHNLEIIIFRKYR-HFNHIINRI 357
           +     +L + LP +D  L+  R RLD    RLPR L  N        +R  F  +  R 
Sbjct: 307 RRADFRALARHLPTADALLAVPRQRLDAAGERLPRALRANAA-----AHRLAFEAVRTR- 360

Query: 358 KSDFLIHNIQKNRQHILEKQQHIEQI---VKQHLRYIFLEKKEKIAILHMLREQTKNRIF 414
                 H+    R  +   Q  +  +   ++  L  +   + E+++   M       R  
Sbjct: 361 ------HSASAFRLRLARAQDRVAALGGRLQWGLTGLVSRRSERLSA--MTARFGSARAA 412

Query: 415 YLHTHI----------KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTS 464
            L  H+            L TR +  + H ++     ++   ++L++ +Y+  L RG+  
Sbjct: 413 SLRAHVLHLSRCRERLSVLSTRAQRAVRHDLRERTNRLAAMEQLLKALSYRGVLARGFAL 472

Query: 465 IQDTNNNFITQKRNLATKTRILINFFDGQANAIVINKAPPKEQP 508
           ++D     +     +    R+ + F DG+     + +  P E P
Sbjct: 473 VRDAQGGAVRAAGAVVPGARLELEFADGRLGVQALGEGAPVEPP 516


>gi|121601929|ref|YP_989310.1| exodeoxyribonuclease VII large subunit [Bartonella bacilliformis
           KC583]
 gi|189037838|sp|A1UTK7|EX7L_BARBK RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|120614106|gb|ABM44707.1| exodeoxyribonuclease VII, large subunit [Bartonella bacilliformis
           KC583]
          Length = 476

 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 210/510 (41%), Positives = 309/510 (60%), Gaps = 52/510 (10%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           E+SVSE++  LK +VE    +V +RGEISGYRG H+SGHAYF+LKD+ +R++A+IW   +
Sbjct: 16  EFSVSEIANALKRVVEDKFGYVRIRGEISGYRGAHASGHAYFALKDDKARLEAVIWLSVM 75

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            K+ F PEEG+E + +GK+TT+PGSSKYQI+IE+L P+G G L+T LE RKKKL EEGLF
Sbjct: 76  KKLSFPPEEGMEVIAVGKLTTYPGSSKYQIVIEALEPTGVGALMTLLENRKKKLAEEGLF 135

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
              +K P+P++PKII V+TSPTGAVIRDI+ RI  RFPL ++++PV+VQG+ C +E+A+A
Sbjct: 136 DAANKKPLPYMPKIIGVVTSPTGAVIRDIIHRIFDRFPLHILVWPVRVQGETCGREVASA 195

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           +   N L  G   P+PD+II+ARGGGS+EDLW FNDE +VRA+  S+IP+ISA+GHETDW
Sbjct: 196 VEGFNALFLGGGIPKPDLIIVARGGGSLEDLWGFNDEAVVRAVYASAIPVISAVGHETDW 255

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL DYAAD RAPTPTGAAE AVPVK  ++  L ++ +R    + R   +    L +L++ 
Sbjct: 256 TLIDYAADWRAPTPTGAAERAVPVKLDIEVHLASINSRFRVGLARYFDFHQQKLRALVRG 315

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           LP  DQ  +  R   D +   L+  L +   +K  +F+ +  R     L  N +K +  I
Sbjct: 316 LPTVDQLFALPRRGFDEISSRLQRALCVSYDKKCFYFHALSLRFSPRLL--NTKKAQYAI 373

Query: 374 LEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSH 433
              Q++  ++ +  LR +  EK+                                     
Sbjct: 374 ---QEYTGRLHRAFLRNV--EKQ------------------------------------- 391

Query: 434 KIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDGQ 493
                   V +  R+L+S +Y+N L+RG+      ++  I +   L    +I + FFDG+
Sbjct: 392 -----RAQVEMACRLLKSTSYQNILERGFVLALGKDHKPIKRLMQLPETGQISLRFFDGE 446

Query: 494 ANAIVINKAPPKEQPTKKCQLHNNKREKQG 523
            +    ++A  +    K+ +   ++++ QG
Sbjct: 447 IDVSTHDRAVNRSLKNKRIK---SQKDDQG 473


>gi|240850521|ref|YP_002971920.1| exodeoxyribonuclease VII large subunit [Bartonella grahamii as4aup]
 gi|240267644|gb|ACS51232.1| exodeoxyribonuclease VII large subunit [Bartonella grahamii as4aup]
          Length = 476

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 213/527 (40%), Positives = 307/527 (58%), Gaps = 56/527 (10%)

Query: 4   FSQKNSLDH-PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHS 62
           FS+K  + +  E++VSE++  LK +VE    +V VRGEISGYRG H+SGHAYF+LKD+ +
Sbjct: 5   FSEKTGVTNVAEFTVSEIAGALKRVVEEKFGYVRVRGEISGYRGTHASGHAYFALKDDKA 64

Query: 63  RIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEK 122
           R++A+IW+G + K++F PEEG+E + +GK+TT+PGSSKYQI+IE+L P+G G L+T LE 
Sbjct: 65  RLEAVIWRGVMEKLKFPPEEGMEVVAVGKLTTYPGSSKYQIVIEALEPTGVGALMTLLEN 124

Query: 123 RKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQ 182
           RKKK +EEGLF +  K P+P++P+II V+TSPTGAVIRDI+ RIS RFPL ++++PV+VQ
Sbjct: 125 RKKKFVEEGLFDEAKKKPLPYMPRIIGVVTSPTGAVIRDIIHRISDRFPLHILVWPVRVQ 184

Query: 183 GDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIP 242
           G+   +E+A A+   N L  G   P+PD+II+ARGGGS+EDLW FNDE +VRA+  S++P
Sbjct: 185 GETSGREVAVAVEGFNALAPGGFIPKPDLIIVARGGGSLEDLWGFNDEAVVRAVYASALP 244

Query: 243 IISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKY 302
           +ISA+GHETDWTL DY AD RAPTPTGAAE AVPVK  L+  + +L ARL   ++R   +
Sbjct: 245 VISAVGHETDWTLIDYVADWRAPTPTGAAEKAVPVKLDLEVCVASLGARLRKGLVRSFDF 304

Query: 303 KINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFL 362
               L +  + LP  DQ  +  R   D +   L+  L              ++  K  F 
Sbjct: 305 HQQKLRAARRGLPTVDQLFALPRRGFDEISNRLQRAL-------------CVSYDKKCFS 351

Query: 363 IHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKK 422
            H ++      L   +  ++             KE  A LH        R F        
Sbjct: 352 FHTLRLRLSLRLLNSEKAQR-----------NTKEYTARLH--------RAFV------- 385

Query: 423 LITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATK 482
                       ++     + +  R+L+S +Y+N L+RG+      +N  I +       
Sbjct: 386 ----------RSVEKQRAQMELAFRLLKSTSYQNILERGFVLALGQDNKPIKRLIQFPDT 435

Query: 483 TRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
            +I + FFDG  +  +      K    K+ +L ++       QG LF
Sbjct: 436 GQISLRFFDGDISVAIQEPVFSKRSKHKQIKLPSDD------QGTLF 476


>gi|114705932|ref|ZP_01438835.1| exodeoxyribonuclease VII large subunit protein [Fulvimarina pelagi
           HTCC2506]
 gi|114538778|gb|EAU41899.1| exodeoxyribonuclease VII large subunit protein [Fulvimarina pelagi
           HTCC2506]
          Length = 532

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 210/535 (39%), Positives = 309/535 (57%), Gaps = 37/535 (6%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           E++VSE+S  LK  VE    HV VRGE+SGYRG HSSGHAYF+LKD+ +RIDA+IW+G+ 
Sbjct: 14  EFTVSEISISLKRTVEDAFGHVRVRGEVSGYRGPHSSGHAYFALKDDKARIDAVIWRGSF 73

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
           + + F P+EG+E +  G++TT+PGSSKYQI+IE + P+G+G L+  L++R++KL  EGLF
Sbjct: 74  SNLAFKPQEGLEIIATGRLTTYPGSSKYQIVIEDIKPAGAGALMALLDERRRKLEAEGLF 133

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
           + + K  +PF+P++I V+TSPTGAVIRDI  RI+ RFP+ V+++PVKVQG+     +A A
Sbjct: 134 APERKKRLPFLPRVIGVVTSPTGAVIRDIRHRITDRFPVHVLVWPVKVQGEGSGDAVARA 193

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N  +     PRPD++I+ARGGGS+EDLW FNDE +VRA A+S IP+ISA+GHETDW
Sbjct: 194 ITGFNAFEPDGPIPRPDVLIVARGGGSLEDLWGFNDEAVVRAAADSDIPLISAVGHETDW 253

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D+ AD RAPTPTGAAE+AVPV+  L + +    AR  N I R + +    +    +A
Sbjct: 254 TLIDHVADRRAPTPTGAAEIAVPVRAELLADVAAFHARQGNAISRRLDHDRRQVVQTARA 313

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           LP+ D  L+  R RLD     L     +++    + F  +  R+    L   I++ R  +
Sbjct: 314 LPSPDMLLALPRRRLDDAASGLGSQFLLVVSESRQTFGGVAARLSLSTLEGAIREKRGSL 373

Query: 374 --------------LEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH 419
                         L +Q+ + Q +  +L+ I L+ + + A L         ++  +   
Sbjct: 374 RHAALEAEQAMAGRLSRQRQLFQRITANLQPIGLKARSEAARL---------KLDTVSER 424

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
             +  TR+      +++        T R+      K  L+RGYT I+   +  IT    L
Sbjct: 425 FDRARTRLTEDRRERLRQ-------TWRVASGLGPKRVLERGYTIIRGEGDVPITDPALL 477

Query: 480 ATKTRILINFF-DGQANAIVINKAPPKEQPTKKCQLHNNKR----EKQGTQGELF 529
              T   + F  + +  A+   +A P    T+       K+    E +  QG LF
Sbjct: 478 PPGTAFAVEFAGNNRIGALASGEAAPGS--TRPAAPRKRKKATPPEAERAQGSLF 530


>gi|170747101|ref|YP_001753361.1| exodeoxyribonuclease VII, large subunit [Methylobacterium
           radiotolerans JCM 2831]
 gi|170653623|gb|ACB22678.1| exodeoxyribonuclease VII, large subunit [Methylobacterium
           radiotolerans JCM 2831]
          Length = 566

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 208/506 (41%), Positives = 294/506 (58%), Gaps = 19/506 (3%)

Query: 3   PFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHS 62
           P S  N+ + PE+SV EL+  LK  +E    HV +RGEISGYRG H SGHAYFSLKD  +
Sbjct: 19  PTSVLNA-NQPEWSVGELAGALKRTLEDAFGHVRLRGEISGYRGQHGSGHAYFSLKDGQA 77

Query: 63  RIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEK 122
           RIDA++WKG   ++   P+EG+E +  G+ITTF G S YQI+IESL P+G G  +  LE+
Sbjct: 78  RIDAVVWKGVFGRLRQRPQEGLEVVATGRITTFAGKSSYQIVIESLEPAGLGAWMALLEE 137

Query: 123 RKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQ 182
           RKK+L  EGLF+  HK PIP++P+++ V+TSPTGAVIRDIL R+  RFP  V+++PV+VQ
Sbjct: 138 RKKQLAAEGLFAPDHKRPIPYLPRVVGVVTSPTGAVIRDILHRLEDRFPRPVLVWPVRVQ 197

Query: 183 GDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIP 242
           GD   +E+A AI   N L  G   PRPD++I+ARGGGSIEDLW FN+E +VRA   S+IP
Sbjct: 198 GDGAAEEVAAAIRGFNALPAGGPIPRPDVLIVARGGGSIEDLWAFNEECVVRAAFASAIP 257

Query: 243 IISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKY 302
           +ISA+GHETD TL DY +D RAPTPTGAAEMAVPV+  L +++ +L AR    + R I  
Sbjct: 258 LISAVGHETDTTLIDYVSDRRAPTPTGAAEMAVPVRADLIATVADLAARGRGAVGRRIDR 317

Query: 303 KINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIK---- 358
             + L +L +ALP++D  L+  R RLD     L   L     R       +++R+     
Sbjct: 318 DRSDLRALGRALPSADALLAAKRQRLDLAEARLAPALAAGASRHRARLQLLLDRMARRSP 377

Query: 359 ------SDFLIHNIQKNRQHILEKQ-QHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKN 411
                 +   +  I     H L    Q   + + Q  R + + ++  +     L+ +  +
Sbjct: 378 DVALANARARLARIDHRPLHALRNDVQRKGEALIQLGRRLVVAREASLERARALQARRTD 437

Query: 412 RIFYLHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNN 471
           R+  L   + +   R        I+     +     +L S +Y+  L RGY  ++D    
Sbjct: 438 RLLALSERLAQAGAR-------GIERRRDRLDGLAGLLGSLSYRAVLDRGYVLVRDAAGL 490

Query: 472 FITQKRNLATKTRILINFFDGQANAI 497
            + +    A   R+ + F DG   A+
Sbjct: 491 PVRRAAAAAAAQRLSLQFADGTVTAV 516


>gi|146342911|ref|YP_001207959.1| exodeoxyribonuclease VII large subunit [Bradyrhizobium sp. ORS278]
 gi|146195717|emb|CAL79744.1| putative exonuclease VII, large subunit OB-fold nucleic acid
           binding domain [Bradyrhizobium sp. ORS278]
          Length = 538

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 213/533 (39%), Positives = 309/533 (57%), Gaps = 21/533 (3%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           PE++VSELS  LK  VE    HV VRGEISG+RG HSSGH YF+LKD  ++I+A+IWKG 
Sbjct: 11  PEFTVSELSSALKRTVEDQFGHVRVRGEISGFRGPHSSGHCYFALKDESAKIEAVIWKGV 70

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
             ++ F P+EG+E +  GK+TT+P SSKYQI+IE+L P+G G L+  +E+RK+KL  EGL
Sbjct: 71  HGRMRFKPQEGLEVIATGKLTTYPNSSKYQIVIEALEPAGIGALMALMEERKRKLGAEGL 130

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F    K  +P++P++I V+TSPTGAVIRDIL R+  RFP RV+++PVKVQGD   +++A 
Sbjct: 131 FDPARKQLLPWLPEVIGVVTSPTGAVIRDILHRLEDRFPRRVLVWPVKVQGDGSAEQVAA 190

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N L E    PRPD++I+ARGGGS+EDLW FN+E++VRA A S IP+ISA+GHETD
Sbjct: 191 AIRGFNDLPEDGPIPRPDVLIVARGGGSLEDLWSFNEEIVVRAAAESMIPLISAVGHETD 250

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            TL D+AAD RAPTPT AAEMAVPV+  L   + +L  R++    R  + + N L +  +
Sbjct: 251 VTLIDFAADKRAPTPTAAAEMAVPVRSELMQEVASLARRVSVCWQRGQESRRNELRAAAR 310

Query: 313 ALPNSDQTLSCSRYRLD----RLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQK 368
           ALP +   L+  R RLD     LPR L+ N  +     +R F     ++    L   I +
Sbjct: 311 ALPGASDLLAIPRQRLDAASSSLPRALKTNTHV----HFRQFAAASAKLTLRVLHGQISQ 366

Query: 369 NRQHILEKQQHIEQIVKQHL-----RYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKL 423
               ++   + +    +  L     R+  L+ + K A      +  +  I       ++L
Sbjct: 367 ADHRLVVSSERLSLSARALLHRRRERFEALDARFK-ASRQAYAQAKRQAIARERDRAERL 425

Query: 424 ITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKT 483
             R    L+  I           ++L + +Y++ L RG+  ++D   + + Q   + +  
Sbjct: 426 ADRASRALATSILRLRARTDHAGQLLSALSYRSVLARGFALVRDEAGHPLHQAAGIESGA 485

Query: 484 RILINFFDGQ------ANAIVINKAPPKEQPTKKCQLHNNKREKQ-GTQGELF 529
            + I F DG+      A + +   AP   +P ++ +    KR      QG LF
Sbjct: 486 ALSIEFADGRVAATAGAGSPLPTSAPAAPKPVRESKPAAAKRTPDPADQGSLF 538


>gi|316932705|ref|YP_004107687.1| exodeoxyribonuclease VII large subunit [Rhodopseudomonas palustris
           DX-1]
 gi|315600419|gb|ADU42954.1| exodeoxyribonuclease VII, large subunit [Rhodopseudomonas palustris
           DX-1]
          Length = 537

 Score =  400 bits (1028), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 211/529 (39%), Positives = 309/529 (58%), Gaps = 19/529 (3%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           E++VSELS  LK  VE    HV VRGEI+G+RG HSSGH YF+LKD  ++I+A+IWKG  
Sbjct: 15  EFTVSELSQALKRTVEDTYGHVRVRGEITGFRGPHSSGHCYFALKDEGAKIEAVIWKGVA 74

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            ++ F P+EG+E +  GK+TT+PGSSKYQI+IE+L P+G G L+  +E+RKKKL  EGLF
Sbjct: 75  GRMRFRPQEGLEVIATGKLTTYPGSSKYQIVIEALEPAGVGALMALMEERKKKLAAEGLF 134

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
            +  K  +P++P++I V+TSPTGAVIRDIL R+  RFP RV+++PV+VQG+   +++A A
Sbjct: 135 DEARKQLLPWLPEVIGVVTSPTGAVIRDILHRLEDRFPRRVLVWPVRVQGEGSAEQVAAA 194

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N L E    PRPD++I+ARGGGS+EDLW FN+E++VRA A+S IP+ISA+GHETD 
Sbjct: 195 IHGFNALPEDGPIPRPDLLIVARGGGSLEDLWSFNEEIVVRAAADSMIPLISAVGHETDV 254

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D+AAD RAPTPT AAEMAVPV+  L   +  L  R+ +   R   ++ N L +  +A
Sbjct: 255 TLIDFAADKRAPTPTAAAEMAVPVRAELFVEVGGLARRMLSSWQRGQDFRRNELRAAARA 314

Query: 314 LPNSDQTLSCSRYRLD----RLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKN 369
           LP +   L+  R RLD     LPR L  N      R       +  ++    + H+   +
Sbjct: 315 LPGASDLLAIPRQRLDTAAASLPRALRANTHAHHRRFAAAAAGMTLKVLRAQVAHS--AH 372

Query: 370 RQHILEKQ-QHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKN-RIFYLHTHIKKLITRI 427
           R  +   Q Q   +   +H R  F     ++    +  +Q +  RI      +++L  R 
Sbjct: 373 RLDVSGTQLQRCARATLRHRRDRFEGLAVRLQASRLANQQAQRMRIAGEQERLQRLAERA 432

Query: 428 EFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILI 487
              L+  ++     +  T ++L + +Y+  L RG+  ++D     +    ++A   R+ +
Sbjct: 433 RRALATLLERRQARLDATGKLLTALSYRGVLARGFALVRDAEGRSVHTAASVAAGARLSV 492

Query: 488 NFFDGQ-------ANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
            F DG+        +    + A P   P K  +    +  K   QG LF
Sbjct: 493 EFADGRLGVTADGGSGSPAHTAKPASVPAKAAK----RLVKPAGQGSLF 537


>gi|154251076|ref|YP_001411900.1| exodeoxyribonuclease VII large subunit [Parvibaculum
           lavamentivorans DS-1]
 gi|171769562|sp|A7HQR0|EX7L_PARL1 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|154155026|gb|ABS62243.1| exodeoxyribonuclease VII, large subunit [Parvibaculum
           lavamentivorans DS-1]
          Length = 477

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 213/504 (42%), Positives = 297/504 (58%), Gaps = 62/504 (12%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           E+SVSE+S+ LK  VE    HV VRGEI+GYRG HSSGH YF LKD+ +R+DA+IWKG  
Sbjct: 16  EFSVSEISFALKKTVEETFGHVRVRGEITGYRGPHSSGHCYFGLKDDKARMDAVIWKGNF 75

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            K+ F PEEG+E +  GK+TT+PGSSKYQI+I+ L P+G G L+  LE+R+KKL  EGLF
Sbjct: 76  GKLRFKPEEGMEVIATGKLTTYPGSSKYQIVIDHLEPAGVGALMALLEERRKKLAAEGLF 135

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
           + + K  +PF+P++I V+TSPTGAVIRDIL R+  RFP  VI++PV+VQG+    E+A A
Sbjct: 136 AAERKRALPFLPEVIGVVTSPTGAVIRDILHRLQDRFPRHVIVWPVRVQGETSAAEVAAA 195

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N +++G   PRPD++I+ARGGGSIEDLW FN+E++VRA A S+IP+ISAIGHETD 
Sbjct: 196 IRGFNAMEKGGKTPRPDLLIIARGGGSIEDLWSFNEEIVVRAAAESAIPLISAIGHETDT 255

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D+A+D RAPTPT AAEMAVPV+  L + + +  +RL     R I+     L  L + 
Sbjct: 256 TLIDFASDRRAPTPTAAAEMAVPVRAELLADVRDKGSRLIRCEARAIESYRTQLGGLARG 315

Query: 314 LPNSDQTLSCSRYRL----DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKN 369
           LP     ++  R R     DRL R L    E+    K    + +  R+ SD  I      
Sbjct: 316 LPKLQDLVALPRQRFDTAADRLGRALIRAAEV----KRARLSRVEGRL-SDRPI------ 364

Query: 370 RQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEF 429
           R  I  +++ + Q++++                                     +TR E 
Sbjct: 365 RLRIANERKGLPQLLQR-------------------------------------LTRAE- 386

Query: 430 ILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINF 489
             + ++     S+  +T++L+S++Y   LKRGY  ++D     I          RI I F
Sbjct: 387 --TRRVADLARSLDGSTKLLESYSYHGVLKRGYAVVRDETGKPIRAGAGQTAGARIEIEF 444

Query: 490 FDGQANAIVI-------NKAPPKE 506
            + + +A+V         KAPPK+
Sbjct: 445 AEDRLDAVVAPGGTVAPRKAPPKK 468


>gi|118590626|ref|ZP_01548027.1| exodeoxyribonuclease VII large subunit [Stappia aggregata IAM
           12614]
 gi|118436602|gb|EAV43242.1| exodeoxyribonuclease VII large subunit [Stappia aggregata IAM
           12614]
          Length = 520

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 210/516 (40%), Positives = 307/516 (59%), Gaps = 12/516 (2%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           E+SVSE+S+ +K  +E    +V VRGE+ G      SGH Y  LKD+ S +  +IW+G+ 
Sbjct: 10  EFSVSEISFSIKRTMEEAFGYVRVRGEL-GRISRPGSGHIYLDLKDDRSVLSGVIWRGSA 68

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
           +K++  PE+G+E +  GKITTFPG SKYQ++I+SL P+G+G L+  LE+RKKKL  EGLF
Sbjct: 69  SKLKIQPEQGLEVIATGKITTFPGQSKYQMVIDSLEPAGAGALMALLEERKKKLAAEGLF 128

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
           +++ K P+P +P++I VITSPTGAVIRDIL RIS RFPL V+++PV+VQG+    E+AN 
Sbjct: 129 AEERKRPLPPLPRVIGVITSPTGAVIRDILHRISDRFPLHVLVWPVRVQGETSGAEVANG 188

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N L+ G   PRPD++I+ARGGGSIEDLW FN+E +VRA ++S IP+ISA+GHETDW
Sbjct: 189 IRGFNALQPGGPIPRPDVLIVARGGGSIEDLWGFNEEAVVRAASDSQIPLISAVGHETDW 248

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D AADLRAPTPTGAAE AVPVK  L + + +   RLN+ ++R +  +   L +   A
Sbjct: 249 TLIDLAADLRAPTPTGAAEFAVPVKAELMAMVDDRSRRLNSGLVRFVTTRRTELRAASAA 308

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYR-HFNHIINRIKSDFLIHNIQKNRQH 372
           LP     L+  R + D L   LE  L I+  R +R H+ +   R+    L     K RQ 
Sbjct: 309 LPAPQDLLALPRQKFDTLASSLERAL-IVSTRTHRTHYQNFAGRLSPLLLSRLTTKARQD 367

Query: 373 IL---EKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEF 429
           ++   E++Q   Q+     R+ F    E +A+  +   +   +       +  L  R+  
Sbjct: 368 LIQASERKQRALQVAVSQKRHSF----EALAV-RLTPSRLAQQTTLGTERLSGLGERLNR 422

Query: 430 ILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINF 489
               ++      +    ++L+S +YK+ L RGY  ++D +   +     +A+   + I  
Sbjct: 423 AYLARLSQEKARLDGLQKLLKSLSYKDVLARGYAVVRDDSGQPVRSAGAVASGAALSIEL 482

Query: 490 FDGQANAIVI-NKAPPKEQPTKKCQLHNNKREKQGT 524
            DG  +A+ + + A PK    KK          QG+
Sbjct: 483 ADGTVDAVALSDSAGPKPAKAKKQPAGKGPATNQGS 518


>gi|75676737|ref|YP_319158.1| exodeoxyribonuclease VII large subunit [Nitrobacter winogradskyi
           Nb-255]
 gi|74421607|gb|ABA05806.1| Exodeoxyribonuclease VII large subunit [Nitrobacter winogradskyi
           Nb-255]
          Length = 541

 Score =  398 bits (1023), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 211/534 (39%), Positives = 310/534 (58%), Gaps = 22/534 (4%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           PEY+VSELS  LK  VE+   HV VRGEISG+RG H+SGH YF+LKD  ++I+A+IWKG 
Sbjct: 13  PEYTVSELSSALKRTVENAYGHVRVRGEISGFRGPHASGHCYFALKDESAKIEAVIWKGV 72

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
             ++ F P+EG+E +  GK+TT+PGSSKYQI+IE++ P+G G L+  +E+RKKKL  +GL
Sbjct: 73  HGRMRFKPQEGLEVIATGKLTTYPGSSKYQIVIEAIEPAGIGALMALMEERKKKLAAQGL 132

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F +  K  +P++P++I V+TSPTGAVIRDIL R+  RFP RV+++PV+VQG+   ++IA 
Sbjct: 133 FDEARKQLLPWLPEVIGVVTSPTGAVIRDILHRLEDRFPRRVLVWPVRVQGEGSAEQIAA 192

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N L +G   PRPD++I+ARGGGS+EDLW FN+E++VRA A S IP+ISA+GHETD
Sbjct: 193 AIDGFNALPDGGPIPRPDLLIVARGGGSLEDLWSFNEEIVVRAAAGSMIPLISAVGHETD 252

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            TL D+AAD RAPTPT AAEMAVPV+  L   + +L AR      R    +   L S  +
Sbjct: 253 VTLIDFAADQRAPTPTAAAEMAVPVRSDLAIEISDLAARALVAWKRGHDDRRTELRSAAR 312

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
           ALP + + L+  R +LD     L   L       +R F  I   +    L   I   +Q 
Sbjct: 313 ALPGAGELLAIPRQKLDNAAAALPRALRASTHLHHRRFTRISGGLTLRVLHAQITHAKQS 372

Query: 373 IL---EKQQHIEQIVKQHLRYIFLE-----KKEKIAILHMLREQ-TKNRIFYLHTHIKKL 423
           +     +  H  Q++ +H R  F       +  ++A +   R++  ++         +  
Sbjct: 373 VAATGARLAHCTQVMLRHRRDRFAGLAVRLRASRVANVQAQRDRIARDNERTRRLAERAR 432

Query: 424 ITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKT 483
              +  +  H+ +  H+      ++L + +Y+  L RG+  ++D     +       +  
Sbjct: 433 RALVTLLRRHEARITHSG-----QLLAALSYRGVLARGFALVRDDAGQAVRSATAAGSGA 487

Query: 484 RILINFFDGQAN-------AIVINKAPPKEQPTKKCQLHNNKR-EKQGTQGELF 529
           R+ + F DG+ N           +  PP+  PT + +  + KR  K   QG LF
Sbjct: 488 RLTLEFADGKVNVTSDTDQTAATSSNPPRSGPTSEPKPVSRKRAAKPAGQGSLF 541


>gi|328545113|ref|YP_004305222.1| exodeoxyribonuclease 7 large subunit [polymorphum gilvum
           SL003B-26A1]
 gi|326414855|gb|ADZ71918.1| Exodeoxyribonuclease 7 large subunit [Polymorphum gilvum
           SL003B-26A1]
          Length = 519

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 209/517 (40%), Positives = 303/517 (58%), Gaps = 8/517 (1%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           EYSVS++S+ +K  +E    +V VRGE+ G      SGH Y  LKD+ S + A+IWKG  
Sbjct: 10  EYSVSDISFSIKRTLEDTFGYVRVRGEL-GRISRPGSGHVYLDLKDDRSVLSAVIWKGAA 68

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            K++  PE+G+E +  GKITTFPG SKYQ++I++L P+G+G L+  LE RK+KL  EGLF
Sbjct: 69  AKLKIQPEQGLEVIATGKITTFPGQSKYQMVIDALEPAGAGALMALLEDRKRKLAAEGLF 128

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
           + + K P+P +P++I V+TSPTGAVIRDIL R+S RFPL V+++PV+VQGD C  E+AN 
Sbjct: 129 AAERKRPLPTLPRVIGVVTSPTGAVIRDILHRLSDRFPLHVLVWPVRVQGDSCGAEVANG 188

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N L+ G   PRPD+II+ARGGGS+EDLW FNDE +VRA A S+IP+ISA+GHETDW
Sbjct: 189 IRGFNALEAGGAIPRPDLIIVARGGGSLEDLWGFNDEQVVRAAAESAIPLISAVGHETDW 248

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D AAD+RAPTPTGAAE+AVPVK  L + + +L  RL + + RL+  +   L +   A
Sbjct: 249 TLIDLAADVRAPTPTGAAEIAVPVKAELMAGVDDLSRRLASGLNRLVASRRTELRAAAAA 308

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           LP     L+  R RLD     LE  L +          H    +    L+  +++ R+ +
Sbjct: 309 LPAPRDLLALPRQRLDFSGGNLERGLTVNTRAHRSRLQHAAALLTPMTLVRAMRQGRERL 368

Query: 374 LEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH-IKKLITRIEFILS 432
                H ++  +     IF  ++   A    L      +   L T  +  L+ R+E    
Sbjct: 369 ---DGHRQRQARAWETTIFRHRQRLEAAAGRLTSGRLEQQLRLGTERLDGLLRRLERAQQ 425

Query: 433 HKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDG 492
            ++      +    ++L++ +YK+ L RGY  ++D     +    +++   R+ +   DG
Sbjct: 426 ARLAEQRARLQGLEKLLKTLSYKDVLARGYALVRDAAGEPVRSAAHVSAGDRLSVEVADG 485

Query: 493 QANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
           +  AI    A P E+  K  +  +N      +QG LF
Sbjct: 486 RFEAIA---ATPAEELRKSRKPKDNPAPGGTSQGSLF 519


>gi|154245360|ref|YP_001416318.1| exodeoxyribonuclease VII large subunit [Xanthobacter autotrophicus
           Py2]
 gi|154159445|gb|ABS66661.1| exodeoxyribonuclease VII, large subunit [Xanthobacter autotrophicus
           Py2]
          Length = 496

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 197/489 (40%), Positives = 283/489 (57%), Gaps = 55/489 (11%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           PE+SVSELS  L+  VE    HV VRGEISGYRG H SGHAYFSLKD  +R+DA+IWKGT
Sbjct: 24  PEWSVSELSAALRRTVEDAYGHVRVRGEISGYRGPHGSGHAYFSLKDAGARLDAVIWKGT 83

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
             ++   PEEG+E + IG++TT+PG S YQI+IE+L  +G+G ++  LE+RK++L  EGL
Sbjct: 84  FQRLRLKPEEGLEVVAIGRLTTYPGKSGYQIVIEALEFAGAGAIMAMLEERKRRLSAEGL 143

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F    K  +PF+P++I V+TSPTGAVIRDIL R+  RFP RV+++PV+VQG+    E+A 
Sbjct: 144 FDPARKVALPFLPQVIGVVTSPTGAVIRDILHRLDDRFPRRVLVWPVRVQGETSAAEVAA 203

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N L  G   PRPD+I++ARGGG++EDL  F+DE +VRA A S+IP+++A+GHETD
Sbjct: 204 AIRGFNALPAGGAIPRPDVIVVARGGGALEDLLGFSDEEVVRAAAESAIPLVAAVGHETD 263

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            TL D+AAD+RAPTPT AAEM VPV+  L +++ +L  RL    +RL++ +   L  L +
Sbjct: 264 VTLIDFAADVRAPTPTAAAEMVVPVRSELIAAVEDLGGRLAAAPVRLLERRRADLRGLSR 323

Query: 313 ALPNSDQTLSCSRYRLD----RLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQK 368
            LP+++  LS  R RLD    RLPR L+ N                              
Sbjct: 324 LLPSAENLLSVPRQRLDAASERLPRALKAN------------------------------ 353

Query: 369 NRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIE 428
                              LR +    +     L +  E+  +R+  L   +K+  +   
Sbjct: 354 --------------AAAHRLRLVAARARLSPEALRLRLERAGDRLETLDGRLKRAFSVAR 399

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
              + +++S         ++L + ++K  L RG+  ++D     +     L   T + + 
Sbjct: 400 EQRAARLRSAG-------QLLDALSFKGVLSRGFALVRDAQGQPVRLAAGLTAGTALDLE 452

Query: 489 FFDGQANAI 497
           F DG   A+
Sbjct: 453 FADGHVAAV 461


>gi|192289762|ref|YP_001990367.1| exodeoxyribonuclease VII large subunit [Rhodopseudomonas palustris
           TIE-1]
 gi|192283511|gb|ACE99891.1| exodeoxyribonuclease VII, large subunit [Rhodopseudomonas palustris
           TIE-1]
          Length = 537

 Score =  392 bits (1006), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 208/528 (39%), Positives = 308/528 (58%), Gaps = 17/528 (3%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           E++VSELS  LK  VE    HV VRGEI+G+RG HSSGH YF+LKD  ++I+A+IWKG  
Sbjct: 15  EFTVSELSQALKRTVEDTYGHVRVRGEITGFRGPHSSGHCYFALKDEGAKIEAVIWKGVA 74

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            ++ F P+EG+E +  GK+TT+PGSSKYQI+IE+L P+G G L+  +E+RKKKL  EGLF
Sbjct: 75  GRMRFKPQEGLEVIATGKLTTYPGSSKYQIVIEALEPAGVGALMALMEERKKKLAAEGLF 134

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
            +  K  +P++P++I V+TSPTGAVIRDIL R+  RFP RV+++PV+VQG+   ++IA A
Sbjct: 135 DEARKQLLPWLPEVIGVVTSPTGAVIRDILHRLEDRFPRRVLVWPVRVQGEGSAEQIAAA 194

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N L E    PRPD++I+ARGGGS+EDLW FN+E++VRA A+S IP+ISA+GHETD 
Sbjct: 195 IHGFNALPEDGPIPRPDLLIVARGGGSLEDLWSFNEEIVVRAAADSMIPLISAVGHETDV 254

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D+A+D RAPTPT AAEMAVPV+  L   +  L  R+ +   R   ++ N L +  +A
Sbjct: 255 TLIDFASDKRAPTPTAAAEMAVPVRAELFVEVGGLARRILSSWQRGQDFRRNELRAAARA 314

Query: 314 LPNSDQTLSCSRYRLD----RLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKN 369
           LP +   L+  R RLD     LPR L  +      R       +  ++    + H+  + 
Sbjct: 315 LPGASDLLAIPRQRLDGASAALPRALRASTNAHHRRFAAAAAGMTLKVLRAQVAHSAHRL 374

Query: 370 RQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKN-RIFYLHTHIKKLITRIE 428
                + Q+     ++ H R  F     ++    +  +Q +  RI      +++L  R  
Sbjct: 375 DSAGTQLQRCARATLR-HRRERFDGLAVRLQASKLANQQAQRMRIAREQERLQRLGERAR 433

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
             L   ++     V  T ++L + +Y+  L RG+  ++D +   +    ++A   R+ + 
Sbjct: 434 RALITLLERRQARVDATGKLLTALSYRGVLARGFALVRDADGRSVHAAASVAAGARLSVE 493

Query: 489 FFDGQ-------ANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
           F DG+        +   +  A P   P K  +   +  +    QG LF
Sbjct: 494 FADGRVAVTADGGSGSPVEAAKPAPTPAKPAKRPTSPAD----QGSLF 537


>gi|39934236|ref|NP_946512.1| exodeoxyribonuclease VII large subunit [Rhodopseudomonas palustris
           CGA009]
 gi|39648084|emb|CAE26604.1| putative exonuclease VII, large subunit OB-fold nucleic acid
           binding domain [Rhodopseudomonas palustris CGA009]
          Length = 537

 Score =  391 bits (1005), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 208/528 (39%), Positives = 307/528 (58%), Gaps = 17/528 (3%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           E++VSELS  LK  VE    HV VRGEI+G+RG HSSGH YF+LKD  ++I+A+IWKG  
Sbjct: 15  EFTVSELSQALKRTVEDTYGHVRVRGEITGFRGPHSSGHCYFALKDEGAKIEAVIWKGVA 74

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            ++ F P+EG+E +  GK+TT+PGSSKYQI+IE+L P+G G L+  +E+RKKKL  EGLF
Sbjct: 75  GRMRFKPQEGLEVIATGKLTTYPGSSKYQIVIEALEPAGVGALMALMEERKKKLAAEGLF 134

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
            +  K  +P++P++I V+TSPTGAVIRDIL R+  RFP RV+++PV+VQG+   ++IA A
Sbjct: 135 DEARKQLLPWLPEVIGVVTSPTGAVIRDILHRLEDRFPRRVLVWPVRVQGEGSAEQIAAA 194

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N L E    PRPD++I+ARGGGS+EDLW FN+E++VRA A+S IP+ISA+GHETD 
Sbjct: 195 IHGFNALPEDGPIPRPDLLIVARGGGSLEDLWSFNEEIVVRAAADSMIPLISAVGHETDV 254

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D+A+D RAPTPT AAEMAVPV+  L   +  L  R+ +   R   ++ N L +  +A
Sbjct: 255 TLIDFASDKRAPTPTAAAEMAVPVRAELFVEVGGLARRILSSWQRGQDFRRNELRAAARA 314

Query: 314 LPNSDQTLSCSRYRLD----RLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKN 369
           LP +   L+  R RLD     LPR L  +      R       +  ++    + H+  + 
Sbjct: 315 LPGASDLLAIPRQRLDGASAALPRALRASTNAHHRRFAAAAAGMTLKVLRAQVAHSAHRL 374

Query: 370 RQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKN-RIFYLHTHIKKLITRIE 428
                + Q+     ++ H R  F     ++    +  +Q +  RI      +++L  R  
Sbjct: 375 DSAGTQLQRCARATLR-HRRERFEGLAVRLQASKLANQQAQRMRIAREQERLQRLAERAR 433

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
             L   ++     V  T ++L + +Y+  L RG+  ++D +   +    ++A   R+ + 
Sbjct: 434 RALITLLERRQARVDATGKLLTALSYRGVLARGFALVRDADGRSVHAAASVAAGARLSVE 493

Query: 489 FFDGQ-------ANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
           F DG+        +   +  A P   P K  +    +      QG LF
Sbjct: 494 FADGRVAVTADGGSGSPVEAAKPTPAPAKPVK----RPPSPAGQGSLF 537


>gi|254502889|ref|ZP_05115040.1| exodeoxyribonuclease VII, large subunit [Labrenzia alexandrii
           DFL-11]
 gi|222438960|gb|EEE45639.1| exodeoxyribonuclease VII, large subunit [Labrenzia alexandrii
           DFL-11]
          Length = 540

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 210/525 (40%), Positives = 305/525 (58%), Gaps = 21/525 (4%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           E+SVSE+S+ +K  +E    +V VRGE+ G      SGH Y  LKD+ + +  +IW+G  
Sbjct: 28  EFSVSEISFSIKRTMEDAFGYVRVRGEL-GRISRPGSGHIYLDLKDDRAVLSGVIWRGVA 86

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
           +K++  PE+G+E +  GKITTFPG SKYQ++I++L P+G+G L+  LE+RKKKL  EGLF
Sbjct: 87  SKLKIQPEQGLEVIATGKITTFPGQSKYQMVIDALEPAGAGALMALLEERKKKLAAEGLF 146

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
           +++ K P+P +P +I V+TSPTGAVIRDIL RIS RFP+ V+++PV+VQG+    E+AN 
Sbjct: 147 AEERKRPLPSLPNVIGVVTSPTGAVIRDILHRISDRFPVHVLVWPVRVQGETSGAEVANG 206

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N  + G T PRPD++I+ARGGGSIEDLW FN+E +VRA A S IP+ISA+GHETDW
Sbjct: 207 IRGFNAFQTGGTIPRPDLVIVARGGGSIEDLWGFNEEAVVRAAAESQIPLISAVGHETDW 266

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D AADLRAPTPTGAAE+AVPVK  L S + +   RL+  + R +  +   L +   A
Sbjct: 267 TLIDLAADLRAPTPTGAAEIAVPVKAELMSMVDDRARRLSTGLQRFVGSRRTELRAASAA 326

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRH-FNHIINRIKSDFLIHNIQKNRQH 372
           LP     L+  R R D     LE  L I+  + +R  + +   R+    L     K RQ 
Sbjct: 327 LPAPRDLLALPRQRFDTAANSLERGL-IVNTKHHRSTYQNASARLSPIVLTRLSTKARQD 385

Query: 373 IL---EKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKK-----LI 424
           +L   ++QQ    +     R  F       AI+  L   T +R+   HT + K     L 
Sbjct: 386 LLVAGDRQQRALSVGIAQKRQAF------DAIVARL---TPSRLSQ-HTALSKERVTGLG 435

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
            R++     ++K     +    ++L+S +YK+ L RGY  ++D +   I     + T   
Sbjct: 436 DRLDRAYLTQLKDSAAKLDGLQKLLKSLSYKDVLARGYAVVRDADGQPIRSTSAVETGAA 495

Query: 485 ILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
           + +   DG  +A+ ++ +   ++P           +    QG LF
Sbjct: 496 LSVELADGTLDAVAMSGSSAPKKPKTTGPKKAASHKPAADQGNLF 540


>gi|323138985|ref|ZP_08074045.1| exodeoxyribonuclease VII, large subunit [Methylocystis sp. ATCC
           49242]
 gi|322395739|gb|EFX98280.1| exodeoxyribonuclease VII, large subunit [Methylocystis sp. ATCC
           49242]
          Length = 522

 Score =  389 bits (998), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 213/519 (41%), Positives = 294/519 (56%), Gaps = 24/519 (4%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           PE SVSEL+  LK  +E     V VRGEIS YRG H+SGHAYFSLKD  +R+DA+IWKGT
Sbjct: 26  PEISVSELANALKRTIEDRFGRVRVRGEISNYRGPHASGHAYFSLKDQSARLDAVIWKGT 85

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
             ++   P+EG+E +  G+ITTFPG S YQI+IE++ P+G G L+  L++R+KKL  EGL
Sbjct: 86  FMRLRTRPQEGLEVVATGRITTFPGKSSYQIVIEAMEPAGVGALMALLDERRKKLAAEGL 145

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F +  K P+PF+P+++ V+TSPTGAVIRDIL R++ RFP RV+++PV+VQG+    E+A 
Sbjct: 146 FDEARKRPLPFLPRVVGVVTSPTGAVIRDILHRLNDRFPRRVLVWPVRVQGETSAVEVAA 205

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N L      PRPD++I+ARGGGS+EDLW FN+E++VR+ A S IP+ISAIGHETD
Sbjct: 206 AINGFNALPADGPVPRPDVLIVARGGGSLEDLWSFNEEIVVRSAAASDIPLISAIGHETD 265

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            TL D+ ADLRAPTPTGAAE AVPV+  L   L     RL     R ++ +   L +L +
Sbjct: 266 TTLIDFVADLRAPTPTGAAEKAVPVRAELAEHLAARARRLAAAKTRAMEQRRTQLATLAR 325

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHI-INRIKSDFLIHNIQKNRQ 371
            LP  +Q L+  R RLDR    L        FR  R    + + R  +    H+ Q    
Sbjct: 326 LLPAPEQLLANPRQRLDRAGERLRG-----AFRAGRDAQRLRLARAANLLARHSPQAELA 380

Query: 372 HILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFIL 431
              E+ + ++  + Q L           A L + R+Q +     L     +L      +L
Sbjct: 381 RARERLKGLDARLAQGL----------AARLTLARQQNQGSAQRLANAGGRLDRAFVTLL 430

Query: 432 SHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFD 491
             K +          R+  S ++K  L RG+  ++D  +  +         T + I F D
Sbjct: 431 RQKKEKLER----LGRLQDSLSHKAVLARGFALVRDEKDALVRGVAQAPPGTALSIEFAD 486

Query: 492 GQANAIVINKAPPKEQPTKKCQLHNNKREKQG-TQGELF 529
           G+ +A   N A     P         + +K G  QG LF
Sbjct: 487 GRIDARAGNAA---TGPAPTVPAPRKRAKKPGDDQGSLF 522


>gi|83309311|ref|YP_419575.1| exonuclease VII large subunit [Magnetospirillum magneticum AMB-1]
 gi|82944152|dbj|BAE49016.1| Exonuclease VII large subunit [Magnetospirillum magneticum AMB-1]
          Length = 688

 Score =  389 bits (998), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 209/519 (40%), Positives = 304/519 (58%), Gaps = 30/519 (5%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           PEYSVSELS  L+  VE   S V VRGEISG++  HSSGH YF+LKD  + +DA+ W+G+
Sbjct: 198 PEYSVSELSGSLRKTVEDAFSFVRVRGEISGFK-RHSSGHLYFALKDADAVLDAVCWRGS 256

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
             K+   PE+G+E +  G++TT+PG SKYQ+++E +  +G G LL  LE RKK+L+ EGL
Sbjct: 257 AGKLAIGPEDGMEVVATGRLTTYPGRSKYQMVVERMELAGQGALLKMLEDRKKRLMAEGL 316

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F    K PIPF+P++I V+TSPTGAVIRDIL R++ RFP RV+++PV VQGD    ++A 
Sbjct: 317 FDTAKKRPIPFLPEVIGVVTSPTGAVIRDILHRLAERFPRRVLLWPVAVQGDGASAQVAA 376

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N LK G   PRPD++I+ARGGGS+EDL  FN+E++VRA A S IP+ISA+GHETD
Sbjct: 377 AIRGFNALKPGGAVPRPDVLIVARGGGSLEDLMAFNEEIVVRAAAESEIPLISAVGHETD 436

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            TL D+A+DLRAPTPT AAE AVPV+  L +++ ++ ARL   + R ++ +   L    +
Sbjct: 437 TTLIDFASDLRAPTPTAAAEKAVPVRAELIATVADMGARLIGAMQRGLEERRTRLGHTFR 496

Query: 313 ALPNSDQTL-SCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQ 371
           ALP+  + +  C+R RLD     L +   +++ R+         R + D L   ++  R+
Sbjct: 497 ALPHPRRVMEDCAR-RLDERAERLTNAPRLLLERR---------RAELDRLAARLRHPRE 546

Query: 372 HILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFIL 431
            + E    +  +  +      L+   K  +    R   + R   L     +LI  +  +L
Sbjct: 547 QLAEAGHKLTALTTR------LDHAMKT-VSAAERAANERRTLQLEQCAGRLIQAMPRLL 599

Query: 432 SHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFD 491
             K K     V+   ++L+SF+Y+  L+RG+  ++D +   +T          + + F D
Sbjct: 600 DEKAK----RVAHAGQLLESFSYRKVLERGFAVVRDEHGTPVTSVAAAKPGAALAVEFAD 655

Query: 492 GQANAIVIN-KAPPKEQPTKKCQLHNNKREKQGTQGELF 529
           G+A   V    APP  +P      H       G QG L 
Sbjct: 656 GKAGVRVEGTAAPPAPKP------HRKPATPDGRQGSLL 688


>gi|170744124|ref|YP_001772779.1| exodeoxyribonuclease VII, large subunit [Methylobacterium sp. 4-46]
 gi|168198398|gb|ACA20345.1| exodeoxyribonuclease VII, large subunit [Methylobacterium sp. 4-46]
          Length = 507

 Score =  388 bits (997), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 202/500 (40%), Positives = 289/500 (57%), Gaps = 30/500 (6%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           E+SV++L+  LK  +E    HV +RGEISGYRG H SGHAYFSLKD  ++IDA+IWKGTL
Sbjct: 22  EWSVTDLAAALKRTLEDAFGHVRLRGEISGYRGPHGSGHAYFSLKDGGAKIDAVIWKGTL 81

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            ++   P+EG+E +  G+ITTFPG S YQI+I+SL P+G+G  +  LE+R++ L  EGLF
Sbjct: 82  ARLRHRPKEGLEVVATGRITTFPGKSAYQIVIDSLEPAGAGAWMALLEERRRLLAAEGLF 141

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
               K P+P++P+++ V+TSPTGAVIRDIL R++ RFP  V+++PV+VQG+   +E+A A
Sbjct: 142 DAARKRPLPYLPRVVGVVTSPTGAVIRDILHRLADRFPRPVLVWPVRVQGEGSAEEVAAA 201

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N L      PRPD++I+ARGGGSIEDLW FN+E++VRA A S+IP+I+A+GHETD 
Sbjct: 202 IRGFNALAPDGPIPRPDVLIVARGGGSIEDLWSFNEEIVVRAAAASAIPLIAAVGHETDV 261

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D+AAD RAPTPTGAAEMAVPV+  L + L  L  R    + RLI+ +   L  L + 
Sbjct: 262 TLIDHAADRRAPTPTGAAEMAVPVRLDLVADLDGLARRHAASLARLIERRRADLRGLARV 321

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           LP  +  L+  R RLD      E  L   +    R     + R+                
Sbjct: 322 LPTPEGLLAVKRQRLD----LAEARLRPALGEAARAAQGRLARLL--------------- 362

Query: 374 LEKQQHIEQIVKQHLRYIFLEK-KEKIA-ILHMLREQTKNRIFYLHTHIKKLITRIEFIL 431
                   Q + +H   + L + + ++A I H  R   +  I      +  +  R+    
Sbjct: 363 --------QALGRHPPALHLARARARLAGIDHRPRHALERLIAVRAERLNGVAQRLAQAE 414

Query: 432 SHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFD 491
           S  ++      +  + +  S  Y+  L+RGY  + D     + +        RI + F D
Sbjct: 415 SRDLERRRARFAAASGLFDSLNYRAVLQRGYALVLDAEGRPVAEAEAARAAGRITVEFQD 474

Query: 492 GQANAIVINKAPPKEQPTKK 511
           G+  A V+  APP+    K+
Sbjct: 475 GKVGA-VVEGAPPRRAAAKR 493


>gi|27382618|ref|NP_774147.1| exodeoxyribonuclease VII large subunit [Bradyrhizobium japonicum
           USDA 110]
 gi|31563103|sp|Q89DD2|EX7L_BRAJA RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|27355790|dbj|BAC52772.1| exodeoxyribonuclease VII large subunit [Bradyrhizobium japonicum
           USDA 110]
          Length = 545

 Score =  388 bits (996), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 214/533 (40%), Positives = 307/533 (57%), Gaps = 14/533 (2%)

Query: 10  LDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIW 69
           L+ PE++VSELS  LK  VE    HV VRGEISG+RG HSSGH YF+LKD  ++I+A+IW
Sbjct: 14  LNAPEFTVSELSQSLKRTVEDAFGHVRVRGEISGFRGAHSSGHCYFALKDESAKIEAVIW 73

Query: 70  KGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLE 129
           KG   ++ F P+EG+E +  GK+TT+PGSSKYQI+IE+L P+G G L+  +E+RKKKL  
Sbjct: 74  KGVHGRMRFKPQEGLEVIATGKLTTYPGSSKYQIVIEALEPAGIGALMALMEERKKKLAA 133

Query: 130 EGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKE 189
           EGLF +  K  +P++P++I V+TSPTGAVIRDIL R+  RFP  V+++PVKVQG+   ++
Sbjct: 134 EGLFDEARKQLLPWLPEVIGVVTSPTGAVIRDILHRLEDRFPRHVLVWPVKVQGEGSAEQ 193

Query: 190 IANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGH 249
           +A AI   N L EG   PRPD++I+ARGGGS+EDLW FN+E++VRA A S IP+ISA+GH
Sbjct: 194 VAAAIRGFNALPEGGKIPRPDVLIVARGGGSLEDLWSFNEEIVVRAAAESMIPLISAVGH 253

Query: 250 ETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNS 309
           ETD TL D+ AD RAPTPT AAEMAVPV+  L   + +L  R      R  + + + L +
Sbjct: 254 ETDITLIDFVADKRAPTPTAAAEMAVPVRSDLFVEVADLARRTRAYWQRAHESRRSELRA 313

Query: 310 LLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKN 369
             +ALP +   L+  R RLD     L   L+      +R F     ++    L   I + 
Sbjct: 314 AARALPAAGDLLAIPRQRLDSAGAALPRGLKANTHAHFRRFTAAGAKLTLRVLHGQIAQA 373

Query: 370 RQHILEKQQHIEQIVKQHL-----RYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
              +    + +    +  L     R+  LE + + + L   + Q +N I        +L 
Sbjct: 374 DHRLTVCGERLGLSARSLLRQRRDRFAGLEVRLRASKLSNAQAQ-RNAIARQRERTHRLA 432

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
            R    L   ++     V  + ++L + +Y+  L RG+  ++D   + +    ++    R
Sbjct: 433 ERANRALVTLLQRLDARVEASGKLLSALSYRGVLARGFALVRDEAGHPLHSADSVGPGAR 492

Query: 485 ILINFFDGQANAI--VINKAPP---KEQPTKKCQLHNNKREKQG---TQGELF 529
           + I F DG+  A       APP    +QP    Q      ++ G    QG LF
Sbjct: 493 VEIEFADGRVGATTDADRPAPPAKRAQQPKPAAQETKPAPKRVGKPVDQGSLF 545


>gi|182678223|ref|YP_001832369.1| exodeoxyribonuclease VII, large subunit [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|259646285|sp|B2IJK8|EX7L_BEII9 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|182634106|gb|ACB94880.1| exodeoxyribonuclease VII, large subunit [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 549

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 210/522 (40%), Positives = 303/522 (58%), Gaps = 28/522 (5%)

Query: 9   SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAII 68
           S + PE +VSELS  LK  +E     V +RGEIS YRG HSSGHAYF LKD ++RIDA+I
Sbjct: 13  STNSPELTVSELSAALKRTLEDRFGIVRLRGEISNYRGPHSSGHAYFCLKDQNARIDAVI 72

Query: 69  WKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLL 128
           WK T  +++  PEEG+E +  GKITT+ G S YQI++E++ P+G G L+   E R+++L 
Sbjct: 73  WKTTFMRLKVKPEEGLEVIATGKITTYAGKSSYQIVVEAIEPAGLGALMALFEARRRQLA 132

Query: 129 EEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPK 188
            EGLF ++ K  +PF+P +I VITSPTGAVIRDIL RI+ RFP  V+++PV+VQG+    
Sbjct: 133 SEGLFDEERKRALPFLPAVIGVITSPTGAVIRDILHRITERFPRPVLLWPVRVQGETAAA 192

Query: 189 EIANAILQLNTLKEGRTCP--RPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           E++ AI   N L      P  RPD++I+ARGGGS+EDLW FN+E +VRA A SSIP+I+A
Sbjct: 193 EVSAAIEGFNALPVTGQGPLHRPDLLIVARGGGSLEDLWGFNEENVVRAAAASSIPLIAA 252

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           IGHETDWTL DYAADLRAPTPTGAAE AVPV+  L +SL +L+ R      RL++ + + 
Sbjct: 253 IGHETDWTLIDYAADLRAPTPTGAAEKAVPVRADLLTSLNDLQRRHAGAAYRLLERRRSD 312

Query: 307 LNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNI 366
           L +L +ALP +D  L+  R RLDR        L     R       ++ R     L H +
Sbjct: 313 LRALARALPQADSLLATPRQRLDR----TATRLATACLRAQDQRGLVLGR-----LAHRL 363

Query: 367 QKNRQH--ILEKQQHIEQIVKQHLRYI-FLEKKEKIAILHMLREQTKN----------RI 413
            +   H  +    Q +E   +   R     +++ + ++LH+    T+N          R+
Sbjct: 364 SRQAPHASLARLGQKLEAFGRGLGRACEIAQERRRQSLLHLGIRLTQNFTQGIRVERERV 423

Query: 414 FYLHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFI 473
                 +  L  R+   +S  +      ++   ++ +S +Y   L RG+  ++D     +
Sbjct: 424 HGRRQKLASLDNRLRQAMSLTLSQRQARLANLAQLTRSLSYHAVLARGFALVRDETGQPL 483

Query: 474 TQKRNLATKTRILINFFDG----QANAIVINKAPPKEQPTKK 511
            +  ++     + + F DG     A A+V    P   +PT+K
Sbjct: 484 RRAADIIENHVLTLEFSDGCRQAVAGALVATDPPVDPKPTRK 525


>gi|90419936|ref|ZP_01227845.1| exodeoxyribonuclease VII, large subunit [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335977|gb|EAS49725.1| exodeoxyribonuclease VII, large subunit [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 545

 Score =  385 bits (989), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 209/493 (42%), Positives = 295/493 (59%), Gaps = 8/493 (1%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           EYSVSE+S  LK  VE    HV +RGE+SGYRG HSSGHAYFSLKD+ +RIDA+IW+   
Sbjct: 15  EYSVSEISGALKRTVEERFGHVRLRGEVSGYRGPHSSGHAYFSLKDDRARIDAVIWRTAF 74

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
           +K+ F PEEG+E +  GK+TT+PGSSKYQI+IE + P+G+G L+  L +R++KL  EGLF
Sbjct: 75  SKLAFKPEEGLEVVATGKLTTYPGSSKYQIVIEQIEPAGAGALMALLNERRRKLEAEGLF 134

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
           + + K P+PF+P++I V+TSPTGAVIRDI  RI+ RFP+ ++++PV+VQG+   +E+A A
Sbjct: 135 AAERKRPLPFMPRVIGVVTSPTGAVIRDIHHRIADRFPVHLLVWPVRVQGETSGEEVARA 194

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   NT  E     RPD+II+ARGGGS+EDLW FNDE++VRA A S+IP+ISA+GHETDW
Sbjct: 195 IDGFNTFPESGAIARPDLIIVARGGGSLEDLWGFNDEVVVRAAAASAIPLISAVGHETDW 254

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D+AAD+RAPTPTGAAEMAVPV+  L +++  L AR +  + R +  +   + +  +A
Sbjct: 255 TLIDHAADMRAPTPTGAAEMAVPVRADLLAAVAALAARHSGAVSRRLDQERRAVAATARA 314

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           LP+ D  L+  R RLD     L   L + +  K R +  +  R+    L   +++ R  +
Sbjct: 315 LPSPDMLLALPRRRLDEASTSLGQCLRVNLSEKRRAYGEVATRLAPSSLETLLREKRADL 374

Query: 374 LEKQQHIEQIVK---QHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFI 430
              Q H    V    Q  R  F    E+IA   +   +   R       +  L  R+   
Sbjct: 375 RHHQSHAAHAVTGLVQRKRQRF----ERIAA-DLQPHRINARAEAARLRLGTLGERLTAA 429

Query: 431 LSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFF 490
            +        +++   R+  S      L+RGYT ++  +   I +   L       + F 
Sbjct: 430 QALAATGRRQALASAWRVADSLNPMRVLERGYTIVRGPDGEPIVRASGLEPGMAFEVQFA 489

Query: 491 DGQANAIVINKAP 503
             Q    V    P
Sbjct: 490 HDQRRGAVATGEP 502


>gi|220926374|ref|YP_002501676.1| exodeoxyribonuclease VII large subunit [Methylobacterium nodulans
           ORS 2060]
 gi|219950981|gb|ACL61373.1| exodeoxyribonuclease VII, large subunit [Methylobacterium nodulans
           ORS 2060]
          Length = 531

 Score =  385 bits (988), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 206/517 (39%), Positives = 291/517 (56%), Gaps = 32/517 (6%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           PE+SV+EL+  LK  +E    HV +RGEISGYRG HSSGHAYFSLKD  ++IDA+IWKGT
Sbjct: 46  PEWSVTELAAALKRTLEDAFGHVRLRGEISGYRGPHSSGHAYFSLKDGGAKIDAVIWKGT 105

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
           L ++   P+EG+E +  G+ITTFPG S YQIIIE+L P+G+G  +  LE+R++ L  EGL
Sbjct: 106 LARLRHRPKEGLEVVATGRITTFPGKSAYQIIIEALEPAGAGAWMALLEERRRLLAAEGL 165

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F    K P+P++P+++ V+TSPTGAVIRDIL R+  RFP  V+++PV+VQG+   +E+A 
Sbjct: 166 FDAARKRPLPYLPRVVGVVTSPTGAVIRDILHRLEDRFPRPVLVWPVRVQGEGSAEEVAA 225

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   + L      PRPD++I+ARGGGSIEDLW FN+E++VRA A S+IP+ISA+GHETD
Sbjct: 226 AIRGFSALAPDGPIPRPDVLIVARGGGSIEDLWSFNEEIVVRAAAESAIPLISAVGHETD 285

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            TL D+AAD RAPTPTGAAEMAVPV+  L + L  L  R    + R I+ + + L  L +
Sbjct: 286 VTLIDHAADRRAPTPTGAAEMAVPVRLDLLADLDGLARRHAAALARSIERRRSDLRGLAR 345

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
            +P+ +  L+  R RLD      E  L   +    R     + R+      H        
Sbjct: 346 VIPSPEALLAVKRQRLD----LAEARLRPALAEGARTAQRRLARLLQALARHPPALRLAR 401

Query: 373 ILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILS 432
             E+   I+   +  L  +   + E++  L     Q ++R                    
Sbjct: 402 ARERFAAIDHRPRHALERLVAVRSERLNGLAQRLAQAQDR-------------------- 441

Query: 433 HKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDG 492
             ++   +  +    +  S  Y+  L RGY  + D     + +        RI + F DG
Sbjct: 442 -DLERRRSRFAGAAALFDSLNYRAVLARGYALVLDAEGRPLAEAEAARAAGRITVEFQDG 500

Query: 493 QANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
           +  A V+  APP+    K+      +      QG LF
Sbjct: 501 KVAA-VVEGAPPRRAAAKRGPAGPAR------QGSLF 530


>gi|84686140|ref|ZP_01014035.1| Exonuclease VII, large subunit [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84665667|gb|EAQ12142.1| Exonuclease VII, large subunit [Rhodobacterales bacterium HTCC2654]
          Length = 545

 Score =  385 bits (988), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 200/515 (38%), Positives = 292/515 (56%), Gaps = 8/515 (1%)

Query: 11  DHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           + PE++VSELS  +K ++E    HV +RGE+ G      SGH Y  LKD+ + I  +IWK
Sbjct: 36  NAPEFTVSELSGAVKRMIEGEFGHVRIRGEV-GRVSRPRSGHIYLDLKDDRAVISGVIWK 94

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           G   ++   PEEG+E +  G++TTFPG SKYQI+I+ + P+G+G L+  LEKRK  L  E
Sbjct: 95  GVSARLATQPEEGMEVVATGRLTTFPGQSKYQIVIDDIAPAGAGALMAMLEKRKAALTAE 154

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEI 190
           GLF+ + K PIP++P+II V+TSP+GAVIRDIL R+  RFP +V+I+PV VQG+ C  E+
Sbjct: 155 GLFAQERKKPIPYLPEIIGVVTSPSGAVIRDILHRLRDRFPRKVLIWPVAVQGERCAPEV 214

Query: 191 ANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHE 250
             AI   N L  G   PRPD+II+ARGGGS+EDLW FN+E +VRA A S IP+ISA+GHE
Sbjct: 215 TRAIQGFNALTPGGALPRPDLIIVARGGGSVEDLWGFNEESVVRAAAASDIPLISAVGHE 274

Query: 251 TDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSL 310
           TD TL DYAAD RAPTPT AAEMAVPV+  L +    L +RL + + + I  +   L  L
Sbjct: 275 TDTTLIDYAADRRAPTPTAAAEMAVPVRRELMAYTAELGSRLTSALTQGITRRAQRLTDL 334

Query: 311 LKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNR 370
            +ALP ++  L   R RLDR    L   L   +  +    N     ++   L + +   R
Sbjct: 335 SRALPRAETLLETPRQRLDRAGDRLPAALIAKVRGEEVRLNRASGGLRPSVLTNRVTVLR 394

Query: 371 QHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRI-FYLHTHIKKLITRIEF 429
           + + ++   +   +    R +   K+E   +   L     +          + L  R+  
Sbjct: 395 ERVADRAGRLGYALA---RPVEAGKRELARLSPRLDPARIDEARVRKEREFEALCARLSR 451

Query: 430 ILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINF 489
           + + +I+     +    R+  +  Y  TLKRGY  ++  + + +T +   A    + I F
Sbjct: 452 VGTGQIEGWQKRLDALERMRVTLGYTETLKRGYAVVRG-DGDVVTTREAAAHAGALEIEF 510

Query: 490 FDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGT 524
            DG+ +  VI       +PT K +   ++  +QGT
Sbjct: 511 HDGRLD--VIGGGGGSAKPTAKAKKSKDEPPEQGT 543


>gi|91978566|ref|YP_571225.1| exodeoxyribonuclease VII large subunit [Rhodopseudomonas palustris
           BisB5]
 gi|91685022|gb|ABE41324.1| Exodeoxyribonuclease VII large subunit [Rhodopseudomonas palustris
           BisB5]
          Length = 536

 Score =  383 bits (984), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 213/526 (40%), Positives = 310/526 (58%), Gaps = 14/526 (2%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           E++VSELS  LK  VE +  HV VRGEISG+RG HSSGH YF+LKD  ++I+A+IWKG  
Sbjct: 15  EFTVSELSQALKRTVEDSYGHVRVRGEISGFRGAHSSGHCYFALKDESAKIEAVIWKGVA 74

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            ++ F P+EG+E +  GK+TT+PGSSKYQI+IE+L P+G G L+  +E+RKKKL  EGLF
Sbjct: 75  GRMRFKPQEGLEVIATGKLTTYPGSSKYQIVIEALEPAGVGALMALMEERKKKLGAEGLF 134

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
            +  K  +P++P +I V+TSPTGAVIRDIL R+  RFP RV+++PVKVQG+   +++A A
Sbjct: 135 DEARKQLLPWLPDVIGVVTSPTGAVIRDILHRLEDRFPRRVLVWPVKVQGEGSAEQVAAA 194

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N L EG   PRPD++I+ARGGGS+EDLW FN+E++VRA A S IP+ISA+GHETD 
Sbjct: 195 IHGFNALPEGGPIPRPDLLIVARGGGSLEDLWSFNEEIVVRAAAESMIPLISAVGHETDV 254

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D+AAD RAPTPT AAEMAVPV+  L   + +   R+     R    + N L +  +A
Sbjct: 255 TLIDFAADKRAPTPTAAAEMAVPVRAELFVEVQSFSRRMMLCWTRGQDSRRNELRAAARA 314

Query: 314 LPNSDQTLSCSRYRLDR----LPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKN 369
           LP + + L+  R RLD     LPR L  N        +R F      I  + L   +  +
Sbjct: 315 LPAASELLAIPRQRLDTAAAGLPRALRANTHA----HHRRFAKAAAGITLNVLRAQVSHS 370

Query: 370 RQHI---LEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKN-RIFYLHTHIKKLIT 425
            Q +    E+ +H  +   +H R  F     ++    +  EQ +  +I      +++L  
Sbjct: 371 AQRLGITGERLKHGARATLRHRRDRFDGLAIRLQASKLANEQAQRMQIARERERMQRLAE 430

Query: 426 RIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRI 485
           R    L+  +      ++ + ++L + +Y+  L RG+  ++D + + +     ++   ++
Sbjct: 431 RARRALTTLLDRQQARLTQSGKLLTALSYRGVLARGFALVRDADGHAVHAAAAVSAGAQL 490

Query: 486 LINFFDGQANAIVINK-APPKEQPTKKCQLHNNKRE-KQGTQGELF 529
            + F DG+ +       A    +PT        KR  K   QG LF
Sbjct: 491 SVEFADGRVSVTADGGHAGEPAKPTTPASKPTQKRTPKPVDQGSLF 536


>gi|115526606|ref|YP_783517.1| exodeoxyribonuclease VII large subunit [Rhodopseudomonas palustris
           BisA53]
 gi|115520553|gb|ABJ08537.1| Exodeoxyribonuclease VII large subunit [Rhodopseudomonas palustris
           BisA53]
          Length = 546

 Score =  382 bits (982), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 203/508 (39%), Positives = 298/508 (58%), Gaps = 12/508 (2%)

Query: 11  DHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           + PE++V+ELS  LK  VE    HV VRGEI+G+RG HSSGH YFSLKD+ ++I+A+IWK
Sbjct: 12  NSPEFTVTELSSALKRTVEDAYGHVRVRGEITGFRGAHSSGHCYFSLKDDGAKIEAVIWK 71

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           G   ++ F P+EG+E +  GK+TT+PGSSKYQI+IE++ P+G G L+  +E+RK+KL  E
Sbjct: 72  GVHGRMRFKPQEGLEVIATGKLTTYPGSSKYQIVIEAIEPAGVGALMALMEERKRKLGAE 131

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEI 190
           GLF +  K  +P++P++I V+TSPTGAVIRDIL R+  RFP RV+++PV+VQG+   +++
Sbjct: 132 GLFDEARKQLLPYLPEVIGVVTSPTGAVIRDILHRLQDRFPRRVLVWPVRVQGEGSAEQV 191

Query: 191 ANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHE 250
           A AI   N L EG   PRPD++I+ARGGGS+EDLW FN+E++VRA A S IP+ISA+GHE
Sbjct: 192 AAAIHGFNALSEGGAIPRPDLLIVARGGGSLEDLWSFNEEIVVRAAAESMIPLISAVGHE 251

Query: 251 TDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIII---RLIKYKINTL 307
           TD TL D+AAD RAPTPT AAEMAVPV+  L    + + AR   +++   R  + +   L
Sbjct: 252 TDITLIDFAADKRAPTPTAAAEMAVPVRAEL---FVEVSARNRRMMLCWQRGQERRRTEL 308

Query: 308 NSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQ 367
            +  +ALP+    L+    RLD     L   L       +R F      +    L   + 
Sbjct: 309 RAATRALPSGGALLAIPTQRLDGAAAALPRALRANTHAHHRRFAQASAGLTLRVLRAQVA 368

Query: 368 KNRQHILEKQQHIEQIVKQHL-----RYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKK 422
              Q +      ++   +  L     R+  L  + K + L   + Q + RI       ++
Sbjct: 369 HAAQRLDVNGARLKHCARAALRQRRDRFDALAARLKTSKLANAQAQ-RARIAREQERTQR 427

Query: 423 LITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATK 482
           L  R    LS  I+     V+   ++L + +Y+  L RG+  ++D     +    ++A  
Sbjct: 428 LTERSRRALSILIERHRARVTHAGQLLGALSYRGVLARGFALVRDAQGAALHAAASVAAG 487

Query: 483 TRILINFFDGQANAIVINKAPPKEQPTK 510
             + + F DG+  A       P +  TK
Sbjct: 488 AHLTLEFADGRIGATADADGRPAQASTK 515


>gi|299134218|ref|ZP_07027411.1| exodeoxyribonuclease VII, large subunit [Afipia sp. 1NLS2]
 gi|298590965|gb|EFI51167.1| exodeoxyribonuclease VII, large subunit [Afipia sp. 1NLS2]
          Length = 480

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 208/520 (40%), Positives = 293/520 (56%), Gaps = 56/520 (10%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           E++VSELS  LK  VE    HV VRGEISG+RG H+SGH YF+LKD  ++I+A+IWKG  
Sbjct: 13  EFTVSELSSALKRTVEDTYGHVRVRGEISGFRGPHASGHCYFALKDESAKIEAVIWKGVH 72

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            ++   P+EG+E +  GK+TT+PGSSKYQI+IE++ P+G G L+  +E+RKKKL  EGLF
Sbjct: 73  GRMRVKPQEGLEVIATGKLTTYPGSSKYQIVIEAIEPAGIGALMALMEERKKKLAAEGLF 132

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
            +  K  +P++P++I VITSPTGAVIRDIL R+  RFP RV+++PV+VQG+   +++A A
Sbjct: 133 DESRKQLLPWLPEVIGVITSPTGAVIRDILHRLEDRFPRRVLVWPVRVQGEGSAEQVAAA 192

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N L+EG   PRPD++I+ARGGGS+EDLW FN+E++VRA A S IP+ISA+GHETD 
Sbjct: 193 IEGFNALEEGGPIPRPDLLIVARGGGSLEDLWSFNEEIVVRAAAASMIPLISAVGHETDI 252

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D+AAD RAPTPT AAEMAVPV+  L   + +L  R      R  +++ + L S  + 
Sbjct: 253 TLIDFAADKRAPTPTAAAEMAVPVRADLAIEISSLARRSFACWQRGQEHRRSELRSAARG 312

Query: 314 LPNSDQTLSCSRYRLDR----LPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKN 369
           LP     L+  R R DR    LPR L  N  +      R  + I  R+    L   I + 
Sbjct: 313 LPKLTDLLAIPRQRFDRASAQLPRALRANTHVY----DRRLSMIAGRLTVTTLRGQIARA 368

Query: 370 RQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEF 429
           R  +    +   +  +Q   +I L +                             TRI+ 
Sbjct: 369 RDQVNRLSESARRCSQQ---FIALRR-----------------------------TRIQH 396

Query: 430 ILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINF 489
                          + ++L + +YK  L RG+  ++D     +     +     I I F
Sbjct: 397 ---------------SAQMLAALSYKGVLSRGFALVRDETGLPLHHAAQVGAGEHISIEF 441

Query: 490 FDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
            DG+  A   +  PP  +   K     +  E +  QG+LF
Sbjct: 442 ADGRIAATA-HGTPPSAKKVAKPAKTADVPEHKKVQGDLF 480


>gi|217976587|ref|YP_002360734.1| exodeoxyribonuclease VII, large subunit [Methylocella silvestris
           BL2]
 gi|217501963|gb|ACK49372.1| exodeoxyribonuclease VII, large subunit [Methylocella silvestris
           BL2]
          Length = 521

 Score =  379 bits (972), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 203/491 (41%), Positives = 285/491 (58%), Gaps = 18/491 (3%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           PE +VSELS  LK  +E     V +RGEIS YRG HSSGHAYF LKD  +RIDA+IWKG 
Sbjct: 10  PELTVSELSNALKRTIEDRFGFVRLRGEISNYRGPHSSGHAYFCLKDAGARIDAVIWKGV 69

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
             ++   PEEG+E +  GKITTFPG S YQII+E++ P+G G L+   E+R++KL  EGL
Sbjct: 70  FGRLRVKPEEGLEVIATGKITTFPGKSSYQIIVEAIEPAGVGALMALFEERRRKLAAEGL 129

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F +  K  +PF+P  + VITSPTGAVIRDIL RI  RFP  V+++PV+VQG+    E+A 
Sbjct: 130 FDEARKKALPFLPLRVGVITSPTGAVIRDILHRIKDRFPRHVLVWPVRVQGETSAAEVAA 189

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI     L E     RP +II+ARGGGS+EDLW FN+E++VRA+A S+IP+ISAIGHETD
Sbjct: 190 AIAGFGALPEDGPLARPHVIIVARGGGSLEDLWSFNEEIVVRAVAASAIPLISAIGHETD 249

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           WTL D+AADLRAPTPTGAAE AVPV+  L + + +L  R    + RL+  + +   +L +
Sbjct: 250 WTLIDHAADLRAPTPTGAAEKAVPVRLQLIADVADLSRRHAGAMARLLDRRRSEARALSR 309

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
           ALP  ++ L+  R +LD   R   +     I R + H++  + R          +     
Sbjct: 310 ALPLPEEILALPRQKLDHAGRRFAN----AILRAHDHYSLALGRAAQRLARQTPRARMAR 365

Query: 373 ILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKN-----------RIFYLHTHIK 421
             EK   ++Q ++   R   + ++ + A L+ L E+  N           R       + 
Sbjct: 366 AGEKLAGLQQRMQ---RSAVIGRERRAAALNSLGERLINARLSRARAEQERTAAARHRLD 422

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLAT 481
            L  R+   +  KI +    +    ++ +S  YKN L RG+  ++D   N +     +  
Sbjct: 423 VLGPRLLRAVHEKIAARRAELRRLDQLRESLGYKNVLARGFALVRDAEGNPLRLAAAITD 482

Query: 482 KTRILINFFDG 492
              + + F DG
Sbjct: 483 GALLDLQFADG 493


>gi|85706860|ref|ZP_01037951.1| Exonuclease VII, large subunit [Roseovarius sp. 217]
 gi|85668653|gb|EAQ23523.1| Exonuclease VII, large subunit [Roseovarius sp. 217]
          Length = 497

 Score =  379 bits (972), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 200/513 (38%), Positives = 293/513 (57%), Gaps = 42/513 (8%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           PE+SVS+LS  +K ++E   SHV VRGE+ G      SGH Y  LKD+ + +  IIWKG 
Sbjct: 15  PEFSVSDLSGAIKRMIEGEFSHVRVRGEL-GRISRPRSGHIYLDLKDDSAVLAGIIWKGV 73

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
             ++   PEEG+E +  G++TTFPG S+YQIIIE + P+G G L+  LEKRK  L  EGL
Sbjct: 74  ATRLAVQPEEGMEVVATGRLTTFPGQSRYQIIIEDMKPAGMGALMAMLEKRKAALAAEGL 133

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F+ + K  +P++P II V+TSP+GAVIRDIL R+  RFP +V+I+PV VQGD+C  E+A 
Sbjct: 134 FAPERKQALPYLPDIIGVVTSPSGAVIRDILHRLRDRFPRKVLIWPVAVQGDKCAPEVAR 193

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N +  G   PRPD+II+ARGGGS+EDLW FN+E++VRA A S IP+ISA+GHETD
Sbjct: 194 AIRGFNAMTPGGALPRPDLIIVARGGGSVEDLWGFNEEIVVRAAAESVIPLISAVGHETD 253

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            TL D+A+D RAPTPT AAE+AVPV+  L + +    ARL++ + + +  +   L  L +
Sbjct: 254 TTLIDFASDKRAPTPTAAAELAVPVRMDLLAWVEGQGARLSHALSQGVSLRGQRLRDLAR 313

Query: 313 ALPNSDQTLSCSRYRLD----RLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQK 368
           ALP +D  L   R RLD    RLP  L  ++++    +  H +     ++   L   ++ 
Sbjct: 314 ALPRADVLLDGPRQRLDALGERLPAALIRSVQV----RRVHLSETAGALRPALLRRAVEG 369

Query: 369 NRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHML-REQTKNRIFYLHTHIKKLITRI 427
           +R+ +      +                     +H L R+ T+ R       + ++  R 
Sbjct: 370 DRRRLQATAARLN--------------------VHALNRDITQKR-----RELDRMSARF 404

Query: 428 EFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILI 487
             +   +++     +S   R+ ++  YK TLKRGY  ++  +   +T ++  A    + I
Sbjct: 405 SEVAGRQVRGWQDRLSALERLRETLGYKATLKRGYAVVR-GDGAVVTTRKAAAGAAVLEI 463

Query: 488 NFFDGQAN------AIVINKAPPKEQPTKKCQL 514
            F DG  +      A+ I K  PK  P  +  L
Sbjct: 464 EFADGMLDVSGTGPAVPIPKVKPKTPPEGQGSL 496


>gi|300024096|ref|YP_003756707.1| exodeoxyribonuclease VII large subunit [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299525917|gb|ADJ24386.1| exodeoxyribonuclease VII, large subunit [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 488

 Score =  378 bits (970), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 202/526 (38%), Positives = 291/526 (55%), Gaps = 51/526 (9%)

Query: 7   KNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDA 66
           +   + PE+SVSELS  +K  +E    +V +RGEISGYRG H+SGH YF+LKD+ ++I+A
Sbjct: 11  RPGANAPEFSVSELSGAIKRALEDGFGYVRLRGEISGYRGPHASGHCYFALKDDRAKIEA 70

Query: 67  IIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKK 126
           +IWKG+  ++ F PEEG+E +  GKITTFPGSSKYQI+IE L P+G+G L+  LE+RK+K
Sbjct: 71  VIWKGSFGRLRFKPEEGMEVVAQGKITTFPGSSKYQIVIEQLEPAGAGALMALLEERKRK 130

Query: 127 LLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDEC 186
              EGLF +  K P PF+PK++ ++TSPTGAVIRD+L   + RFP  V+++PV+VQG+  
Sbjct: 131 FAAEGLFEEARKKPRPFLPKVVGIVTSPTGAVIRDMLHGFNERFPTCVLLWPVRVQGEGS 190

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
             E+A AI   N L+ G   PRPD++I+ARGGGS+EDLW FN+E++VRA A S IP+ISA
Sbjct: 191 AAEVAAAIRGFNALEIGGKIPRPDVLIVARGGGSLEDLWSFNEEIVVRAAAESRIPLISA 250

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETDWTL D  AD RAPTPT AAE AVP    L  +L   + R    I R++      
Sbjct: 251 VGHETDWTLIDLVADARAPTPTKAAEWAVPKYSELIEALDKFQLRKRTAIRRVLADTRTH 310

Query: 307 LNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNI 366
           L +  + LP     ++  R R D + R L   L        R     + R+         
Sbjct: 311 LKASSRGLPKLQDLIALPRQRFDAVDRRLSRAL----LANTRAHGTRLARVSGRL----- 361

Query: 367 QKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITR 426
                         + IV++H R      +E++ +L     Q              LI R
Sbjct: 362 ------------SAQPIVQKHSRC-----RERLDVLERRAGQA-------------LINR 391

Query: 427 IEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRIL 486
           +              +   + +L+S  Y++ L RG+  ++D     + Q R+++    + 
Sbjct: 392 VAV--------RRRDLDGKSALLKSLGYQSVLSRGFALVRDETGVTVRQARSVSPGAALS 443

Query: 487 INFFDGQANAIVINKAPPKEQPTKKCQLHNNKREK---QGTQGELF 529
           + F DG+   +V +  P      +        R+K   +G QG LF
Sbjct: 444 VQFSDGRIG-VVADGDPATGTGAESAAGTKPPRQKTRTRGGQGSLF 488


>gi|312115900|ref|YP_004013496.1| exodeoxyribonuclease VII large subunit [Rhodomicrobium vannielii
           ATCC 17100]
 gi|311221029|gb|ADP72397.1| exodeoxyribonuclease VII, large subunit [Rhodomicrobium vannielii
           ATCC 17100]
          Length = 529

 Score =  377 bits (969), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 196/484 (40%), Positives = 282/484 (58%), Gaps = 12/484 (2%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           E++VSELS+ +K  VE     V +RGEISGYRG HSSGHAY  LKD+ +RIDA+IW+GT 
Sbjct: 11  EFTVSELSFAIKRTVEDAYGLVRLRGEISGYRGQHSSGHAYLCLKDDKARIDAVIWRGTF 70

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
           + ++F PEEG+E +V G+ITTFPG S YQI+IE L P+G+G L+  LE+RKKKL  EGLF
Sbjct: 71  SHLKFKPEEGLEVIVTGRITTFPGKSSYQIVIEQLEPAGAGALMALLEERKKKLAAEGLF 130

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
            +  K P+PF P+++ ++TSPTGAVIRD+L   + R P RVI++PV+VQG+ C  E++ A
Sbjct: 131 DESRKRPLPFWPEVVGIVTSPTGAVIRDMLHGFTERCPTRVIVWPVRVQGETCGAEVSAA 190

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N L      PRPD++I+ARGGGS+EDLW FN+E +VRA A S+IP+ISA+GHETDW
Sbjct: 191 IRGFNALDGFGPLPRPDLLIVARGGGSLEDLWGFNEEAVVRAAAESAIPLISAVGHETDW 250

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D  AD RAPTPT AAE AVP    L   L     R    + R ++          + 
Sbjct: 251 TLIDLVADARAPTPTKAAEWAVPKHADLIIRLGECIERARRCVRRNLEQLRAEFRGAERG 310

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           LP     L   R RLD     L   L     R    F     R+    +   I + R+ +
Sbjct: 311 LPRPHTLLQVPRQRLDTAGARLGQALIYFTERSRGRFERSAVRLSPRLVARPIVEARERL 370

Query: 374 -----LEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIE 428
                   +   + IV++  R+    ++    +L    ++   R+  L     + +T   
Sbjct: 371 GRAATFNARAFRDVIVRKRERWTVRAERLNAGLLATPTQRGIERLLMLAARADQAVTN-- 428

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
             L+H+ +     ++   ++LQS ++K+ L+RG+  ++D +   I +  +++    + I 
Sbjct: 429 --LAHRHRQ---RLAALGQLLQSLSHKSVLERGFALVRDADGRVIRRAASVSAAAALDIE 483

Query: 489 FFDG 492
           F DG
Sbjct: 484 FADG 487


>gi|84499997|ref|ZP_00998263.1| exodeoxyribonuclease VII, large subunit [Oceanicola batsensis
           HTCC2597]
 gi|84391931|gb|EAQ04199.1| exodeoxyribonuclease VII, large subunit [Oceanicola batsensis
           HTCC2597]
          Length = 521

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 194/521 (37%), Positives = 298/521 (57%), Gaps = 21/521 (4%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           E++VSELS  +K  +ES   HV VR E+ G      SGH YF LKD+ + + A+ WKG +
Sbjct: 17  EFTVSELSGAVKRAIESGFGHVRVRAEV-GRVSRPRSGHMYFDLKDDRAVLSAVSWKGQV 75

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            +++  PEEG+E +  G++TTFPG SKYQ+I++++ P+G+G L+  LEKRK  L  EGLF
Sbjct: 76  ARMQVQPEEGMEVIATGRMTTFPGQSKYQLIVDNVEPAGAGALMALLEKRKAMLRAEGLF 135

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
           + + K P+P++P+++ V+TSP+GAVIRDIL R+  RFP+ V+I+PV VQG  C  E++ A
Sbjct: 136 AAERKRPLPYLPRVVGVVTSPSGAVIRDILHRLRDRFPVHVLIWPVAVQGQTCAAEVSRA 195

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N L      PRPD++I+ARGGGSIEDLW FN+E++ RA A+S IP+ISA+GHETD 
Sbjct: 196 IAGFNRLSPAGAVPRPDLLIVARGGGSIEDLWGFNEEIVARAAASSEIPLISAVGHETDT 255

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D+ +D RAPTPT AAE+AVPV+  L   + ++ ARL     + I  +   L+ L +A
Sbjct: 256 TLIDFVSDRRAPTPTAAAELAVPVRAELTGWVADMRARLIRAQGQAILSRRQRLSDLARA 315

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           LP  ++    +R +LD     L + L   +  +    +     ++   L   I ++RQ +
Sbjct: 316 LPRPERLTETARQKLDTWGERLPNALRRGVAARRVALSDCSGALRPGLLRRRIAEDRQRV 375

Query: 374 LEKQQHIEQI----VKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEF 429
            ++   +       V QH R  F     ++    + RE  + R       ++KL  R   
Sbjct: 376 ADRGARLPSSMTRNVMQHRRQ-FETCAARLQPATLRRETLRQR-----EALEKLANRFAE 429

Query: 430 ILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINF 489
                ++S    ++   R+ ++  Y+ TL RGY  ++D N   +T+K        + I F
Sbjct: 430 AARRSVESRRDRLATLDRLRETLGYRETLARGYAVVRDGNGAVMTRKAQAEQAESLAIEF 489

Query: 490 FDGQANAIVINKAP-PKEQPTKKCQLHNNKREKQGTQGELF 529
            DG  +      +P P+++P+        ++E    QG LF
Sbjct: 490 ADGTLDQ---GASPAPRKKPSA------GRKEPPPEQGSLF 521


>gi|209886360|ref|YP_002290216.1| exodeoxyribonuclease VII, large subunit [Oligotropha
           carboxidovorans OM5]
 gi|209874556|gb|ACI94352.1| exodeoxyribonuclease VII, large subunit [Oligotropha
           carboxidovorans OM5]
          Length = 486

 Score =  376 bits (966), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 201/495 (40%), Positives = 284/495 (57%), Gaps = 55/495 (11%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           E++VSELS  LK  VE    HV VRGEISG+RG H+SGH YF+LKD  ++I+A+IWKG  
Sbjct: 13  EFTVSELSSALKRTVEDAYGHVRVRGEISGFRGPHASGHCYFALKDESAKIEAVIWKGVH 72

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            ++   P+EG+E +  GK+TT+PGSSKYQI+IE++ P+G G L+  +E+RK+KL  EGLF
Sbjct: 73  GRMRVKPQEGLEVIATGKLTTYPGSSKYQIVIEAIEPAGVGALMALMEERKRKLAAEGLF 132

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
            D  K  +P++P++I V+TSPTGAVIRDIL R+  RFP RV+++PV+VQG+   ++IA A
Sbjct: 133 DDARKQLLPWLPEVIGVVTSPTGAVIRDILHRLHDRFPRRVLVWPVRVQGEGSAEQIAAA 192

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N L+EG   PRPD++I+ARGGGS+EDLW FN+E++VRA A S IP+ISA+GHETD 
Sbjct: 193 IEGFNALEEGGAIPRPDLLIVARGGGSLEDLWSFNEEIVVRAAAGSMIPLISAVGHETDI 252

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D+AAD RAPTPT AAEMAVPV+  L   + +L  R      R  +++ + L    + 
Sbjct: 253 TLIDFAADKRAPTPTAAAEMAVPVRADLAIEISSLARRAFACWQRGHEHRRSELRGAARG 312

Query: 314 LPNSDQTLSCSRYRLDR----LPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKN 369
           LP     L+  R R DR    LPR L  N  +      R  + +  R+    L   I ++
Sbjct: 313 LPRLTDLLAIPRQRFDRAAAQLPRALRANTHVY----DRRLSMVTGRLTVTTLRTQIARS 368

Query: 370 RQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEF 429
           R  +  +   I +    H  +I L                +NR+ +              
Sbjct: 369 RDQV-NRLSEIAKRCSDH--FIALR---------------RNRVQH-------------- 396

Query: 430 ILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINF 489
                          + ++L + +YK+ L RG+  ++D     +     +    RI I F
Sbjct: 397 ---------------SAQMLAALSYKSVLSRGFALVRDEAGQPLHHAAQVGAGERISIEF 441

Query: 490 FDGQANAIVINKAPP 504
            DG+  A     A P
Sbjct: 442 ADGRIAATTHGPAVP 456


>gi|86748982|ref|YP_485478.1| exodeoxyribonuclease VII large subunit [Rhodopseudomonas palustris
           HaA2]
 gi|86572010|gb|ABD06567.1| Exodeoxyribonuclease VII large subunit [Rhodopseudomonas palustris
           HaA2]
          Length = 538

 Score =  376 bits (966), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 202/490 (41%), Positives = 296/490 (60%), Gaps = 12/490 (2%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           E++VSELS  LK  VE +  HV VRGEISG+RG HSSGH YF+LKD  ++I+A+IWKG  
Sbjct: 15  EFTVSELSQALKRTVEDSYGHVRVRGEISGFRGAHSSGHCYFALKDESAKIEAVIWKGVA 74

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            ++ F P+EG+E +  GK+TT+PGSSKYQI+IE+L P+G G L+  +E+RK+KL  EGLF
Sbjct: 75  GRMRFKPQEGLEVIATGKLTTYPGSSKYQIVIEALEPAGVGALMALMEERKRKLGAEGLF 134

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
            +  K  +P++P++I V+TSPTGAVIRDIL R+  RFP RV+++PVKVQG+   +++A A
Sbjct: 135 DEARKQLLPYLPEVIGVVTSPTGAVIRDILHRLEDRFPRRVLVWPVKVQGEGSAEQVAAA 194

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N L EG   PRPD++I+ARGGGS+EDLW FN+E++VRA A S IP+ISA+GHETD 
Sbjct: 195 IHGFNALPEGGPIPRPDLLIVARGGGSLEDLWSFNEEIVVRAAAESMIPLISAVGHETDV 254

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D+AAD RAPTPT AAEMAVPV+  L   + +   R+     R    + N L +  +A
Sbjct: 255 TLIDFAADKRAPTPTAAAEMAVPVRAELFVEVQSYARRMMLCWSRGQDSRRNELRAAARA 314

Query: 314 LPNSDQTLSCSRYRLD----RLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKN 369
           LP + + L+  R RLD     LPR L  N        +R +    + I  + L   +  +
Sbjct: 315 LPAAGELLAIPRQRLDGAASSLPRALRANTHA----HHRRYAKAASGITLNVLRAQVSHS 370

Query: 370 RQHI---LEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKN-RIFYLHTHIKKLIT 425
            Q +    E+ +H  +   +H R  F     ++    +  EQ +  RI      + +L  
Sbjct: 371 AQRLGSTGERLKHCTRATLRHRRDRFESLAIRLQASKLANEQAQRMRIARERERMLRLAE 430

Query: 426 RIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRI 485
           R     +         +  + ++L + +Y+  L RG+  ++D + + +     ++   R+
Sbjct: 431 RARRAWATLRDRQQARLVQSGKLLTALSYRGVLARGFALVRDADGHALHAAAAVSAGARL 490

Query: 486 LINFFDGQAN 495
            + F DG+  
Sbjct: 491 SVEFADGRVG 500


>gi|83942803|ref|ZP_00955264.1| exodeoxyribonuclease VII, large subunit [Sulfitobacter sp. EE-36]
 gi|83846896|gb|EAP84772.1| exodeoxyribonuclease VII, large subunit [Sulfitobacter sp. EE-36]
          Length = 511

 Score =  376 bits (965), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 203/532 (38%), Positives = 300/532 (56%), Gaps = 30/532 (5%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           +P   +NS   PE++V+ELS  +K ++E    HV +RGE+ G      SGH Y  LKD+ 
Sbjct: 6   DPREGQNS---PEFTVTELSGAIKRVIEGEFGHVRIRGEV-GRVSRPRSGHIYLDLKDDS 61

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           S I  +IWKG   ++E  PEEG+E +  G+ITTF G SKYQI+IE + P+G G L+  LE
Sbjct: 62  SVISGVIWKGVSARLETQPEEGMEVIATGRITTFGGQSKYQIVIEDIKPAGMGALMALLE 121

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           KRK  L  EGLF+ + K P+P++P++I V+TSP+GAVIRDIL R+  RFP +V+I+PV V
Sbjct: 122 KRKAALAAEGLFAPERKRPLPYLPEVIGVVTSPSGAVIRDILHRLRDRFPRKVLIWPVAV 181

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QG +C  E+A AI   N L  G   PRPD++I+ARGGGS+EDLW FN+E++ RA A S I
Sbjct: 182 QGAKCAPEVARAIAGFNALTPGGALPRPDLLIVARGGGSVEDLWGFNEEIVARAAAASDI 241

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETD TL DY +D RAPTPT AAE+AVPV+  L + L   EAR+   + + + 
Sbjct: 242 PLISAVGHETDTTLIDYVSDKRAPTPTAAAELAVPVRHELVALLDGQEARMTQALSQGLA 301

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            +   L  + +ALP  D  L   R RLD     L   L   + ++  H + I   ++   
Sbjct: 302 RRDQRLRDMARALPRPDSLLDGPRQRLDMRGARLGPALTAGVQKRKVHLSDISGALRPAT 361

Query: 362 LIHNIQKNRQHI--LEKQQHIEQIVKQHLRYI--FLEKKEKIAILHMLREQTKNRIFYLH 417
           L  ++Q  ++ +  L  +   E + ++  R +   + +    A+     EQ + R     
Sbjct: 362 LRRSLQTEQRRLAALADRFRPEALGREQKRRLEGLIARFRPDAL-----EQDRKR---KE 413

Query: 418 THIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKR 477
              + L  R+      + +  H  ++   R+ +  +YK+TL RGY  ++  +   +T K+
Sbjct: 414 EAFQSLARRLSDAGQRQTQGWHKQIAGLDRLHEMLSYKSTLARGYAVVR-GDGGVVTTKQ 472

Query: 478 NLATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
                + + I F DG+    +   A PK+ P K  +           QG LF
Sbjct: 473 AAQDASALEIEFIDGKMK--IGGGAAPKKTPKKAPE-----------QGSLF 511


>gi|188583526|ref|YP_001926971.1| exodeoxyribonuclease VII, large subunit [Methylobacterium populi
           BJ001]
 gi|179347024|gb|ACB82436.1| exodeoxyribonuclease VII, large subunit [Methylobacterium populi
           BJ001]
          Length = 548

 Score =  375 bits (964), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 176/347 (50%), Positives = 236/347 (68%)

Query: 11  DHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           + PE+SV +L+  LK  +E    HV +RGEISGYRG H SGHAYFSLKD  ++IDA++WK
Sbjct: 63  NAPEWSVGDLAAALKRTLEDAFGHVRLRGEISGYRGPHGSGHAYFSLKDGSAKIDAVVWK 122

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           G L ++   P+EG+E +  GKITTF G S YQI+I+S+ P+G G  +  LE+RK+ L  E
Sbjct: 123 GVLGRLRQKPKEGLEVVATGKITTFAGKSSYQIVIDSMEPAGIGAWMALLEERKRLLAAE 182

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEI 190
           GLF  + K PIPF+P+++ V+TSPTGAVIRDIL R+  RFP  V+++PV+VQG+    EI
Sbjct: 183 GLFEAERKRPIPFLPRVVGVVTSPTGAVIRDILHRLEDRFPRPVLVWPVRVQGEGAADEI 242

Query: 191 ANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHE 250
           A AI   N L  G   PRPD++I+ARGGGSIEDLW FN+E +VRA A S IP+ISA+GHE
Sbjct: 243 AAAIRGFNALIPGGPIPRPDVLIVARGGGSIEDLWAFNEEAVVRAAAESGIPLISAVGHE 302

Query: 251 TDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSL 310
           TD TL D+A+D RAPTPTGAAEMAVPV+  L + + +L AR    ++R I+ +     +L
Sbjct: 303 TDTTLIDFASDRRAPTPTGAAEMAVPVRAELLAQIHDLGARQAGTMLRRIERERADFRAL 362

Query: 311 LKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRI 357
           ++A+P +D  L+  R RLD     L   L           N + +R+
Sbjct: 363 VRAIPGADAFLAAKRQRLDLADARLRPALAANARDSRERLNRLADRL 409


>gi|126461268|ref|YP_001042382.1| exodeoxyribonuclease VII large subunit [Rhodobacter sphaeroides
           ATCC 17029]
 gi|158513432|sp|A3PGZ4|EX7L_RHOS1 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|126102932|gb|ABN75610.1| Exodeoxyribonuclease VII large subunit [Rhodobacter sphaeroides
           ATCC 17029]
          Length = 519

 Score =  375 bits (962), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 198/518 (38%), Positives = 291/518 (56%), Gaps = 11/518 (2%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           +P   +N+   PE++VSELS  +K ++E     V VRGEI G     +SGH YF LKD+ 
Sbjct: 7   DPAPSRNT---PEFTVSELSGAVKRVIEGEFGLVRVRGEI-GRVSRPASGHLYFDLKDDR 62

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           + + AI WKG   ++   PEEG+E +  G++TTFPG SKYQII+E + P+G+G L+  LE
Sbjct: 63  AVMAAICWKGQAGRLSVRPEEGMEVVATGRMTTFPGQSKYQIIVEDMAPAGAGALMAMLE 122

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           KR+  L  EGLF    K P+PF+P++I V+TSP+GAVIRDIL R+  RFP  V+I+PV V
Sbjct: 123 KRRAALAAEGLFDAGRKRPLPFLPRVIGVVTSPSGAVIRDILHRLRDRFPSHVLIWPVAV 182

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QG++C  E+A AI   NTL EG   PRPD++I+ARGGGS+EDLW FN+E++VRA A S I
Sbjct: 183 QGEKCAPEVAAAIRGFNTLPEGGPIPRPDLLIVARGGGSLEDLWGFNEEIVVRAAAESRI 242

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETD TL D+AAD RAPTPT AAEMAVPV+  L + L    ARL+      I+
Sbjct: 243 PLISAVGHETDTTLIDHAADRRAPTPTAAAEMAVPVRLELLAGLDGQGARLSRCAAETIR 302

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            +   L  L +ALP  +  ++    R D     L   L   +  +      +   ++   
Sbjct: 303 RRDQRLRDLARALPRLESLVAGPSQRFDLWSGRLSGALGQSVAARRARLEPLGAHLRPRL 362

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHL-----RYIFLEKKEKIAILHMLREQTKNRIFYL 416
           L   + + +  + ++ + +E  + +       R+  L  +   A   ++ E  +      
Sbjct: 363 LADLVARQKDRLGDRTRSLETCLGRRAERARDRFDALSARLAPAFARLIAETERASRRDA 422

Query: 417 HTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQK 476
            T +  L  R++     ++      +    R+ Q+  Y+ TLKRGY  ++  +   +T K
Sbjct: 423 AT-LGTLAARLDAAPEARLARLSDRLEALDRLRQTLGYRETLKRGYAVVR-ADGAVLTTK 480

Query: 477 RNLATKTRILINFFDGQANAIVINKAPPKEQPTKKCQL 514
                   + I F DG+ +        PKE+P  +  L
Sbjct: 481 AEAGAAAMLEIEFQDGRLSVGRGKTRKPKEEPPAQGSL 518


>gi|149914435|ref|ZP_01902966.1| exodeoxyribonuclease VII, large subunit [Roseobacter sp. AzwK-3b]
 gi|149811954|gb|EDM71787.1| exodeoxyribonuclease VII, large subunit [Roseobacter sp. AzwK-3b]
          Length = 530

 Score =  374 bits (961), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 197/539 (36%), Positives = 307/539 (56%), Gaps = 33/539 (6%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           +P   +N+   PE+SVSE+S  +K ++E   +H+ V+GE+ G      SGH Y  LKD+ 
Sbjct: 7   DPMEGENA---PEFSVSEISGAVKRVIEGEFAHIRVKGEV-GRVSRPRSGHVYLDLKDDR 62

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           S +  +IWKG  +++   PEEG+E +  G++TTFPG S+YQI+IE + P+G G L+  LE
Sbjct: 63  SVLAGVIWKGVASRLSVQPEEGMEVVATGRLTTFPGQSRYQIVIEDIKPAGMGALMAMLE 122

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           KRK +L  EGLF+ + K P+P++P++I V+TSP+GAVIRDIL R+  RFP +V+I+PV V
Sbjct: 123 KRKTQLAAEGLFAPERKRPLPYLPEVIGVVTSPSGAVIRDILHRLRDRFPRKVLIWPVAV 182

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QG++C  E+  AI   N L  G   PRPD++I+ARGGGSIEDLW FN+E +VRA A S I
Sbjct: 183 QGEKCAPEVTRAIQGFNRLSPGGALPRPDLLIVARGGGSIEDLWGFNEESVVRAAAASEI 242

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETD TL D+AAD RAPTPT AAE+AVPV+  L + +   EAR+ + +   + 
Sbjct: 243 PLISAVGHETDTTLIDFAADQRAPTPTAAAELAVPVRMDLLAWVDKQEARMTHALTSGVT 302

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRL----DRLPRELEHNLEIIIFRKYRHFNHIINRI 357
            +   L  L +ALP  ++ L   R RL    DRLP  L   ++    R+ R F      +
Sbjct: 303 ARGQRLRDLARALPRPERLLDTPRQRLDAWSDRLPAALTRTVQA---RRVRLF-EASGAL 358

Query: 358 KSDFLIHNIQKNRQHILEKQQHIEQIVKQHL---RYIFLEKKEKIAILHMLREQTKNRIF 414
           +   L   +   R+  L  +  +   +++ +   R     + +++++  + R+     I 
Sbjct: 359 RPGALQSRLASRREMFLSWEARLAPALQRMVDRKRETLDRRLDRLSLRPIERD-----IA 413

Query: 415 YLHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFIT 474
                + ++  R+      +++     ++   R+ ++  YK TL+RGY  ++   +   T
Sbjct: 414 RKSEQLDRVARRLSDAGDRQLRGWRERINAMDRLRETLGYKATLQRGYAVVRGDGDVVTT 473

Query: 475 QKRNLATKTRILINFFDGQANAIVINKAPPK---------EQPTKKCQLHNNKREKQGT 524
           +   L  +  + I F DG+   + +  AP           E+P KK     +    QG+
Sbjct: 474 RAAALGAQA-LEIEFADGR---MPVGGAPDDGAAQDRTLAEKPVKKPGKRPSDPPDQGS 528


>gi|307941763|ref|ZP_07657118.1| exodeoxyribonuclease VII, large subunit [Roseibium sp. TrichSKD4]
 gi|307775371|gb|EFO34577.1| exodeoxyribonuclease VII, large subunit [Roseibium sp. TrichSKD4]
          Length = 524

 Score =  374 bits (961), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 212/522 (40%), Positives = 305/522 (58%), Gaps = 13/522 (2%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           E+SVSE+S+ +K  +E    +V VRGE+ G      SGH Y  LKD  + +  +IW+G  
Sbjct: 10  EFSVSEISFSIKRAMEDTFGYVRVRGEL-GRISRPGSGHIYLDLKDERAVLSGVIWRGVA 68

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
           +K++  PE+G+E +  GKITTFPG SKYQ++I+SL P+G+G L+  LE+RKKKL  EGLF
Sbjct: 69  SKLKIQPEQGLEVIATGKITTFPGQSKYQMVIDSLEPAGAGALMALLEERKKKLAAEGLF 128

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
           S++ K  +P +P++I V+TSPTGAVIRDIL RIS RFPL V+++PV+VQG+    E+AN 
Sbjct: 129 SEERKQRLPHLPRVIGVVTSPTGAVIRDILHRISDRFPLHVLVWPVRVQGETSGAEVANG 188

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N+L+ G   PRPD+I++ARGGGSIEDLW FN+E +VRA A S IP+ISA+GHETDW
Sbjct: 189 IRGFNSLQAGGPIPRPDLIVVARGGGSIEDLWGFNEEAVVRAAAASEIPLISAVGHETDW 248

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D AADLRAPTPTGAAE+AVPVK  L + + +L  RL + + R I  +   L +   A
Sbjct: 249 TLIDLAADLRAPTPTGAAEIAVPVKAELLALVDDLSRRLYSGLNRSIANRRTELRAAGAA 308

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRH-FNHIINRIKSDFLIHNIQKNRQH 372
           LP     L+  R R D     LE  L I+  R +R  F+ +  R+    L   +      
Sbjct: 309 LPAPRDLLALPRQRFDTAAGSLERAL-IVNTRSHRSGFDGVSARLSPLLLTRGLSHAHDR 367

Query: 373 ---ILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEF 429
              ++++Q    Q+  Q  R  +     ++     LR+Q+   +      +K L  R++ 
Sbjct: 368 LTALVDRQSRALQVTVQSKRQTYSAVASRLTP-DRLRQQSALGL----ERLKTLSERMDR 422

Query: 430 ILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINF 489
              +++      +    ++L S +YK  L RGY  ++D +   +    ++    +++I  
Sbjct: 423 AYGNRLAQDKARLDGLDKLLNSLSYKEVLSRGYAVVRDKSGTPVRSATDVPAGEKLVIEL 482

Query: 490 FDG--QANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
            DG   A A+  N A   E+   K      K  K  TQG LF
Sbjct: 483 SDGLIDAMAVSANSASKTEKKAPKKPAAKPKNNKPETQGNLF 524


>gi|90426092|ref|YP_534462.1| exodeoxyribonuclease VII large subunit [Rhodopseudomonas palustris
           BisB18]
 gi|90108106|gb|ABD90143.1| Exodeoxyribonuclease VII large subunit [Rhodopseudomonas palustris
           BisB18]
          Length = 541

 Score =  374 bits (961), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 201/491 (40%), Positives = 294/491 (59%), Gaps = 6/491 (1%)

Query: 11  DHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           + PE++V+ELS  LK  VE    HV VRGEISG+RG HSSGH YF+LKD  ++I+A+IWK
Sbjct: 10  NSPEFTVTELSSALKRTVEDAYGHVRVRGEISGFRGPHSSGHCYFALKDEGAKIEAVIWK 69

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           G   ++ F P+EG+E +  GK+TT+PGSSKYQI+IE++ P+G G L+  +E+RK+KL  E
Sbjct: 70  GVHGRMRFKPQEGLEVIATGKLTTYPGSSKYQIVIEAIEPAGIGALMALMEERKRKLGAE 129

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEI 190
           GLF +  K  +P++P++I V+TSPTGAVIRDIL R+  RFP RV+++PVKVQGD   ++I
Sbjct: 130 GLFDEARKQLLPYLPEVIGVVTSPTGAVIRDILHRLQDRFPRRVLVWPVKVQGDGSAEQI 189

Query: 191 ANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHE 250
           A AI   N L EG + PRPD++I+ARGGGS+EDLW FN+E++VRA A+S IP+ISA+GHE
Sbjct: 190 AAAIHGFNALPEGGSIPRPDLLIVARGGGSLEDLWSFNEEIVVRAAADSMIPLISAVGHE 249

Query: 251 TDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSL 310
           TD TL D+AAD RAPTPT AAEMAVPV+  L   +  L  R      R  + + + L + 
Sbjct: 250 TDITLIDFAADKRAPTPTAAAEMAVPVRAELFVEVGQLGHRAMLCFQRGQERRRSELRAA 309

Query: 311 LKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNR 370
            +ALP++   L+  R RLD     L   L       +R F      +    L   +    
Sbjct: 310 TRALPSAAALLAIPRQRLDGAAAALPRALRANSHAHHRRFATACAGLTLKVLRAQVAHAT 369

Query: 371 QHILEKQQHIEQIVKQHL-----RYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLIT 425
           Q +    + ++   +  L     R+  L+ + K + L  ++ Q K  +       ++L  
Sbjct: 370 QRLAVNGERLKHCARAGLRHRRDRFAALDARFKASKLANVQAQRKA-LARDRERTQRLAE 428

Query: 426 RIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRI 485
           R    L   ++     V+   ++L + +Y+  L RG+  ++D     +     +    R+
Sbjct: 429 RARRALLIALQRQQARVASCGQLLGALSYRGVLARGFALVRDAQGLAVHAAAAIDPGARL 488

Query: 486 LINFFDGQANA 496
            + F DG+  A
Sbjct: 489 SLEFADGRIGA 499


>gi|221638251|ref|YP_002524513.1| exodeoxyribonuclease VII large subunit [Rhodobacter sphaeroides
           KD131]
 gi|254783706|sp|B9KM14|EX7L_RHOSK RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|221159032|gb|ACM00012.1| Exodeoxyribonuclease 7 large subunit [Rhodobacter sphaeroides
           KD131]
          Length = 519

 Score =  374 bits (961), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 197/518 (38%), Positives = 291/518 (56%), Gaps = 11/518 (2%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           +P   +N+   PE++VSELS  +K ++E     V VRGEI G     +SGH YF LKD+ 
Sbjct: 7   DPAPSRNT---PEFTVSELSGAVKRVIEGEFGLVRVRGEI-GRVSRPASGHLYFDLKDDR 62

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           + + AI WKG   ++   PEEG+E +  G++TTFPG SKYQII+E + P+G+G L+  LE
Sbjct: 63  AVMAAICWKGQAGRLSVRPEEGMEVVATGRMTTFPGQSKYQIIVEDMAPAGAGALMAMLE 122

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           KR+  L  EGLF    K P+P++P++I V+TSP+GAVIRDIL R+  RFP  V+I+PV V
Sbjct: 123 KRRAALAAEGLFDAARKRPLPYLPRVIGVVTSPSGAVIRDILHRLRDRFPSHVLIWPVAV 182

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QG++C  E+A AI   N L EG   PRPD++I+ARGGGS+EDLW FN+E++VRA A S I
Sbjct: 183 QGEKCAPEVAAAIRGFNALPEGGPIPRPDLLIVARGGGSLEDLWGFNEEIVVRAAAESRI 242

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETD TL D+AAD RAPTPT AAEMAVPV+  L + L    ARL+      I+
Sbjct: 243 PLISAVGHETDTTLIDHAADRRAPTPTAAAEMAVPVRLELLAGLDGQGARLSRCAAETIR 302

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            +   L  L +ALP  +  ++    R D     L   L   +  +      +   ++   
Sbjct: 303 RRDQRLRDLARALPRLESLVAGPSQRFDLWSGRLSGALGQSVAARRARLEPLGAHLRPRL 362

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHL-----RYIFLEKKEKIAILHMLREQTKNRIFYL 416
           L   + + +  + ++ + +E  + +       R+  L  +   A   ++ E T+      
Sbjct: 363 LADLVARQKDRLGDRTRSLETCLGRRAERARDRFEALSARLAPAFARLIAE-TERATRRD 421

Query: 417 HTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQK 476
              +  L  R++     ++      +    R+ Q+  Y+ TLKRGY  ++  +   +T K
Sbjct: 422 AATLGTLAARLDAAPEARLARLSDRLEALDRLRQTLGYRETLKRGYAVVR-ADGAVVTTK 480

Query: 477 RNLATKTRILINFFDGQANAIVINKAPPKEQPTKKCQL 514
               T   + I F DG+ +        PKE+P  +  L
Sbjct: 481 AEAGTAAVLEIEFQDGRLSVGRGKTRKPKEEPPAQGSL 518


>gi|254473566|ref|ZP_05086962.1| exodeoxyribonuclease VII, large subunit [Pseudovibrio sp. JE062]
 gi|211957278|gb|EEA92482.1| exodeoxyribonuclease VII, large subunit [Pseudovibrio sp. JE062]
          Length = 510

 Score =  374 bits (960), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 194/496 (39%), Positives = 287/496 (57%), Gaps = 52/496 (10%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           EY+VSE+S  +K  +E    ++ VRGE+ G     +SGH Y  +KD+ + +  IIW+G  
Sbjct: 9   EYTVSEISGDIKRELEDKFGYIRVRGEL-GRVSRPASGHIYLDVKDDKAVLSGIIWRGNA 67

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
           ++++  PE+G+E +  GKITTFPG SKYQ++I+SL P+G+G L+  LE+RK+KL  EGLF
Sbjct: 68  SRLKVQPEQGLEVIATGKITTFPGQSKYQMVIDSLEPAGAGALMALLEERKRKLAAEGLF 127

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
           +++ K  +P +P++I V+TSPTGAVIRDIL RIS RFPL V+++PV+VQG+ C  E+A  
Sbjct: 128 AEERKVALPRMPRVIGVVTSPTGAVIRDILHRISDRFPLHVLVWPVRVQGETCGSEVAAG 187

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N L+ G   PRPD++I+ARGGGSIEDLW FNDE +VRA A+S IP+ISA+GHETDW
Sbjct: 188 IRGFNALEAGGAIPRPDVLIVARGGGSIEDLWGFNDEAVVRAAADSQIPLISAVGHETDW 247

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D AAD+RAPTPTGAAE AVPVK  + + + +L  RL+  ++RL++ +   L +   A
Sbjct: 248 TLIDLAADVRAPTPTGAAEFAVPVKAEMTAQVDDLSRRLSTGLLRLVQSRRTELRAASAA 307

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           LP     L+  R R D +   LEH L++                       N Q +R  +
Sbjct: 308 LPAPRDLLALPRQRFDMVAGRLEHGLKM-----------------------NTQIHRNSL 344

Query: 374 LEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSH 433
                     V   LR I LE++           Q + R+  L         R     S+
Sbjct: 345 --------TAVSSGLRPITLERQVA---------QGRERLQVLK-------VRATTAFSN 380

Query: 434 KIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDGQ 493
           +++     +S +  +L S +Y+  ++RGY  ++D N   +   + +     + +    G 
Sbjct: 381 QVQRQRLRLSNSAGLLGSLSYERVIERGYAVVRDENGIPLASAQAVQAGQALKLEMKGGT 440

Query: 494 ANAIV----INKAPPK 505
             A+     +   PP+
Sbjct: 441 VGAVADGGGVTPTPPR 456


>gi|296446110|ref|ZP_06888058.1| exodeoxyribonuclease VII, large subunit [Methylosinus trichosporium
           OB3b]
 gi|296256304|gb|EFH03383.1| exodeoxyribonuclease VII, large subunit [Methylosinus trichosporium
           OB3b]
          Length = 526

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 197/487 (40%), Positives = 279/487 (57%), Gaps = 24/487 (4%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           PE SVSEL+  LK  VE    HV VRGEI+ YRG HSSGH YFSLKD ++R+DA+IWK T
Sbjct: 30  PELSVSELANALKRTVEDRFGHVRVRGEITNYRGPHSSGHVYFSLKDQNARLDAVIWKTT 89

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
             ++   P+EG+E +  GKITTFPG S YQI+I++L P+G+G L+  L++R+K+L  EGL
Sbjct: 90  FFRLRVKPQEGLEVVATGKITTFPGKSSYQIVIDTLEPAGAGALMALLDERRKRLAAEGL 149

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F  + K P+PF+P ++ V+TSPTGAVIRDIL R+  RFP RV+++PV+VQG+ C  E+  
Sbjct: 150 FDAERKRPLPFLPAVVGVVTSPTGAVIRDILHRLLDRFPRRVLVWPVRVQGESCAAEVTA 209

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N L  G   PRPD++I+ARGGGS+EDLW FN+E++VRA A S+IP++SAIGHETD
Sbjct: 210 AIEGFNALPPGGPIPRPDVLIVARGGGSLEDLWGFNEEIVVRAAAASAIPLVSAIGHETD 269

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            TL D+ +DLRAPTPTGAAE  VPV+  L      L  RL+    RL+      L SL +
Sbjct: 270 TTLIDFVSDLRAPTPTGAAEKCVPVRAELIEQTAVLARRLSGAERRLLDAHRRHLVSLQR 329

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYR---HFNHIINRIKSDFLIHNIQKN 369
            LP   Q L     R DR    L   L   +  +     H  H++ R       H+ Q  
Sbjct: 330 VLPAGPQLLMHPFQRSDRAGERLRAALRRALDARRLRLSHLTHVLAR-------HSPQAE 382

Query: 370 RQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEF 429
                E+ + +   ++Q L         ++A+     +  + R+ +    ++    RI  
Sbjct: 383 LARASERLKGLHARLRQGL-------SARMALARREADGAQRRVDHAEQRLRSAYFRI-- 433

Query: 430 ILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINF 489
                I      +    ++ +   Y++ L RG+  ++D     +   R++     + I F
Sbjct: 434 -----IADRQARLDRLDQLRRMLGYESVLARGFALVRDEQGTVLRLARDVTPGMAMAIQF 488

Query: 490 FDGQANA 496
            D    A
Sbjct: 489 ADSAVRA 495


>gi|332560275|ref|ZP_08414597.1| exodeoxyribonuclease VII large subunit [Rhodobacter sphaeroides
           WS8N]
 gi|332277987|gb|EGJ23302.1| exodeoxyribonuclease VII large subunit [Rhodobacter sphaeroides
           WS8N]
          Length = 519

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 197/518 (38%), Positives = 291/518 (56%), Gaps = 11/518 (2%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           +P   +N+   PE++VSELS  +K ++E     V VRGEI G     +SGH YF LKD+ 
Sbjct: 7   DPAPSRNT---PEFTVSELSGAVKRVIEGEFGLVRVRGEI-GRVSRPASGHLYFDLKDDR 62

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           + + AI WKG   ++   PEEG+E +  G++TTFPG SKYQII+E + P+G+G L+  LE
Sbjct: 63  AVMAAICWKGQAGRLSVRPEEGMEVVATGRMTTFPGQSKYQIIVEDMAPAGAGALMAMLE 122

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           KR+  L  EGLF    K+P+PF+P++I V+TSP+GAVIRDIL R+  RFP  V+I+PV V
Sbjct: 123 KRRAALAAEGLFDAARKHPLPFLPRVIGVVTSPSGAVIRDILHRLRDRFPSHVLIWPVAV 182

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QG++C  E+A AI   N L EG   PRPD++I+ARGGGS+EDLW FN+E++VRA A S I
Sbjct: 183 QGEKCAPEVAAAIRGFNALPEGGPIPRPDLLIVARGGGSLEDLWGFNEEIVVRAAAESRI 242

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETD TL D+AAD RAPTPT AAEMAVPV+  L + L    ARL+      I+
Sbjct: 243 PLISAVGHETDTTLIDHAADRRAPTPTAAAEMAVPVRLELLAGLDGQGARLSRCAAETIR 302

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            +   L  L +ALP  +  ++    R D     L   L   +  +      +   ++   
Sbjct: 303 RRDQRLRDLARALPRLESLVAGPSQRFDLWSGRLSGALGQSVAARRARLEPLGAHLRPRL 362

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHL-----RYIFLEKKEKIAILHMLREQTKNRIFYL 416
           L   + + +  + ++ + +E  + +       R+  L  +   A   ++ E T+      
Sbjct: 363 LADLVARQKDRLGDRTRSLETCLGRRAERARDRFDALSARLAPAFARLIAE-TERATRRD 421

Query: 417 HTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQK 476
              +  L  R++     ++      +    R+ Q+  Y+ TLKRGY  ++  +   +T K
Sbjct: 422 AATLGTLAARLDAAPEARLARLSDRLEALDRLRQTLGYRETLKRGYAVVR-ADGAVLTTK 480

Query: 477 RNLATKTRILINFFDGQANAIVINKAPPKEQPTKKCQL 514
                   + I F DG+ +        PKE+P  +  L
Sbjct: 481 AEAGAAAMLEIEFQDGRLSVGRGKTRKPKEEPPAQGSL 518


>gi|77462391|ref|YP_351895.1| exodeoxyribonuclease VII large subunit [Rhodobacter sphaeroides
           2.4.1]
 gi|123757775|sp|Q3J5E0|EX7L_RHOS4 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|77386809|gb|ABA77994.1| Exodeoxyribonuclease VII large subunit [Rhodobacter sphaeroides
           2.4.1]
          Length = 519

 Score =  372 bits (956), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 197/518 (38%), Positives = 291/518 (56%), Gaps = 11/518 (2%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           +P   +N+   PE++VSELS  +K ++E     V VRGEI G     +SGH YF LKD+ 
Sbjct: 7   DPAPSRNT---PEFTVSELSGAVKRVIEGEFGLVRVRGEI-GRVSRPASGHLYFDLKDDR 62

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           + + AI WKG   ++   PEEG+E +  G++TTFPG SKYQII+E + P+G+G L+  LE
Sbjct: 63  AVMAAICWKGQAGRLSVRPEEGMEVVATGRMTTFPGQSKYQIIVEDMAPAGAGALMAMLE 122

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           KR+  L  EGLF    K+P+PF+P++I V+TSP+GAVIRDIL R+  RFP  V+I+PV V
Sbjct: 123 KRRAALAAEGLFDAARKHPLPFLPRVIGVVTSPSGAVIRDILHRLRDRFPSHVLIWPVAV 182

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QG++C  E+A AI   N L EG   PRPD++I+ARGGGS+EDLW FN+E++VRA A S I
Sbjct: 183 QGEKCAPEVAAAIRGFNALPEGGPIPRPDLLIVARGGGSLEDLWGFNEEIVVRAAAESRI 242

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETD TL D+AAD RAPTPT AAEMAVPV+  L + L    ARL+      I+
Sbjct: 243 PLISAVGHETDTTLIDHAADRRAPTPTAAAEMAVPVRLELLAGLDGQVARLSRCAAETIR 302

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            +   L  L +ALP  +  ++    R D     L   L   +  +      +   ++   
Sbjct: 303 RRDQRLRDLARALPRLESLVAGPSQRFDLWSGRLSGALGQSVAARRARLEPLGAHLRPRL 362

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHL-----RYIFLEKKEKIAILHMLREQTKNRIFYL 416
           L   + + +  + ++ + +E  + +       R+  L  +   A   ++ E T+      
Sbjct: 363 LADLVARQKDRLGDRTRSLETCLGRRAERARDRFDALSARLAPAFARLIAE-TERATRRD 421

Query: 417 HTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQK 476
              +  L  R++     ++      +    R+ Q+  Y+ TLKRGY  ++  +   +T K
Sbjct: 422 AATLGTLAARLDAAPEARLARLSDRLEALDRLRQTLGYRETLKRGYAVVR-ADGAVLTTK 480

Query: 477 RNLATKTRILINFFDGQANAIVINKAPPKEQPTKKCQL 514
                   + I F DG+ +        PKE+P  +  L
Sbjct: 481 AEAGAAAMLEIEFQDGRLSVGRGKTRKPKEEPPAQGSL 518


>gi|114763003|ref|ZP_01442433.1| exodeoxyribonuclease VII, large subunit [Pelagibaca bermudensis
           HTCC2601]
 gi|114544327|gb|EAU47335.1| exodeoxyribonuclease VII, large subunit [Roseovarius sp. HTCC2601]
          Length = 510

 Score =  372 bits (954), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 196/490 (40%), Positives = 281/490 (57%), Gaps = 33/490 (6%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           ++ + PE+SVSELS  +K  +E    HV V+GE+ G      SGH Y  LKD+ S I  +
Sbjct: 7   DTGNTPEFSVSELSGAVKRTIEGEFGHVRVKGEV-GRVSRPRSGHIYLDLKDDRSVISGV 65

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +WKG   ++E  PEEG+E +  G++TTFPG SKYQI+IE + P+G G L+  LEKRK +L
Sbjct: 66  VWKGVSARLETQPEEGMEVVATGRLTTFPGQSKYQIVIEDIRPAGLGALMAMLEKRKAQL 125

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECP 187
             EGLF    K P+P++P+II V+TSP+GAVIRDIL R+  RFP +V+I+PV VQG  C 
Sbjct: 126 QAEGLFDPARKQPLPYLPEIIGVVTSPSGAVIRDILHRLRDRFPRKVLIWPVAVQGKSCA 185

Query: 188 KEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAI 247
            E+A AI   N L  G   PRPD++I+ARGGGS+EDLW FN+E++ RA A S IP+ISA+
Sbjct: 186 PEVARAIEGFNALSPGGAMPRPDLLIVARGGGSVEDLWGFNEEIVARAAAASDIPLISAV 245

Query: 248 GHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTL 307
           GHETD TL DY +D RAPTP+ AAE+AVPV+  L        AR+   + + I+ +   L
Sbjct: 246 GHETDTTLIDYVSDRRAPTPSAAAEIAVPVRMELLGWTGEAGARMTRAMGQRIELRSQRL 305

Query: 308 NSLLKALPNSDQTLSCSRYRLD----RLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLI 363
             L +ALP ++  L   R RLD    RLPR L    E    ++    +     ++   L 
Sbjct: 306 RDLSRALPRAETLLDQPRQRLDLLGERLPRGLIRGTE----QRRVVLSDAAGALRPSLLS 361

Query: 364 HNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKL 423
             I   R+ +  +   +       LR I  E +           Q + R+  L   + + 
Sbjct: 362 RVIAHGRESLGRRTDRL------SLRPIEREMR-----------QGRERLATLTRRLDEA 404

Query: 424 ITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKT 483
            TR       ++++   ++   TR+L++ +YK TL+RGY  ++   N  +T+K       
Sbjct: 405 GTR-------RLETPRGTLDGLTRLLETLSYKGTLQRGYAVVRSGENEILTRKSAAEAAA 457

Query: 484 RILINFFDGQ 493
            + I F DG+
Sbjct: 458 SLEIEFADGR 467


>gi|83955626|ref|ZP_00964206.1| exodeoxyribonuclease VII, large subunit [Sulfitobacter sp.
           NAS-14.1]
 gi|83839920|gb|EAP79096.1| exodeoxyribonuclease VII, large subunit [Sulfitobacter sp.
           NAS-14.1]
          Length = 515

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 199/528 (37%), Positives = 294/528 (55%), Gaps = 42/528 (7%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           +P   +NS   PE++V+ELS  +K ++E    HV +RGE+ G      SGH Y  LKD+ 
Sbjct: 30  DPREGQNS---PEFTVTELSGAIKRVIEGEFGHVRIRGEV-GRVSRPRSGHIYLDLKDDS 85

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           S I  +IWKG   ++E  PEEG+E +  G+ITTF G SKYQI+IE + P+G G L+  LE
Sbjct: 86  SVISGVIWKGVSARLETQPEEGMEVIATGRITTFGGQSKYQIVIEDIKPAGMGALMALLE 145

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           KRK  L  EGLF+ + K P+P++P++I V+TSP+GAVIRDIL R+  RFP +V+I+PV V
Sbjct: 146 KRKAVLAAEGLFAPERKRPLPYLPEVIGVVTSPSGAVIRDILHRLRDRFPRKVLIWPVAV 205

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QG +C  E+A AI   N L  G   PRPD++I+ARGGGS+EDLW FN+E++ RA A S I
Sbjct: 206 QGAKCAPEVARAIAGFNALTPGGALPRPDLLIVARGGGSVEDLWGFNEEIVARAAAASEI 265

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETD TL DY +D RAPTPT AAE+AVPV+  L + L   EAR+   + + + 
Sbjct: 266 PLISAVGHETDTTLIDYVSDKRAPTPTAAAELAVPVRHELVALLDGQEARMTQALSQGLA 325

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            +   L  + +ALP  D  L   R RLD     L   L   + ++  H + I   ++   
Sbjct: 326 RRDQRLRDMARALPRPDSLLDGPRQRLDMRGARLGPALTAGVQKRKVHLSDISGALRPAT 385

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIK 421
           L  ++Q        +Q+ +  +  +      ++ +++           K   F      +
Sbjct: 386 LRRSLQA-------EQRRLAALADRFRPDALVQDRKR-----------KEEAF------Q 421

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLAT 481
            L  R+      + +  H  ++   R+ +  +YK+TL RGY  ++  +   +T K+    
Sbjct: 422 SLARRLSDAGQRQTQGWHKQIAGLDRLHEMLSYKSTLARGYAVVR-GDGGVVTTKQAALD 480

Query: 482 KTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
            + + I F DG+    +   A PK+ P K  +           QG LF
Sbjct: 481 ASALEIEFIDGKMK--ISGGAAPKKTPKKAPE-----------QGSLF 515


>gi|149202158|ref|ZP_01879131.1| exodeoxyribonuclease VII, large subunit [Roseovarius sp. TM1035]
 gi|149144256|gb|EDM32287.1| exodeoxyribonuclease VII, large subunit [Roseovarius sp. TM1035]
          Length = 495

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 190/485 (39%), Positives = 283/485 (58%), Gaps = 36/485 (7%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           PE+SVS+LS  +K ++E   SHV VRGE+ G      SGH Y  LKD+ + +  IIWKG 
Sbjct: 15  PEFSVSDLSGAIKRMIEGEFSHVRVRGEL-GRISRPRSGHIYLDLKDDSAVLAGIIWKGV 73

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
             ++   PEEG+E +  G++TTFPG S+YQIIIE + P+G G L+  LEKRK  L  EGL
Sbjct: 74  ATRLAVQPEEGMEVVATGRLTTFPGQSRYQIIIEDMKPAGMGALMAMLEKRKAALAAEGL 133

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F+ + K  +P++P+II V+TSP+GAVIRDIL R+  RFP +V+I+PV VQGD+C  E+A 
Sbjct: 134 FASERKQALPYLPEIIGVVTSPSGAVIRDILHRLRDRFPRKVLIWPVAVQGDKCAAEVAR 193

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N +  G   PRPD+II+ARGGGS+EDLW FN+E++VRA A S+IP+ISA+GHETD
Sbjct: 194 AIRGFNAMTPGGALPRPDLIIVARGGGSVEDLWGFNEEIVVRAAAESAIPLISAVGHETD 253

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            TL D+A+D RAPTPT AAE+AVPV+  L + +    ARL++ + + ++ +   L  L +
Sbjct: 254 TTLIDFASDKRAPTPTAAAELAVPVRMDLLAWVEGQGARLSHALSQGVRLRGQRLRDLAR 313

Query: 313 ALPNSDQTLSCSRYRLD----RLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQK 368
           ALP ++  L   R RLD    RLP  L  ++++    +  H +     ++   L   ++ 
Sbjct: 314 ALPRAEVLLDGPRQRLDALGERLPAALIRSVQV----RRVHLSETAGALRPALLRRAVEG 369

Query: 369 NRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNR-IFYLHTHIKKLITRI 427
           +R+ +      +                     +H L     NR I      + ++  R+
Sbjct: 370 DRRRLQATAARLN--------------------VHAL-----NRDIAQKRRDLDQVSARL 404

Query: 428 EFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILI 487
             +   +++     ++   R+ ++  YK TL RGY  ++  +   +T +   A    + I
Sbjct: 405 SDVAGRQVRGWQDRLAALERLRETLGYKATLSRGYAVVR-GDGAVMTTRAAAAGAAALQI 463

Query: 488 NFFDG 492
            F DG
Sbjct: 464 EFADG 468


>gi|148253225|ref|YP_001237810.1| exodeoxyribonuclease VII large subunit [Bradyrhizobium sp. BTAi1]
 gi|146405398|gb|ABQ33904.1| Exodeoxyribonuclease VII large subunit [Bradyrhizobium sp. BTAi1]
          Length = 536

 Score =  368 bits (944), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 202/499 (40%), Positives = 297/499 (59%), Gaps = 40/499 (8%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           PE++VSELS  LK  VE    HV VRGEI+G+RG HSSGH YF+LKD  ++I+A+IWKG 
Sbjct: 11  PEFTVSELSSALKRTVEDQFGHVRVRGEITGFRGPHSSGHCYFALKDESAKIEAVIWKGV 70

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
             ++ F P+EG+E +  GK+TT+P SSKYQI+IE+L P+G G L+  +E+RK+KL  EGL
Sbjct: 71  HGRMRFKPQEGLEVIATGKLTTYPNSSKYQIVIEALEPAGIGALMALMEERKRKLGAEGL 130

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F    K  +P++P++I V+TSPTGAVIRDIL R+  RFP  V+++PVKVQG+   +++A 
Sbjct: 131 FDPARKQLLPWLPEVIGVVTSPTGAVIRDILHRLEDRFPRHVLVWPVKVQGEGSAEQVAA 190

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N L E    PRPD++I+ARGGGS+EDLW FN+E++VRA A S IP+ISA+GHETD
Sbjct: 191 AIRGFNDLPEDGPIPRPDVLIVARGGGSLEDLWSFNEEIVVRAAAESMIPLISAVGHETD 250

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            TL D+AAD RAPTPT AAEMAVPV+  L   + +L  R++    R  + + N L +  +
Sbjct: 251 VTLIDFAADKRAPTPTAAAEMAVPVRSELMQEVASLARRVSVCWQRSQEGRRNELRAAAR 310

Query: 313 ALPNSDQTLSCSRYRLD----RLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQK 368
           ALP + + L+  R RLD     LPR L+ N  +     +R F     ++    L   I +
Sbjct: 311 ALPGAAELLAIPRQRLDSAAASLPRALKTNTNV----HFRQFAAASAKLTLRVLHGQIAQ 366

Query: 369 NRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQ--------TKNRIFYLHTH- 419
               ++   + +    +              A+LH  RE+          +R+ Y     
Sbjct: 367 ADHRLIVSSERLSLSAR--------------ALLHRRRERFEALDARFKASRLAYAQAKR 412

Query: 420 --IKKLITRIEFILSHKIKSCHTSVS-ITTRI------LQSFAYKNTLKRGYTSIQDTNN 470
             I++   R E +     ++  TS+S ++ R+      L + +Y++ L RG+  ++D   
Sbjct: 413 QAIERERDRTERLADRAARALATSISRLSARVDHAGQLLAALSYRSVLARGFALVRDDAG 472

Query: 471 NFITQKRNLATKTRILINF 489
           + + Q  ++     + I F
Sbjct: 473 HPLHQAASIGPNAALSIEF 491


>gi|163746079|ref|ZP_02153438.1| exodeoxyribonuclease VII, large subunit, putative [Oceanibulbus
           indolifex HEL-45]
 gi|161380824|gb|EDQ05234.1| exodeoxyribonuclease VII, large subunit, putative [Oceanibulbus
           indolifex HEL-45]
          Length = 524

 Score =  366 bits (940), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 196/523 (37%), Positives = 296/523 (56%), Gaps = 26/523 (4%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           +P    NS   PE++V+ELS  +K ++E   +HV +RGE+ G      SGH Y  LKD+ 
Sbjct: 6   DPAPGANS---PEFTVTELSGAIKRVIEGEFAHVRIRGEV-GRVSRPRSGHVYLDLKDDR 61

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           S I  +IWKG   ++E  PEEG+E +  G+ITTF G SKYQI+IE + P+G G L+  LE
Sbjct: 62  SVISGVIWKGVTARLETQPEEGMEVIATGRITTFGGQSKYQIVIEDIKPAGMGALMALLE 121

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           KRK  L  EGLF+ + K P+P++P+II V+TSP+GAVIRDIL R+  RFP +V+I+PV V
Sbjct: 122 KRKAALAAEGLFAPERKRPLPYLPEIIGVVTSPSGAVIRDILHRLRDRFPRKVLIWPVAV 181

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QG +C  E+  AI   N L  G   PRPD++I+ARGGGS+EDLW FN+E +VRA A S I
Sbjct: 182 QGAKCAPEVVRAIEGFNRLTPGGALPRPDLLIVARGGGSVEDLWGFNEESVVRAAAASDI 241

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETD TL D+ +D RAPTPT AAE+AVPV+  L + L    AR+   + + + 
Sbjct: 242 PLISAVGHETDTTLIDFVSDKRAPTPTAAAELAVPVRHELAAWLEGQGARMRQALSQGLT 301

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            +   +  + +ALP +D  L   R RLDR   +L   L   +  +     H+   ++   
Sbjct: 302 RRGQRMRDVARALPRADTLLEGPRQRLDRGGEKLAPALIAGVQGRRVKLAHMSGALRPGT 361

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHL--RYIFLE-----------KKEKIAILHMLREQ 408
           L  ++  +RQ +      ++   +++L  R  FL+           +++ +     L ++
Sbjct: 362 LRRHLDADRQRLANLSARLDPAWQRNLKGRNDFLKTRLDRFHPEVLQRQILRRRERLADR 421

Query: 409 TKN-RIFYLHTHIKKLITRIEFILSHKIKSCHTS-------VSITTRILQSFAYKNTLKR 460
           T+N R   L   + +   R+  +L+   ++   +       +    R L +  Y+ TL R
Sbjct: 422 TQNFRPEVLSRDLARQDQRLTEVLARLARAGQAAQDRRRRQIDALGRTLGTLGYRETLAR 481

Query: 461 GYTSIQDTNNNFITQKRNLATKTRILINFFDGQANAIVINKAP 503
           G+  ++  + N +T      + TR+ I F D +   +    AP
Sbjct: 482 GFAVVR-GDGNVVTSAEAAKSATRLEIEFADDRLEVLHKEDAP 523


>gi|89055791|ref|YP_511242.1| exodeoxyribonuclease VII large subunit [Jannaschia sp. CCS1]
 gi|88865340|gb|ABD56217.1| Exodeoxyribonuclease VII large subunit [Jannaschia sp. CCS1]
          Length = 519

 Score =  366 bits (940), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 189/495 (38%), Positives = 285/495 (57%), Gaps = 14/495 (2%)

Query: 4   FSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSR 63
              + + + PE++VSE+S  +K  VE   +HV VRGE+ G   +  SGH Y  LKD+ S 
Sbjct: 5   IDDEGTGNSPEFTVSEISGAVKRTVEGAFAHVRVRGEV-GRLSLPRSGHIYLDLKDDRSV 63

Query: 64  IDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKR 123
           + +++WKG  N++   PEEG+E +  G++TTFPG SKYQ++I+ L P+G+G L+  LEKR
Sbjct: 64  LASVVWKGVANRLTHRPEEGMEVIATGRLTTFPGQSKYQLVIDDLQPAGAGALMAMLEKR 123

Query: 124 KKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQG 183
           +K L  EGLF D  K P+PF+P++I V+TSP+GAVIRDIL R+  RFP +V+I+PV VQG
Sbjct: 124 RKALAAEGLFDDARKQPLPFLPEVIGVVTSPSGAVIRDILHRLRDRFPRKVLIWPVAVQG 183

Query: 184 DECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPI 243
            +C  ++ANAI   N L  G   PRPD++I+ARGGGS+EDLW FN+E +VRA A+S+IP+
Sbjct: 184 AKCGPDVANAIRGFNALTPGGALPRPDLLIVARGGGSLEDLWGFNEEEVVRATADSTIPL 243

Query: 244 ISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYK 303
           ISA+GHETD TL DYA+D RAPTPTGAAE AVPV+  + + L   E  L   +   +  +
Sbjct: 244 ISAVGHETDTTLIDYASDYRAPTPTGAAEKAVPVRMDMLNWLRQQEGILTRAMTGALTMR 303

Query: 304 INTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLI 363
              L  L +ALP SD  +  +R RLD     L   L           + +  R+    L 
Sbjct: 304 AQRLADLSRALPRSDALMEPARQRLDLAGLRLAPALASRTKDARAQLDRLAARLDP-ALD 362

Query: 364 HNIQKNRQHILEKQ-----QHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHT 418
             + + R  + E+        +  +V+Q  R +     +++ +  +  ++   R   +  
Sbjct: 363 RAVARKRLALGERAAGLTPARLANVVRQGRRDL-----DRLTV-RLDPQRLTARTSKMEE 416

Query: 419 HIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRN 478
            + +   R     +  ++    ++    R+ ++  Y  TL RGY  I+    + +T K  
Sbjct: 417 RLGQARARFAQAANLSVRKRREALDSLDRLRRTLGYTETLGRGYAVIR-AGEDVLTSKAA 475

Query: 479 LATKTRILINFFDGQ 493
            +    + I F DG+
Sbjct: 476 ASAHAAMEIQFSDGR 490


>gi|310815255|ref|YP_003963219.1| exodeoxyribonuclease VII, large subunit [Ketogulonicigenium vulgare
           Y25]
 gi|308753990|gb|ADO41919.1| exodeoxyribonuclease VII, large subunit [Ketogulonicigenium vulgare
           Y25]
          Length = 447

 Score =  365 bits (936), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 188/406 (46%), Positives = 259/406 (63%), Gaps = 17/406 (4%)

Query: 1   MNPFSQKNSLDH-PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKD 59
           M  F  +   D+ PE+SVSELS  +K +VE   +HV VRGE+ G     SSGH Y  LKD
Sbjct: 1   MELFEDEKPKDNAPEFSVSELSGAVKRMVEGEFAHVRVRGEL-GRISRPSSGHIYLDLKD 59

Query: 60  NHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTA 119
           + S + A++WKG   ++   PEEG+E +  G++TTFPG SKYQ+IIE + P+G+G L+  
Sbjct: 60  DRSVLAAVVWKGQAARLSARPEEGLEVIATGRLTTFPGQSKYQMIIEDIAPAGAGALMAR 119

Query: 120 LEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPV 179
           LEK K +L EEGLF    K PIPF+P++I VITSP+GAVIRDIL R+  RFP +VI++PV
Sbjct: 120 LEKLKAQLGEEGLFDPARKKPIPFLPEVIGVITSPSGAVIRDILHRLRDRFPRKVIVWPV 179

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
            VQG     E+A AI   N L  G   PRPD++I+ARGGGS+EDLW FN+E++VRA A S
Sbjct: 180 AVQGQAAAGEVARAIAGFNALTPGGAMPRPDLLIVARGGGSVEDLWAFNEEVVVRAAAAS 239

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
            IP+ISA+GHETD TL DYAAD RAPTPT AAEMAVPV+  L + + +LEAR +  + ++
Sbjct: 240 DIPLISAVGHETDTTLIDYAADRRAPTPTAAAEMAVPVRMDLFAQMQSLEARQSRAMQQV 299

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLD----RLPRELEHNLEIIIFRKYRHF---NH 352
           +  +   L+ L +ALP +D  L+    RLD    RL   L+  ++    R  R+    + 
Sbjct: 300 LTRRGQRLSDLSRALPRADALLAGQAQRLDFAAQRLDAALQTGIDARALRLARNALTPSV 359

Query: 353 IINRIKSDFLIHNIQKNRQH------ILEKQQHIEQI--VKQHLRY 390
           +  RI +D    ++   R        + +K+Q +E I  +++ L Y
Sbjct: 360 LRTRINNDLRTIDVLATRASAATERLMRQKEQAVENIDRLRETLGY 405


>gi|126729213|ref|ZP_01745027.1| exodeoxyribonuclease VII, large subunit [Sagittula stellata E-37]
 gi|126710203|gb|EBA09255.1| exodeoxyribonuclease VII, large subunit [Sagittula stellata E-37]
          Length = 513

 Score =  365 bits (936), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 189/532 (35%), Positives = 300/532 (56%), Gaps = 22/532 (4%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M+      + + PE+SVSELS  +K ++E     V VRGE+ G      SGH Y  LKD+
Sbjct: 1   MDLIDDGTNGNTPEFSVSELSGAVKRVIEGEFGFVRVRGEV-GRVSRPRSGHVYLDLKDD 59

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            S I  ++WKG  ++++  PEEG+E +  G++TTFPG SKYQI++E + P+G+G L+  L
Sbjct: 60  RSVISGVMWKGVASRLQTQPEEGMEVVATGRLTTFPGQSKYQIVLEDIRPAGAGALMAML 119

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           EKRK  L  EGLF    K P+P++P+II V+TSP+GAVIRDIL R+  RFP +V+I+PV 
Sbjct: 120 EKRKAALAAEGLFDAGRKKPLPYLPEIIGVVTSPSGAVIRDILHRLRDRFPRKVLIWPVA 179

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQG  C  E+A AI   N  + G T PRPD++I+ARGGGS+EDLW FN+E++ RA A S 
Sbjct: 180 VQGAACAPEVARAIEGFNRFQPGGTLPRPDLLIVARGGGSVEDLWGFNEEVVARAAAASH 239

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP+ISA+GHETD TL D+ +D RAPTP+ AAE+AVPV+  L + + +  AR+   +   +
Sbjct: 240 IPLISAVGHETDTTLIDFVSDRRAPTPSAAAELAVPVRMELAAQIRDFGARMTRAMGLRV 299

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           +++   L  L +ALP  ++ +   R RLD +   L   L   + R+       +  ++  
Sbjct: 300 EHRGQRLRDLARALPRPEELVEGPRQRLDVMGDRLPAALTRAVDRQRLRLTETVGSLRPA 359

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHL---RYIFLEKKEKIAILHMLREQTKNRIFYLH 417
            L   +   R  + E+   +   + + +   R     +  +++   +LR+    R     
Sbjct: 360 ILRRAVSVERGRMDERSARLGPALARAVKVRRDTLEARAARLSPRAILRDIGTGR----- 414

Query: 418 THIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKR 477
             + +L  R++   + +I+     +    R+ ++ +Y+ TL+RG+  +  +++  +T + 
Sbjct: 415 ERLDRLSQRLDAAQAARIQDTRQRLEALARLAETLSYRATLERGFAVVW-SDSGVVTSRA 473

Query: 478 NLATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
                T + + F DG+   + +  A P  +  K+         K   QG LF
Sbjct: 474 AADEATGLEVEFSDGR---MKLGGAAPARRKAKR---------KPPEQGSLF 513


>gi|254563195|ref|YP_003070290.1| exonuclease VII, large subunit OB-fold nucleic acid binding domain
           [Methylobacterium extorquens DM4]
 gi|254270473|emb|CAX26473.1| putative exonuclease VII, large subunit OB-fold nucleic acid
           binding domain [Methylobacterium extorquens DM4]
          Length = 522

 Score =  363 bits (931), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 208/537 (38%), Positives = 291/537 (54%), Gaps = 67/537 (12%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           PE+SV +L+  LK  +E    HV +RGEI+GYRG H SGHAYFSLKD  ++IDA++WKG 
Sbjct: 33  PEWSVGDLAAALKRTLEDAFGHVRLRGEITGYRGPHGSGHAYFSLKDGSAKIDAVVWKGV 92

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
           L ++   P+EG+E +  GKITTF G S YQI+I+S+ P+G G  +  LE+RK++L  EGL
Sbjct: 93  LGRLRQKPKEGLEVVATGKITTFAGKSSYQIVIDSMEPAGIGAWMALLEERKRQLAAEGL 152

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F    K PIPF+P++I V+TSPTGAVIRDIL R+  RFP  V+++PV+VQG+   +EIA 
Sbjct: 153 FETDRKRPIPFLPRVIGVVTSPTGAVIRDILHRLEDRFPRPVLVWPVRVQGEGAAEEIAA 212

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N L      PRPD++I+ARGGGSIEDLW FN+E +VRA A S IP+ISA+GHETD
Sbjct: 213 AIRGFNALSPDGPIPRPDVLIVARGGGSIEDLWAFNEEAVVRAAAESEIPLISAVGHETD 272

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            TL D+A+D RAPTPTGAAEMAVPV+  L + +  L AR    ++R I+ +     +L++
Sbjct: 273 TTLIDFASDRRAPTPTGAAEMAVPVRAELAAQVHELGARQAGTMLRRIERERADFRALVR 332

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
           A+P +D  L+  R RLD     L   L           N + +R                
Sbjct: 333 AIPGADAFLAVKRQRLDLADARLRPALAANARDSRERLNRVADR---------------- 376

Query: 373 ILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILS 432
            L ++     + +   R   ++ + + A+  ++ E+ ++R+  L                
Sbjct: 377 -LTRRSPAIALAEARARLAAIDHRPRTAMSRIV-ERRRDRLDAL---------------- 418

Query: 433 HKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDG 492
                        T +L + +YK  L RGY  ++D +   +      A   R  + F DG
Sbjct: 419 -------------TSLLGALSYKAVLARGYALVRDADGLPVRSAAAAAQAARFQLQFADG 465

Query: 493 -----------QANAIVINKAP----PKEQPTKKCQLHNNKREK-----QGTQGELF 529
                         A  +  AP    PK  P +       K EK        QG LF
Sbjct: 466 ALFARPEEAPDDPVAPPVADAPPSPRPKRAPRRAAPEPAPKPEKVTAEPAARQGSLF 522


>gi|84515408|ref|ZP_01002770.1| Exonuclease VII, large subunit [Loktanella vestfoldensis SKA53]
 gi|84510691|gb|EAQ07146.1| Exonuclease VII, large subunit [Loktanella vestfoldensis SKA53]
          Length = 499

 Score =  362 bits (929), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 194/496 (39%), Positives = 285/496 (57%), Gaps = 20/496 (4%)

Query: 5   SQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRI 64
           + K++ + PE+SVSE+S  +K  +E   +H+ VRGE+ G     SSGH Y  LKD+ S +
Sbjct: 10  TDKSADNTPEFSVSEISGAVKKTIEGGFAHIRVRGEL-GRISRPSSGHIYLDLKDDRSVL 68

Query: 65  DAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRK 124
             IIWKG    +   PEEG+E +  GK+TTFPG SKYQ+IIE + P+G+G L+  LEKR+
Sbjct: 69  SGIIWKGRATALTHRPEEGMEVIATGKLTTFPGQSKYQMIIEDIQPAGAGALMAMLEKRR 128

Query: 125 KKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGD 184
             L  EGLF    K P+P++P+II V+TSP+GAVIRDIL R+  RFP +V+++PV VQG 
Sbjct: 129 VMLAGEGLFDAARKKPLPYLPEIIGVVTSPSGAVIRDILHRLRDRFPRKVLVWPVAVQGQ 188

Query: 185 ECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPII 244
           +C  E+A AI   N L  G   PRPD+II+ARGGGS+EDLW FN+E++VRA A S IP+I
Sbjct: 189 KCAAEVAAAIDGFNRLTPGGALPRPDLIIVARGGGSLEDLWGFNEEIVVRAAAASDIPLI 248

Query: 245 SAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKI 304
           SA+GHETD TL D+AAD+RAPTPT AAE+AVPV+  L + +    ARL   +   ++ + 
Sbjct: 249 SAVGHETDTTLIDFAADIRAPTPTAAAELAVPVRIELLAFVDQQGARLVRALSNGVQTRR 308

Query: 305 NTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
             L  L +ALP  D      R RLD L   L   L     +K    +     ++   L  
Sbjct: 309 QRLRDLARALPRVDTLADGPRQRLDYLADRLPAALRQAAAQKRLQLSDAA--LRPAILQR 366

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            + ++R+ +      +            L+++ + A + + R     R   L T + +  
Sbjct: 367 RLAEDRRRLSALSDRLAPA---------LQRRSRDAAVTLERAGRGLRCDLLQTRLDRQA 417

Query: 425 TRIEFILSH------KIKSCHTS-VSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKR 477
            R+  +L+       + ++  T+ ++   R+ ++  Y  TLKRGY  ++   +  +T   
Sbjct: 418 ERLSSVLARLSDRATRQQTERTARLAALDRLRETLGYMETLKRGYAVVR-AGDVLVTDTV 476

Query: 478 NLATKTRILINFFDGQ 493
             A    + I F DG+
Sbjct: 477 AAAKADHLEIQFADGR 492


>gi|254485812|ref|ZP_05099017.1| exodeoxyribonuclease VII, large subunit [Roseobacter sp. GAI101]
 gi|214042681|gb|EEB83319.1| exodeoxyribonuclease VII, large subunit [Roseobacter sp. GAI101]
          Length = 491

 Score =  361 bits (926), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 197/511 (38%), Positives = 286/511 (55%), Gaps = 35/511 (6%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
            P   +NS   PE++V+ELS  +K ++ES   HV +RGE+ G      SGH Y  LKD+ 
Sbjct: 6   EPAPGQNS---PEFTVTELSSAIKRVIESEFGHVRIRGEV-GRVSRPRSGHIYLDLKDDA 61

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           S I  +IWKG   ++E  PEEG+E +  G+ITTF G SKYQI+IE + P+G G L+  LE
Sbjct: 62  SVISGVIWKGVAARLETQPEEGMEVIATGRITTFGGQSKYQIVIEDIKPAGMGALMALLE 121

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           KRK  L  EGLF+ + K  +P++P +I V+TSP+GAVIRDIL R+  RFP +V+I+PV V
Sbjct: 122 KRKAALAAEGLFAPERKRALPYLPDVIGVVTSPSGAVIRDILHRLRDRFPRKVLIWPVAV 181

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QG +C  E+A AI   N L  G   PRPD++I+ARGGGS+EDLW FN+E++ RA A S I
Sbjct: 182 QGAKCAPEVARAIEGFNKLTFGGAIPRPDLLIVARGGGSVEDLWGFNEEIVARAAALSEI 241

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETD TL DY +D RAPTPT AAE+AVPV+  L + L   EAR+   + + + 
Sbjct: 242 PLISAVGHETDTTLIDYVSDKRAPTPTAAAELAVPVRHELVALLDGQEARMTRALSQGLA 301

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            +   L  + +ALP +D  L   R R+D L   L   L   + ++     +I   ++   
Sbjct: 302 RRDQRLRDMARALPRADSLLDGPRQRVDVLGGRLGPALTAGVQKRKVRLANISGVLRPGT 361

Query: 362 LIHNIQKNRQHI--LEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH 419
           L   +Q  ++ +  L  +   E +V+        ++K K      L  +  +        
Sbjct: 362 LTRALQSEQRRLAGLSARFRPEALVQ--------DQKRKAEAFQSLARRLSDAGLRQTAG 413

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
            +K I  ++                  R+ +  +YK+TL RGY  ++  +   +T K+  
Sbjct: 414 WRKQIAGLD------------------RVHEMLSYKSTLARGYAVVRG-DGKLVTTKKAA 454

Query: 480 ATKTRILINFFDGQANAIVINKAPPKEQPTK 510
              T + I F DG+    V  KA P++   K
Sbjct: 455 QDATSLEIEFADGRMQ--VGGKAGPRKAAKK 483


>gi|163740774|ref|ZP_02148167.1| exodeoxyribonuclease VII, large subunit [Phaeobacter gallaeciensis
           2.10]
 gi|161385765|gb|EDQ10141.1| exodeoxyribonuclease VII, large subunit [Phaeobacter gallaeciensis
           2.10]
          Length = 521

 Score =  360 bits (923), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 197/540 (36%), Positives = 297/540 (55%), Gaps = 44/540 (8%)

Query: 5   SQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRI 64
           S +   + PE++VSE+S  +K  +E     + V+GE+ G      SGH Y+ +KD+ S +
Sbjct: 11  SDRPGQNAPEFTVSEISGEVKRTLEGTFGRIRVKGEV-GRVFKARSGHLYYDIKDDRSVL 69

Query: 65  DAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRK 124
               WKG +  +  +PEEG+E +V G++T F G SKY + ++ +  +G G L+  LEKRK
Sbjct: 70  ACTTWKGQIASLSVVPEEGLEVVVTGRLTAFGGQSKYNMNVDEVAVAGQGALMALLEKRK 129

Query: 125 KKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGD 184
           K+L  EGLF+ + K P+P++P+II V+TSP+GAVIRDIL R+  RFP +V+++PV VQG 
Sbjct: 130 KQLEAEGLFAPERKKPLPYLPQIIGVVTSPSGAVIRDILHRLRDRFPRKVLVWPVAVQGA 189

Query: 185 ECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPII 244
            C  E+A AI   N L  G   PRPD+II+ARGGGSIEDLW FN+E + RA+ANS IP+I
Sbjct: 190 NCAPEVARAIEGFNQLTPGGALPRPDLIIVARGGGSIEDLWGFNEETVARAVANSQIPLI 249

Query: 245 SAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKI 304
           SA+GHETD TL D+ +D RAPTPT AAE+AVPV+  L     N  ARL     + ++ + 
Sbjct: 250 SAVGHETDTTLIDFVSDRRAPTPTAAAELAVPVRLELLGWTENQGARLVRSAGQAVQQRR 309

Query: 305 NTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
             LN L +ALP  D  L   R RLDR+   L                        D LI 
Sbjct: 310 QRLNDLARALPKPDTLLETPRQRLDRVSERL-----------------------PDALIR 346

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAIL--HMLREQTKNRIFYLHTHIKK 422
            +++ R  + E    +       LR +   +++++  L   +     +  +   H  I +
Sbjct: 347 GVERRRLRLSEAAAALR---PSTLRQLVGARQDRLRNLSSRLTLRPIQQDLARQHDRIGQ 403

Query: 423 LITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATK 482
           L  R+E + + ++      +  T R L+  +YK TL+RGY  ++ +++  IT+    AT+
Sbjct: 404 LTQRLEAVQTQRLDRHRQRLEATGRQLEILSYKATLERGYAVVR-SDDGVITRAAEAATQ 462

Query: 483 TRILINFFD----------GQANAIVI---NKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
            R+ I F D          G  + +     + + PK + +K  +  + K +    QG LF
Sbjct: 463 PRLRIEFADAEIDVTPAEAGGGDGVTPPAKSSSAPKSEASKPGKRPSGKAQPD-DQGSLF 521


>gi|163737651|ref|ZP_02145068.1| exodeoxyribonuclease VII, large subunit [Phaeobacter gallaeciensis
           BS107]
 gi|161389177|gb|EDQ13529.1| exodeoxyribonuclease VII, large subunit [Phaeobacter gallaeciensis
           BS107]
          Length = 521

 Score =  359 bits (922), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 188/491 (38%), Positives = 280/491 (57%), Gaps = 30/491 (6%)

Query: 5   SQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRI 64
           S +   + PE++VSE+S  +K  +E     + V+GE+ G      SGH Y+ +KD+ S +
Sbjct: 11  SDRPGQNAPEFTVSEISGEVKRTLEGTFGRIRVKGEV-GRVFKARSGHLYYDIKDDRSVL 69

Query: 65  DAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRK 124
               WKG +  +  +PEEG+E +V G++T F G SKY + ++ +  +G G L+  LEKRK
Sbjct: 70  ACTTWKGQIASLSVVPEEGLEVVVTGRLTAFGGQSKYNMNVDEVAVAGQGALMALLEKRK 129

Query: 125 KKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGD 184
           K+L  EGLF+ + K P+P++P+II V+TSP+GAVIRDIL R+  RFP +V+++PV VQG 
Sbjct: 130 KQLEAEGLFAPERKKPLPYLPQIIGVVTSPSGAVIRDILHRLRDRFPRKVLVWPVAVQGA 189

Query: 185 ECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPII 244
            C  E+A AI   N L  G   PRPD+II+ARGGGSIEDLW FN+E + RA+ANS IP+I
Sbjct: 190 NCAPEVARAIEGFNQLTPGGALPRPDLIIVARGGGSIEDLWGFNEETVARAVANSQIPLI 249

Query: 245 SAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKI 304
           SA+GHETD TL D+ +D RAPTPT AAE+AVPV+  L     N  ARL     + ++ + 
Sbjct: 250 SAVGHETDTTLIDFVSDRRAPTPTAAAELAVPVRLELLGWTENQGARLVRSAGQAVQQRR 309

Query: 305 NTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
             LN L +ALP  D  L   R RLDR+   L                        D LI 
Sbjct: 310 QRLNDLARALPKPDTLLETPRQRLDRVSERL-----------------------PDALIR 346

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAIL--HMLREQTKNRIFYLHTHIKK 422
            +++ R  + E    +       LR +   +++++  L   +     +  +   H  I +
Sbjct: 347 GVERRRLRLSEAAAALR---PSTLRQLVGARQDRLRNLSSRLTLRPIQQDLARQHDRIGQ 403

Query: 423 LITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATK 482
           L  R+E + + ++      +  T R L+  +YK TL+RGY  ++ +++  IT+    AT+
Sbjct: 404 LTQRLEAVQTQRLDRHRQRLEATGRQLEILSYKATLERGYAVVR-SDDGVITRATEAATQ 462

Query: 483 TRILINFFDGQ 493
            R+ I F D +
Sbjct: 463 PRLRIEFADAE 473


>gi|218532089|ref|YP_002422905.1| exodeoxyribonuclease VII large subunit [Methylobacterium
           chloromethanicum CM4]
 gi|218524392|gb|ACK84977.1| exodeoxyribonuclease VII, large subunit [Methylobacterium
           chloromethanicum CM4]
          Length = 523

 Score =  359 bits (921), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 175/345 (50%), Positives = 235/345 (68%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           PE+SV +L+  LK  +E    HV +RGEI+GYRG H SGHAYFSLKD  ++IDA++WKG 
Sbjct: 33  PEWSVGDLAAALKRTLEDAFGHVRLRGEITGYRGPHGSGHAYFSLKDGSAKIDAVVWKGV 92

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
           L ++   P+EG+E +  GKITTF G S YQI+I+S+ P+G G  +  LE+RK++L  EGL
Sbjct: 93  LGRLRQKPKEGLEVVATGKITTFAGKSSYQIVIDSMEPAGIGAWMALLEERKRQLAAEGL 152

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F  + K PIPF+P++I V+TSPTGAVIRDIL R+  RFP  V+++PV+VQG+   +EIA 
Sbjct: 153 FEAERKRPIPFLPRVIGVVTSPTGAVIRDILHRLEDRFPRPVLVWPVRVQGEGAAEEIAA 212

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N L      PRPD++I+ARGGGSIEDLW FN+E +VRA A S IP+ISA+GHETD
Sbjct: 213 AIRGFNALSPDGPIPRPDVLIVARGGGSIEDLWAFNEEAVVRAAAESEIPLISAVGHETD 272

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            TL D+A+D RAPTPTGAAEMAVPV+  L + +  L AR    ++R I+ +     +L++
Sbjct: 273 TTLIDFASDRRAPTPTGAAEMAVPVRAELAAQVHELGARQAGTMLRRIERERADFRALVR 332

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRI 357
           A+P +D  L+  R RLD     L   L           N + +R+
Sbjct: 333 AIPGADAFLAVKRQRLDLADARLRPALAANARDSRERLNRVADRL 377


>gi|163853273|ref|YP_001641316.1| exodeoxyribonuclease VII, large subunit [Methylobacterium
           extorquens PA1]
 gi|163664878|gb|ABY32245.1| exodeoxyribonuclease VII, large subunit [Methylobacterium
           extorquens PA1]
          Length = 522

 Score =  358 bits (920), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 200/512 (39%), Positives = 286/512 (55%), Gaps = 58/512 (11%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           PE+SV +L+  LK  +E    HV +RGEI+GYRG H SGHAYFSLKD  ++IDA++WKG 
Sbjct: 33  PEWSVGDLAAALKRTLEDAFGHVRLRGEITGYRGPHGSGHAYFSLKDGSAKIDAVVWKGV 92

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
           L ++   P+EG+E +  GKITTF G S YQI+I+S+ P+G G  +  LE+RK++L  EGL
Sbjct: 93  LGRLRQKPKEGLEVVATGKITTFAGKSSYQIVIDSMEPAGIGAWMALLEERKRQLAAEGL 152

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F    K PIPF+P++I V+TSPTGAVIRDIL R+  RFP  V+++PV+VQG+   +EIA 
Sbjct: 153 FETDRKRPIPFLPRVIGVVTSPTGAVIRDILHRLEDRFPRPVLVWPVRVQGEGAAEEIAA 212

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N L      PRPD++I+ARGGGSIEDLW FN+E +VRA A S IP+ISA+GHETD
Sbjct: 213 AIRGFNALSPDGPIPRPDVLIVARGGGSIEDLWAFNEEAVVRAAAESEIPLISAVGHETD 272

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            TL D+A+D RAPTPTGAAEMAVPV+  L + +  L AR    ++R I+ +     +L++
Sbjct: 273 TTLIDFASDRRAPTPTGAAEMAVPVRTELSAQIHELGARQAGTMLRRIERERADFRALVR 332

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
           A+P +D  L+  R RLD     L   L           N + +R                
Sbjct: 333 AIPGADAFLAVKRQRLDLADARLRPALAANARDSRERLNRVADR---------------- 376

Query: 373 ILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILS 432
            L ++     + +   R   ++ + + A+  ++ E+ ++R+  L                
Sbjct: 377 -LTRRSPAIALAEARARLAAIDHRPRTAMSRIV-ERRRDRLDAL---------------- 418

Query: 433 HKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDG 492
                        T +L + +YK  L RGY  ++D +   +      A   R  + F DG
Sbjct: 419 -------------TSLLGALSYKAVLARGYALVRDADGLPVRSAAAAARAARFQLQFADG 465

Query: 493 -----------QANAIVINKAPPKEQPTKKCQ 513
                         A  + +APP  +P +  +
Sbjct: 466 AIFARPEEAPDDPVAPPLAEAPPSPRPKRAPR 497


>gi|146276686|ref|YP_001166845.1| exodeoxyribonuclease VII large subunit [Rhodobacter sphaeroides
           ATCC 17025]
 gi|166232360|sp|A4WQ76|EX7L_RHOS5 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|145554927|gb|ABP69540.1| Exodeoxyribonuclease VII large subunit [Rhodobacter sphaeroides
           ATCC 17025]
          Length = 519

 Score =  358 bits (920), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 195/511 (38%), Positives = 282/511 (55%), Gaps = 39/511 (7%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           +P   +N+   PEY+VSELS  +K ++E     V VRGEI G     +SGH YF LKD+ 
Sbjct: 7   DPAPARNT---PEYTVSELSGAVKRVIEGEFGLVRVRGEI-GRVSRPASGHLYFDLKDDR 62

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           + I AI WKG   ++   PEEG+E +  G++TTFPG SKYQII+E + P+G+G L+  LE
Sbjct: 63  AVIAAICWKGQAGRLSVRPEEGMEVVATGRMTTFPGQSKYQIIVEDMAPAGAGALMAMLE 122

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           KR+  L  EGLF    K P+PF+P++I V+TSP+GAVIRDIL R+  RFP  V+I+PV V
Sbjct: 123 KRRAALAAEGLFDAARKRPLPFLPRVIGVVTSPSGAVIRDILHRLRDRFPSHVLIWPVAV 182

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QG++C  E+A AI   N L +G   PRPD++I+ARGGGS+EDLW FN+E++VRA A S I
Sbjct: 183 QGEKCAPEVAAAIRGFNALPDGGPIPRPDLLIVARGGGSLEDLWGFNEEIVVRAAAESRI 242

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETD TL D+AAD RAPTPT AAEMAVPV+  L + L    ARL+      I+
Sbjct: 243 PLISAVGHETDTTLIDHAADRRAPTPTAAAEMAVPVRLDLLAGLDGQGARLSRCAAETIR 302

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            +   L  L +ALP  D  ++    R D     L   L   +  +      +   ++   
Sbjct: 303 RRDQRLRDLSRALPRLDSLVAGPSQRFDLWSARLSGALGQSVAARRARLEPLGAHLRPRL 362

Query: 362 LIHNIQKNRQHILEKQQHIEQIV-----KQHLRYIFLEKKEKIAILHMLREQTK-NR--- 412
           L   + + +  + ++ + +E  +     +   R+  L  +   A   ++ E  + NR   
Sbjct: 363 LADLVARQKDRLADRGRGLETCLGRRSERARDRFEALSGRLAPAFARLVAESERTNRRDA 422

Query: 413 ----------IFYLHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGY 462
                            + +L  R+E +                R+ Q+  Y+ TL+RGY
Sbjct: 423 AALGALAARLEAAPEARLLRLADRLEAL---------------DRLRQTLGYRETLRRGY 467

Query: 463 TSIQDTNNNFITQKRNLATKTRILINFFDGQ 493
             ++  +   +T K        + I F DG+
Sbjct: 468 AVVR-ADGEVVTTKTAAERAASLEIEFQDGR 497


>gi|240140681|ref|YP_002965161.1| putative exonuclease VII, large subunit OB-fold nucleic acid
           binding domain [Methylobacterium extorquens AM1]
 gi|240010658|gb|ACS41884.1| putative exonuclease VII, large subunit OB-fold nucleic acid
           binding domain [Methylobacterium extorquens AM1]
          Length = 523

 Score =  358 bits (919), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 175/345 (50%), Positives = 234/345 (67%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           PE+SV +L+  LK  +E    HV +RGEI+GYRG H SGHAYFSLKD  ++IDA++WKG 
Sbjct: 33  PEWSVGDLAAALKRTLEDAFGHVRLRGEITGYRGPHGSGHAYFSLKDGSAKIDAVVWKGV 92

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
           L ++   P+EG+E +  GKITTF G S YQI+I+S+ P+G G  +  LE+RK++L  EGL
Sbjct: 93  LGRLRQKPKEGLEVIATGKITTFAGKSSYQIVIDSMEPAGIGAWMALLEERKRQLAAEGL 152

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F    K PIPF+P++I V+TSPTGAVIRDIL R+  RFP  V+++PV+VQG+   +EIA 
Sbjct: 153 FETDRKRPIPFLPRVIGVVTSPTGAVIRDILHRLEDRFPRPVLVWPVRVQGEGAAEEIAA 212

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N L      PRPD++I+ARGGGSIEDLW FN+E +VRA A S IP+ISA+GHETD
Sbjct: 213 AIRGFNALSPDGPIPRPDVLIVARGGGSIEDLWAFNEEAVVRAAAESEIPLISAVGHETD 272

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            TL D+A+D RAPTPTGAAEMAVPV+  L + +  L AR    ++R I+ +     +L++
Sbjct: 273 TTLIDFASDRRAPTPTGAAEMAVPVRAELAAQVHELGARQAGTMLRRIERERADFRALVR 332

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRI 357
           A+P +D  L+  R RLD     L   L           N + +R+
Sbjct: 333 AIPGADAFLAVKRQRLDLADARLRPALAANARDSRERLNRVADRL 377


>gi|260427057|ref|ZP_05781036.1| exodeoxyribonuclease VII, large subunit [Citreicella sp. SE45]
 gi|260421549|gb|EEX14800.1| exodeoxyribonuclease VII, large subunit [Citreicella sp. SE45]
          Length = 490

 Score =  358 bits (918), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 200/506 (39%), Positives = 285/506 (56%), Gaps = 35/506 (6%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           +S + PE+SVSELS  +K ++E    HV V+GE+ G      SGH Y  LKD+ S I  I
Sbjct: 7   DSGNTPEFSVSELSGAVKRVIEGEFGHVRVKGEV-GRVSRPRSGHIYLDLKDDRSVIAGI 65

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +WKG   ++E  PEEG+E +  G++TTFPG SKYQI+IE + P+G G L+  LEKRK  L
Sbjct: 66  VWKGVAARLETQPEEGMEVVATGRLTTFPGQSKYQIVIEDIRPAGLGALMAMLEKRKALL 125

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECP 187
             EGLF    K P+P++P++I V+TSP+GAVIRDIL R+  RFP +V+I+PV VQG  C 
Sbjct: 126 QAEGLFDASRKRPLPYLPEVIGVVTSPSGAVIRDILHRLRDRFPRKVLIWPVAVQGQNCA 185

Query: 188 KEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAI 247
            E+  AI   N L  G   PRPD++I+ARGGGS+EDLW FN+E + RA A S IP+ISA+
Sbjct: 186 PEVVRAIEGFNALSPGGALPRPDLLIVARGGGSVEDLWGFNEEAVARAAAASQIPLISAV 245

Query: 248 GHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTL 307
           GHETD TL D+ +D RAPTPT AAE+AVPV+  L S       R+   + + I+ +   L
Sbjct: 246 GHETDTTLIDFVSDRRAPTPTAAAEIAVPVRMELLSWTGEAGVRMTRAMGQRIEVRSQRL 305

Query: 308 NSLLKALPNSDQTLSCSRYRL----DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLI 363
             L +ALP ++  L   R RL    DRLPR L    E    ++    + +   ++   L 
Sbjct: 306 RDLSRALPRAETLLDQPRQRLDLLGDRLPRALIRGTE----QRRVALSDVAGALRPSLLT 361

Query: 364 HNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKL 423
             I   R+ +  +   +       LR I    + +IA       Q ++R+  L   +++ 
Sbjct: 362 RVIAHGRESLGRRTDRL------SLRPI----EREIA-------QGRDRLATLSRRLEES 404

Query: 424 ITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKT 483
            TR       ++      +   +R+L++ +YK TL RGY  ++      +T K       
Sbjct: 405 ATR-------RLDDPARKLDGLSRLLETLSYKGTLARGYAVVRSAEGTILTHKAAAQNAA 457

Query: 484 RILINFFDGQANAIVINKAPPKEQPT 509
            + I F DG+    +  KA PK + T
Sbjct: 458 GLEIEFSDGRFA--LGGKARPKRKDT 481


>gi|119386735|ref|YP_917790.1| exodeoxyribonuclease VII, large subunit [Paracoccus denitrificans
           PD1222]
 gi|119377330|gb|ABL72094.1| Exodeoxyribonuclease VII large subunit [Paracoccus denitrificans
           PD1222]
          Length = 519

 Score =  358 bits (918), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 198/524 (37%), Positives = 290/524 (55%), Gaps = 26/524 (4%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           E++VSE+S  +K ++E     V VRGEI G     SSGH YF LKD+ + I A+ WKG  
Sbjct: 14  EFTVSEISGAVKRVLEGEFGRVRVRGEI-GRVSRPSSGHLYFDLKDDRAVIAAVTWKGQA 72

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            ++   PEEGIE +  G++TTFPG SKYQ+I+E + P+G+G L+  LEK +K L  EGLF
Sbjct: 73  ARLSTRPEEGIEVIATGRLTTFPGQSKYQLIVEEIEPAGAGALMMMLEKCRKALAAEGLF 132

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
            +  K P+P++P++I V+TSP+GAVIRDIL R+  RFP  V+I+PV VQG+ C  ++  A
Sbjct: 133 DESRKRPLPYLPRVIGVVTSPSGAVIRDILHRLRDRFPTHVLIWPVAVQGEGCASQVTAA 192

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N L      PRPD+II+ARGGGS+EDLW FN+E +VRA A+S IP+ISA+GHETD 
Sbjct: 193 IRGFNALPSDGPLPRPDLIIVARGGGSLEDLWGFNEEAVVRAAADSLIPLISAVGHETDT 252

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D+A+D RAPTPT AAEMAVPV+  L + L  ++AR+        + +   L+ L +A
Sbjct: 253 TLIDFASDRRAPTPTAAAEMAVPVRAELAARLTEIQARMMRAAQTRNQRQRQRLSDLGRA 312

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           L       + +R R D     LE  L   +  +    N +   + +   +  + +NR+  
Sbjct: 313 LGRPQALTAPARQRFDLFAERLEPALRGFVRARRDRLNALPLSLSA---LRAMLRNRRDA 369

Query: 374 LEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH--------IKKLIT 425
           L+ Q    Q +   L  +   + E++  L    E+ + R+              + +L  
Sbjct: 370 LQAQA---QRLPLCLARLGQRRSERLTDLGSRLERARARMLADAARQIVRDRGTLDRLAA 426

Query: 426 RIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRI 485
           R+       +     ++    R+ Q+  Y+ TL+RG+  +    +  +T     A   R 
Sbjct: 427 RLSAAGGRLLAPRRDALERLDRLRQTLGYRETLRRGFAVVHGP-SGLLTHAAEAAQTPRF 485

Query: 486 LINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
            I F DG+  A     APP  +P +K       RE +G Q  LF
Sbjct: 486 EIEFLDGRMAA--RPDAPPA-KPARK------PREPKG-QKSLF 519


>gi|254460102|ref|ZP_05073518.1| exodeoxyribonuclease VII, large subunit [Rhodobacterales bacterium
           HTCC2083]
 gi|206676691|gb|EDZ41178.1| exodeoxyribonuclease VII, large subunit [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 520

 Score =  353 bits (907), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 196/534 (36%), Positives = 295/534 (55%), Gaps = 33/534 (6%)

Query: 7   KNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHS-SGHAYFSLKDNHSRID 65
           +   + PE++VSE+S  +K  +E    HV +RGE+   R +H+ SGH YF +KD+ S + 
Sbjct: 9   REGANEPEFTVSEISSAVKRTIEGTFDHVRIRGEVG--RVVHARSGHLYFDIKDDRSVLG 66

Query: 66  AIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKK 125
              WKG + K+  +PEEG+E +  G++TTFPG SKYQ+ ++ +  +G G L+  LEKRKK
Sbjct: 67  CTAWKGQVAKLTVMPEEGMEIIATGRLTTFPGQSKYQMNVQDVAVAGEGALMAMLEKRKK 126

Query: 126 KLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDE 185
           KL  EG+F  + K  IPF+P++I V+TSPTGAVIRDIL R+  RFP +V+I+PV VQG+ 
Sbjct: 127 KLKAEGIFDPERKQNIPFLPEVIGVVTSPTGAVIRDILHRLRDRFPRKVLIWPVAVQGER 186

Query: 186 CPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIIS 245
           C  E+  AI   N    G   PRPD+II+ARGGGSIEDLW FN+E++ RA A S+IP+IS
Sbjct: 187 CAPEVTRAIDGFNAFTPGGALPRPDLIIVARGGGSIEDLWGFNEEIVARAAAGSAIPLIS 246

Query: 246 AIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKIN 305
           A+GHETD TL D+A+D RAPTPT AAE AVPV+  L + L   E R  + +   + ++  
Sbjct: 247 AVGHETDTTLIDFASDHRAPTPTAAAERAVPVRAELLARLEETEGRRISAMRAALNHRGE 306

Query: 306 TLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHN 365
            L  L +ALP  +  L+ S+ RLD     L + L   I       +     ++   L  +
Sbjct: 307 KLRDLSRALPRREALLAHSQQRLDLASARLPNALMARINLGRTGLSQASGALRPSLLSRS 366

Query: 366 IQKNRQHI----------LEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFY 415
           ++ + + +          LE+++    I  Q+L   F   +    I   LR Q  + + +
Sbjct: 367 LEASSERVKDRAVRLAPALERKRTTAAIDLQNLSKRFDATRVDAQI--ELRRQKLSDVLH 424

Query: 416 LHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQ 475
                K+     +   + K+ +         R+  +  YK TL RGY  ++  + + +T 
Sbjct: 425 ---RFKQAAHAQQDQQTRKLDALD-------RLRLTLGYKATLDRGYAVVRSADGDVLTT 474

Query: 476 KRNLATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
           ++   +   + I F DG  N   I    P  +P K   +  + ++    QG LF
Sbjct: 475 QKAAKSHVALDIEFADGTLN---IGTGRPA-KPAKTATVKTDPKD----QGSLF 520


>gi|241760867|ref|ZP_04758956.1| exodeoxyribonuclease VII, large subunit [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|241374486|gb|EER63947.1| exodeoxyribonuclease VII, large subunit [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 544

 Score =  352 bits (904), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 192/517 (37%), Positives = 303/517 (58%), Gaps = 35/517 (6%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
           +SVSE+S  LK  VE   SH+ VRGEISG+     SGH Y +LKD+ + +D++IW+G ++
Sbjct: 24  FSVSEISGALKRTVEDAFSHIRVRGEISGFTQA-GSGHCYLALKDDKAVLDSVIWRGVVS 82

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
           +I F PE G+E +  G++TT+ G S+YQ++IE L  +G G L+  L++R++ L EEGLF+
Sbjct: 83  RISFWPENGMEVIATGRLTTYAGRSRYQLVIEQLEIAGQGALMALLDRRRRMLAEEGLFN 142

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANAI 194
              K  +PF+PKII V++SP+GAVIRDIL R++ R P  VI++PV VQGD+   ++A A+
Sbjct: 143 ADRKRALPFMPKIIGVVSSPSGAVIRDILHRLADRCPTHVILWPVPVQGDQAAAKVAAAV 202

Query: 195 LQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWT 254
              + LK G   PRPD++I+ARGGGS+EDLW FN+E++VRA+A SSIP+ISA+GHETD T
Sbjct: 203 RGFSALKAGDAIPRPDLLIVARGGGSLEDLWPFNEEILVRAVAESSIPVISAVGHETDTT 262

Query: 255 LADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKAL 314
           L DYAADLRAPTPT AAE+AVPV+  L + L NL  R+NN I R  K     L+++ + L
Sbjct: 263 LCDYAADLRAPTPTAAAELAVPVRSELVNGLNNLHLRMNNAIARHAKLSEERLDAVRQRL 322

Query: 315 PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH-- 372
           P+ ++ L+      D    +LE ++   +       N     ++   L   I + +    
Sbjct: 323 PDGERLLAPFIQLFDDRASQLERDISERMTHARHKLNFYAATLRPALLKARIAREQARLS 382

Query: 373 ----------ILEKQQHIEQIVKQ------------HLRYIFLEKKEKIAILHMLREQTK 410
                     ++++QQ ++ + ++             LR+ FL +K +  +L   R Q K
Sbjct: 383 ACRLPTGQRLVIQEQQKLDNVTRRLKQAYQQRLSHADLRFKFLAEKLQPLLLEQ-RWQQK 441

Query: 411 NRIFYLHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNN 470
             +    +   +L+T        ++     ++    R+ +       L +GY  ++D+++
Sbjct: 442 AELLAACSLKPELVT-------ARLNIWQKNIDQLWRVAEQAHPDKILAKGYARVEDSHS 494

Query: 471 NFITQKRNLATKTRILINFFDGQANAIVINKAPPKEQ 507
           + ++   +  T  R+ + F DG  +  V  + PPK +
Sbjct: 495 HVVSNAHDAKTHKRLNLIFHDG--SVWVAPETPPKSR 529


>gi|83591499|ref|YP_425251.1| exodeoxyribonuclease VII large subunit [Rhodospirillum rubrum ATCC
           11170]
 gi|83574413|gb|ABC20964.1| Exodeoxyribonuclease VII large subunit [Rhodospirillum rubrum ATCC
           11170]
          Length = 537

 Score =  352 bits (902), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 205/528 (38%), Positives = 294/528 (55%), Gaps = 17/528 (3%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           PE SVSELS  LK  +E   S V VRGEIS  + +  SGH Y  LKD+ + IDAIIW+GT
Sbjct: 13  PELSVSELSGALKRTIEEAFSRVRVRGEISQPK-VAGSGHCYLRLKDDQAVIDAIIWRGT 71

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
           + K+   PEEG+E + IG++TT+PG S YQI+IESL  +G G LL  LE+R+++L  EGL
Sbjct: 72  MAKLALRPEEGLEVIAIGRLTTYPGRSSYQIVIESLELAGEGALLKMLEERRRRLAAEGL 131

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F    K   PF+P +I VITSPTGAVIRDIL R++ RFP  V+++PV VQG+    +IA 
Sbjct: 132 FDAGRKRRPPFLPSVIGVITSPTGAVIRDILHRLADRFPRPVLVWPVAVQGEGAAAQIAA 191

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N L  G   PRPD++I+ARGGGS+EDL  FNDE +VRA + S+IP+ISA+GHETD
Sbjct: 192 AITGFNALPAGGPVPRPDVLIVARGGGSLEDLMAFNDEAVVRAASASAIPLISAVGHETD 251

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            TL D+AADLRAPTPTGAAEMAVPV+  L + +     RL+   +RLI+ +   +  L +
Sbjct: 252 TTLIDHAADLRAPTPTGAAEMAVPVRLDLLAQVRERGGRLDGATLRLIEERRLRIEGLGR 311

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
            LP+  + +     RLD     LE  L  ++ R+     H   R++       I +    
Sbjct: 312 GLPDLARLIGTFAQRLDDRAERLEAALPRLLDRRADGVFHTAARLRGPG--EMIARKADA 369

Query: 373 ILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH-IKKLITRIEFIL 431
           +    + +E  + + LR       ++      LR     R+    +  +  L  R++ + 
Sbjct: 370 LERAGRGLETGLARGLREAASRLDQRA---DRLRPGQIARLVAEGSRALTTLAGRLDDLG 426

Query: 432 SHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFD 491
              +     ++      L + +Y+  L+RGY  ++D     +   R L     ++++F D
Sbjct: 427 RQTLVRRQDTLEGLGARLDNMSYRKVLERGYAVVRDATGAIVPAARGLTKGDGVVLDFRD 486

Query: 492 GQANAIV-------INKAPPKEQPTKKCQLHNNKREK---QGTQGELF 529
           G+  A +       I   P  E P         +R +   +G QG+L 
Sbjct: 487 GRVAATIGEADPEAIPGQPAPETPPTAAGRSPARRPRSAGEGRQGDLL 534


>gi|83858533|ref|ZP_00952055.1| putative exodeoxyribonuclease protein [Oceanicaulis alexandrii
           HTCC2633]
 gi|83853356|gb|EAP91208.1| putative exodeoxyribonuclease protein [Oceanicaulis alexandrii
           HTCC2633]
          Length = 484

 Score =  352 bits (902), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 191/495 (38%), Positives = 278/495 (56%), Gaps = 48/495 (9%)

Query: 4   FSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSR 63
            +  ++ + PEY+VSELS  LK  VE    HV VRGE+ G   +  SGH Y  +KD+ + 
Sbjct: 1   MTDASASNTPEYTVSELSNALKRTVEQAYDHVRVRGEL-GRVTVAKSGHVYLDMKDDKAV 59

Query: 64  IDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKR 123
           ID ++WKG    + F PEEG+E +  G+++TFPG SKYQ+IIE + P+G G L+  LE R
Sbjct: 60  IDGVMWKGVAAHLNFRPEEGLEVIAEGRLSTFPGRSKYQMIIERMEPAGEGALMALLEAR 119

Query: 124 KKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQG 183
           KK L  EGLFS   K  +PF+P++I V+TSPTGAVIRDIL R+  RFP+ V+++PV VQG
Sbjct: 120 KKALAAEGLFSPDGKRALPFLPRVIGVVTSPTGAVIRDILHRLEDRFPVHVLLWPVLVQG 179

Query: 184 DECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPI 243
           ++   +IA+AI   N ++ G   P PD++I+ARGGGSIEDLW FN+E +VRA A S IP+
Sbjct: 180 EKAADQIAHAIEGFNAIEPGGPVPVPDVLIVARGGGSIEDLWCFNEERVVRAAAASRIPL 239

Query: 244 ISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYK 303
           ISA+GHETD TL DYA+D RAPTPTGAAE+AVPV+  L   +    ARL + ++R +  K
Sbjct: 240 ISAVGHETDTTLIDYASDRRAPTPTGAAEIAVPVRRELVERISTTTARLMSALVRGLDRK 299

Query: 304 INTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLI 363
              L S  + LP+   TL+             E+N ++                  DF+ 
Sbjct: 300 AADLKSASRGLPSPRATLN-------------ENNQKL------------------DFIA 328

Query: 364 HNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKL 423
             +    Q  LE++Q   Q     +R   L  +  +AI     +Q+              
Sbjct: 329 SRLNGAAQSGLERKQTRLQAAALQMRPTAL--RRDLAIKGDRFQQSG------------- 373

Query: 424 ITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKT 483
             R+E     ++     ++      L++ ++K+ L+RG+  ++D +   + Q   L +  
Sbjct: 374 -ARLEQAFRRELGDQARTLGSLGARLEALSHKSVLRRGFALVKDESGALVRQGAALTSGQ 432

Query: 484 RILINFFDGQANAIV 498
            + + F D    AIV
Sbjct: 433 AVTLVFEDTTRGAIV 447


>gi|259415863|ref|ZP_05739783.1| exodeoxyribonuclease VII, large subunit [Silicibacter sp.
           TrichCH4B]
 gi|259347302|gb|EEW59079.1| exodeoxyribonuclease VII, large subunit [Silicibacter sp.
           TrichCH4B]
          Length = 502

 Score =  351 bits (900), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 188/497 (37%), Positives = 279/497 (56%), Gaps = 41/497 (8%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           +P   +N+   PE+SVSE+S  +K  +E +   V VRGE+ G      SGH Y+ +KD+ 
Sbjct: 7   DPSPGQNA---PEFSVSEISGEIKKTLEGSFGRVRVRGEV-GRVFKARSGHLYYDIKDDR 62

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           S +    WKG ++ +  +PEEG+E +V G++T F G SKY + ++ +  +G G L+  LE
Sbjct: 63  SVLACTTWKGQISGLSVVPEEGLEVVVTGRLTAFGGQSKYNMNVDEVAVAGQGALMALLE 122

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           KRK +L  EGLF+ + K P+P++P+II V+TSP+GAVIRDIL R+  RFP +V+++PV V
Sbjct: 123 KRKAQLASEGLFAPERKKPLPYLPQIIGVVTSPSGAVIRDILHRLRDRFPRKVLVWPVAV 182

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QG  C  E+A AI   N L  G   PRPD+II+ARGGGSIEDLW FN+E++ RA+A S I
Sbjct: 183 QGSNCAPEVARAIEGFNNLSPGGALPRPDLIIVARGGGSIEDLWGFNEEIVARAVAASQI 242

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETD TL DY +DLRAPTPT AAE AVPV+  L   + N  AR+ N   R ++
Sbjct: 243 PLISAVGHETDTTLIDYVSDLRAPTPTAAAEHAVPVRLELLGWVENQSARMANATSRAVQ 302

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            +   L  + +ALP  D  L   R RLDR+   L +                        
Sbjct: 303 LRRQRLGDVARALPRPDTLLETPRQRLDRVSDRLPN-----------------------A 339

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIA------ILHMLREQTKNRIFY 415
           LI  +Q+ +  + E+   +       LR +   +K+++        L  +++ T  +   
Sbjct: 340 LIAGVQRRKLTLSERAATLRPAT---LRSLVEARKDRLKNLSSRLTLRPIQQDTARK--- 393

Query: 416 LHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQ 475
               + ++  R+    + +I+     +S T R L+  +YK TL RGY  ++D  +  +T 
Sbjct: 394 -RDALDRISKRLNAAQTSRIERHADRLSATARQLEILSYKATLSRGYAVVRD-GDALVTN 451

Query: 476 KRNLATKTRILINFFDG 492
                    + I F DG
Sbjct: 452 TLGARNAAALSIEFADG 468


>gi|85375369|ref|YP_459431.1| exodeoxyribonuclease VII large subunit [Erythrobacter litoralis
           HTCC2594]
 gi|122543430|sp|Q2N6Q7|EX7L_ERYLH RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|84788452|gb|ABC64634.1| exodeoxyribonuclease VII large subunit [Erythrobacter litoralis
           HTCC2594]
          Length = 477

 Score =  351 bits (900), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 189/490 (38%), Positives = 278/490 (56%), Gaps = 52/490 (10%)

Query: 4   FSQKNSLDHPE-YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHS 62
            +Q  + D+ E  SVS LS  LK  VE    +V +RGE+SG +   +SGH Y SLKD  +
Sbjct: 5   IAQSRAGDNAEPLSVSALSQMLKRTVEDRFGYVRLRGELSGVK-RAASGHMYCSLKDEKA 63

Query: 63  RIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEK 122
            ID ++WKGT  ++ F PE+G+E +  GK+TT+PG SKYQI++ESL  +G G LL  LEK
Sbjct: 64  VIDGVMWKGTTARLAFQPEDGLEVIATGKLTTYPGRSKYQIVLESLEMAGEGALLALLEK 123

Query: 123 RKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQ 182
            +++L  EGLF+   K P+PF+P+ I V+TSPTGAVIRDIL R++ RFP  V+++PV VQ
Sbjct: 124 TRQRLEAEGLFARDRKRPLPFLPRTIGVVTSPTGAVIRDILHRLADRFPSHVLVWPVLVQ 183

Query: 183 GDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIP 242
           G    ++++ AI     +K G   PRPD++I+ARGGGSIEDLW FN+EM+VRAIA+S IP
Sbjct: 184 GQGAAEQVSAAIRGFGAIKAGGEVPRPDLLIVARGGGSIEDLWSFNEEMVVRAIADSPIP 243

Query: 243 IISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKY 302
           +ISA+GHETD TLADYAAD RAPTPT AAE+AVPVK  L ++L +  AR    ++R +  
Sbjct: 244 VISAVGHETDTTLADYAADRRAPTPTAAAEIAVPVKGELAATLNDYAARQQRGVLRPLSL 303

Query: 303 KINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFL 362
               L +                 R+ RLP      +E ++  + +  +  + R++   L
Sbjct: 304 GRERLEA-----------------RVQRLP-----TIETLLQPQAQKLDERVERLRG-AL 340

Query: 363 IHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKK 422
                K R          E +  Q L    L++ E+ A     R+  + R+         
Sbjct: 341 RDRAAKGR----------EALATQRLSPTMLQRAEREA----RRKLDQVRL--------- 377

Query: 423 LITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATK 482
                  ++  +       ++  +R+L +   +  L+RGY  ++D +   +  K     +
Sbjct: 378 ----APALVERRAARDGERLAGLSRVLATLNPRAPLERGYALVRDADGKLVRAKGEATKQ 433

Query: 483 TRILINFFDG 492
            R+ + F DG
Sbjct: 434 ARLAVEFADG 443


>gi|56551196|ref|YP_162035.1| exodeoxyribonuclease VII large subunit [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|59802896|sp|Q9FDL4|EX7L_ZYMMO RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|56542770|gb|AAV88924.1| exodeoxyribonuclease VII, large subunit [Zymomonas mobilis subsp.
           mobilis ZM4]
          Length = 544

 Score =  351 bits (900), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 192/517 (37%), Positives = 302/517 (58%), Gaps = 35/517 (6%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
           +SVSE+S  LK  VE   SH+ VRGEISG+     SGH Y +LKD+ + +D++IW+G ++
Sbjct: 24  FSVSEISGALKRTVEDAFSHIRVRGEISGFTQA-GSGHCYLALKDDKAVLDSVIWRGVVS 82

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
           +I F PE G+E +  G++TT+ G S+YQ++IE L  +G G L+  L++R++ L EEGLF+
Sbjct: 83  RISFRPENGMEVIATGRLTTYAGRSRYQLVIEQLEIAGQGALMALLDRRRRMLAEEGLFN 142

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANAI 194
              K  +PF+PKII V++SP+GAVIRDIL R++ R P  VI++PV VQGD+   ++A A+
Sbjct: 143 ADRKRALPFMPKIIGVVSSPSGAVIRDILHRLADRCPTHVILWPVPVQGDQAAAKVAAAV 202

Query: 195 LQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWT 254
              + LK G   PRPD++I+ARGGGS+EDLW FN+E++VRA+A SSIP+ISA+GHETD T
Sbjct: 203 RGFSALKAGDAIPRPDLLIVARGGGSLEDLWPFNEEILVRAVAESSIPVISAVGHETDTT 262

Query: 255 LADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKAL 314
           L DYAADLRAPTPT AAE+AVPV+  L + L NL  R+NN I R  K     L ++ + L
Sbjct: 263 LCDYAADLRAPTPTAAAELAVPVRSELVNGLNNLHLRMNNAIARHAKLSEERLEAVRRRL 322

Query: 315 PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH-- 372
           P+ ++ L+      D    +LE ++   +       N     ++   L   I + +    
Sbjct: 323 PDGERLLAPFIQLFDDRASQLERDISERMTHARHKLNFYAATLRPALLQARIAREQARLS 382

Query: 373 ----------ILEKQQHIEQIVKQ------------HLRYIFLEKKEKIAILHMLREQTK 410
                     ++++QQ ++ + ++             LR+ FL +K +  +L   R Q K
Sbjct: 383 ACRLPTGQRLVIQEQQKLDNVTRRLKQAYQQRLSHADLRFKFLAEKLQPLLLEQ-RWQQK 441

Query: 411 NRIFYLHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNN 470
             +    +   +L+T        ++     ++    R+ +       L +GY  ++D+++
Sbjct: 442 AELLAACSLKPELVT-------ARLNIWQKNIDQLWRVAEQAHPDKILAKGYARVEDSHS 494

Query: 471 NFITQKRNLATKTRILINFFDGQANAIVINKAPPKEQ 507
           + ++   +  T  R+ + F DG  +  V  + PPK +
Sbjct: 495 HVVSNAHDAKTHKRLNLIFHDG--SVWVAPETPPKSR 529


>gi|126733161|ref|ZP_01748908.1| Exonuclease VII, large subunit [Roseobacter sp. CCS2]
 gi|126716027|gb|EBA12891.1| Exonuclease VII, large subunit [Roseobacter sp. CCS2]
          Length = 495

 Score =  350 bits (898), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 189/497 (38%), Positives = 285/497 (57%), Gaps = 13/497 (2%)

Query: 1   MNPFSQKNSLDH-PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKD 59
           MN   +    D+ PE+SVSE+S  +K  +E   SHV V+GEI G     +SGH Y  LKD
Sbjct: 1   MNDLFEDEPADNTPEFSVSEISGAVKKAIEGGFSHVRVKGEI-GRVSRPASGHIYMDLKD 59

Query: 60  NHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTA 119
           + + +  +IWKG    +   PEEG+E +  GK+TTFPG SKYQ++IE + P+G+G L+  
Sbjct: 60  DRAVLAGVIWKGRAQGLAHRPEEGMEVVATGKLTTFPGQSKYQMVIEDIAPAGAGALMAM 119

Query: 120 LEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPV 179
           LEKRK  L  EG F+ + K  +P++P+II V+TSP+GAVIRDIL R+  RFP +V+++PV
Sbjct: 120 LEKRKAALAAEGFFAPERKKELPYLPEIIGVVTSPSGAVIRDILHRLRDRFPRKVLVWPV 179

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
            VQG +C  E+A AI   NTL  G   PRPD++I+ARGGGS+EDLW FN+E++ RA A S
Sbjct: 180 AVQGQKCAPEVAAAIEGFNTLTPGGALPRPDLLIVARGGGSLEDLWGFNEEVVARAAAAS 239

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
            IP+ISA+GHETD TL D+ +D+RAPTPT AAE+AVPV+  L +      ARL+  +   
Sbjct: 240 DIPLISAVGHETDTTLIDFVSDMRAPTPTAAAELAVPVRMELLAWADQQGARLSRALTTG 299

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
           +  +   +  L +ALP  D  +   R RLD L   L   L     +K    +     ++ 
Sbjct: 300 LTQRQQRVRDLGRALPQVDALVEGPRQRLDYLGERLPAALTGAAAKKRLQMSEAA--LRP 357

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLR--YIFLEKKEKIAILHMLREQTKNRIFYLH 417
             L   + ++R+ +      +   +K+  R     LE+  +     +L+++   +   L 
Sbjct: 358 GILSRRLAEDRRRLDGLSDRLGPALKRRSREARTTLEQTSRGLRAGVLQDRVSRQSDRLI 417

Query: 418 THIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKR 477
             +++L  R     + ++    + +    R+ ++  Y  TLKRGY  ++   +  +   +
Sbjct: 418 GTLRRLSDRASRQQAERL----SKLEALDRLRETLGYVETLKRGYAVVR--GDGAVVTTK 471

Query: 478 NLATKTRIL-INFFDGQ 493
             A K + L I F DG+
Sbjct: 472 GAAQKAKALEIEFADGR 488


>gi|260753163|ref|YP_003226056.1| exodeoxyribonuclease VII large subunit [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|258552526|gb|ACV75472.1| exodeoxyribonuclease VII, large subunit [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 524

 Score =  349 bits (896), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 192/517 (37%), Positives = 301/517 (58%), Gaps = 35/517 (6%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
           +SVSE+S  LK  VE   SH+ VRGEISG+     SGH Y +LKD+ + +D++IW+G ++
Sbjct: 4   FSVSEISGALKRTVEDAFSHIRVRGEISGFTQA-GSGHCYLALKDDKAVLDSVIWRGVVS 62

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
           +I F PE G+E +  G++TT+ G S+YQ++IE L  +G G L+  L++R++ L EEGLF+
Sbjct: 63  RISFRPENGMEVIATGRLTTYAGRSRYQLVIEQLEIAGQGALMALLDRRRRMLAEEGLFN 122

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANAI 194
              K  +PF+PKII V++SP+GAVIRDIL R++ R P  VI++PV VQGD+   ++A A+
Sbjct: 123 ADRKRALPFMPKIIGVVSSPSGAVIRDILHRLADRCPTHVILWPVPVQGDQAAAKVAAAV 182

Query: 195 LQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWT 254
              + LK G   PRPD++I+ARGGGS+EDLW FN+E++VRA+A SSIP+ISA+GHETD T
Sbjct: 183 RGFSALKAGDVIPRPDLLIVARGGGSLEDLWPFNEEILVRAVAESSIPVISAVGHETDTT 242

Query: 255 LADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKAL 314
           L DYAADLRAPTPT AAE+AVPV+  L + L NL  R+NN I R  K     L ++ + L
Sbjct: 243 LCDYAADLRAPTPTAAAELAVPVRSELVNGLNNLHLRMNNAIARHAKLSEERLEAVRQRL 302

Query: 315 PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH-- 372
           P+ ++ L+      D    +LE ++   +       N     ++   L   I + +    
Sbjct: 303 PDGERLLAPFIQLFDDRASQLERDISERMTHARHKLNFYAATLRPALLKARIAREQARLS 362

Query: 373 ----------ILEKQQHIEQIVKQ------------HLRYIFLEKKEKIAILHMLREQTK 410
                     ++++QQ ++ + ++             LR+ FL +K +  +L   R Q K
Sbjct: 363 ACRLPTGQRLVIQEQQKLDNVTRRLKQAYQQRLSHADLRFKFLAEKLQPLLLKQ-RWQQK 421

Query: 411 NRIFYLHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNN 470
             +    +   +L+T        ++     ++    R+ +       L +GY  ++D+++
Sbjct: 422 AELLAACSLKPELVT-------ARLNIWQKNIDQLWRVAEQAHPDKILAKGYARVEDSHS 474

Query: 471 NFITQKRNLATKTRILINFFDGQANAIVINKAPPKEQ 507
           + ++   +  T  R+ + F DG  +  V    PPK +
Sbjct: 475 HVVSNAHDAKTHKRLNLIFHDG--SVWVAPDTPPKSR 509


>gi|99081786|ref|YP_613940.1| exodeoxyribonuclease VII large subunit [Ruegeria sp. TM1040]
 gi|122397774|sp|Q1GF88|EX7L_SILST RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|99038066|gb|ABF64678.1| Exodeoxyribonuclease VII large subunit [Ruegeria sp. TM1040]
          Length = 502

 Score =  349 bits (896), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 196/531 (36%), Positives = 286/531 (53%), Gaps = 38/531 (7%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           +P   +N+   PE+SVSE+S  +K  +E     + VRGE+ G      SGH Y+ +KD+ 
Sbjct: 7   DPTPGQNA---PEFSVSEISGEVKRTLEGTFGRIRVRGEV-GRVFKARSGHLYYDIKDDR 62

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           S +    WKG ++ +  +PEEG+E +V G++T F G SKY + ++ +  +G G L+  LE
Sbjct: 63  SVLACTTWKGQISGLSVVPEEGLEVVVTGRLTAFGGQSKYNMNVDEVAVAGQGALMALLE 122

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           KRK +L  EGLF+ + K P+P++P II VITSP+GAVIRDIL R+  RFP +V+++PV V
Sbjct: 123 KRKAQLAAEGLFAPERKKPLPYLPGIIGVITSPSGAVIRDILHRLRDRFPRKVLVWPVAV 182

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QG     E+A AI   N L  G   PRPD+II+ARGGGSIEDLW FN+E++ RA A S I
Sbjct: 183 QGSNSAPEVARAIDGFNALTPGGALPRPDLIIVARGGGSIEDLWGFNEEIVARATAASDI 242

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETD TL DY +DLRAPTPT AAE AVPV+  L   + N  AR+ N   R ++
Sbjct: 243 PLISAVGHETDTTLIDYVSDLRAPTPTAAAEHAVPVRLELLGWVENQGARMANAASRAVQ 302

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            +   L  + +ALP  D  L   R RLDR+   L + L                      
Sbjct: 303 LRRQRLGDMARALPRPDTLLETPRQRLDRVSDRLPNAL---------------------- 340

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILH---MLREQTKNRIFYLHT 418
            I  +Q+ +  + ++   +       LR +   +++K+  L     LR  T++ +     
Sbjct: 341 -ISGVQRRKLTLSDRAASLRPAT---LRGLVSSRQDKLKNLSSRLTLRPITQD-LGRKRD 395

Query: 419 HIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRN 478
            + ++  R+    S +I      +S T R L   +YK TL+RGY  ++D     +T    
Sbjct: 396 ALDRITKRLNTAQSSRIDRQIDRLSATARQLDILSYKATLRRGYAVVRD-GAALVTSTEG 454

Query: 479 LATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
                 + I F DG  +   +  AP   + +          +  G QG LF
Sbjct: 455 ARKAAELSIEFADGTFD---VASAPSTTKKSAPKPAAPKAPKTPGEQGSLF 502


>gi|9931345|gb|AAG02155.1|AF212041_11 XseA [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 544

 Score =  349 bits (896), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 191/517 (36%), Positives = 302/517 (58%), Gaps = 35/517 (6%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
           +SVSE+S  LK  VE   SH+ VRGEISG+     S H Y +LKD+ + +D++IW+G ++
Sbjct: 24  FSVSEISGALKRTVEDAFSHIRVRGEISGFTQA-GSRHCYLALKDDKAVLDSVIWRGVVS 82

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
           +I F PE G+E +  G++TT+ G S+YQ++IE L  +G G L+  L++R++ L EEGLF+
Sbjct: 83  RISFRPENGMEVIATGRLTTYAGRSRYQLVIEQLEIAGQGALMALLDRRRRMLAEEGLFN 142

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANAI 194
              K  +PF+PKII V++SP+GAVIRDIL R++ R P  VI++PV VQGD+   ++A A+
Sbjct: 143 ADRKRALPFMPKIIGVVSSPSGAVIRDILHRLADRCPTHVILWPVPVQGDQAAAKVAAAV 202

Query: 195 LQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWT 254
              + LK G   PRPD++I+ARGGGS+EDLW FN+E++VRA+A SSIP+ISA+GHETD T
Sbjct: 203 RGFSALKAGDAIPRPDLLIVARGGGSLEDLWPFNEEILVRAVAESSIPVISAVGHETDTT 262

Query: 255 LADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKAL 314
           L DYAADLRAPTPT AAE+AVPV+  L + L NL  R+NN I R  K     L ++ + L
Sbjct: 263 LCDYAADLRAPTPTAAAELAVPVRSELVNGLNNLHLRMNNAIARHAKLSEERLEAVRRRL 322

Query: 315 PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH-- 372
           P+ ++ L+      D    +LE ++   +       N     ++   L   I + +    
Sbjct: 323 PDGERLLAPFIQLFDDRASQLERDISERMTHARHKLNFYAATLRPALLQARIAREQARLS 382

Query: 373 ----------ILEKQQHIEQIVKQ------------HLRYIFLEKKEKIAILHMLREQTK 410
                     ++++QQ ++ + ++             LR+ FL +K +  +L   R Q K
Sbjct: 383 ACRLPTGQRLVIQEQQKLDNVTRRLKQAYQQRLSHADLRFKFLAEKLQPLLLEQ-RWQQK 441

Query: 411 NRIFYLHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNN 470
             +   ++   +L+T        ++     ++    R+ +       L +GY  ++D+++
Sbjct: 442 AELLAAYSLKPELVT-------ARLNIWQKNIDQLWRVAEQAHPDKILAKGYARVEDSHS 494

Query: 471 NFITQKRNLATKTRILINFFDGQANAIVINKAPPKEQ 507
           + ++   +  T  R+ + F DG  +  V  + PPK +
Sbjct: 495 HVVSNAHDAKTHKRLNLIFHDG--SVWVAPETPPKSR 529


>gi|254466447|ref|ZP_05079858.1| exodeoxyribonuclease VII, large subunit [Rhodobacterales bacterium
           Y4I]
 gi|206687355|gb|EDZ47837.1| exodeoxyribonuclease VII, large subunit [Rhodobacterales bacterium
           Y4I]
          Length = 502

 Score =  348 bits (894), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 193/526 (36%), Positives = 288/526 (54%), Gaps = 35/526 (6%)

Query: 5   SQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRI 64
           S +   + PE++VSE+S  +K  +E     + VRGE+ G      SGH Y+ +KD+ S +
Sbjct: 11  SDRPGQNAPEFTVSEISGEVKRTLEGTFGRIRVRGEV-GRVFKARSGHLYYDIKDDRSVL 69

Query: 65  DAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRK 124
               WKG ++ +  +PEEG+E +V G++T F   SKY + ++ +  +G G L+  LEKRK
Sbjct: 70  ACTTWKGQISGLSVVPEEGLEVVVTGRLTAFGAQSKYNMNVDEVAVAGQGALMALLEKRK 129

Query: 125 KKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGD 184
           K+L  EGLF+ + K P+P++P+II V+TSP+GAVIRDIL R+  RFP +V+++PV VQG 
Sbjct: 130 KQLEAEGLFAPERKKPLPYLPQIIGVVTSPSGAVIRDILHRLRDRFPRKVLVWPVAVQGQ 189

Query: 185 ECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPII 244
            C  E+A AI   N L  G   PRPD+II+ARGGGSIEDLW FN+E++ RA A S IP+I
Sbjct: 190 NCAPEVARAIDGFNRLTPGGALPRPDLIIVARGGGSIEDLWGFNEEIVARAAAASQIPLI 249

Query: 245 SAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKI 304
           SA+GHETD TL D+ +D RAPTPT AAE+AVPV+  L +      ARL     + ++ + 
Sbjct: 250 SAVGHETDTTLIDFVSDRRAPTPTAAAELAVPVRLELMAWTETQGARLTRAAGQAVQLRR 309

Query: 305 NTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
             LN L +ALP  D  L   R RLDR+   L   L   + R+  H +     ++   L  
Sbjct: 310 QRLNDLARALPKPDTLLETPRQRLDRISDRLPGALISGVQRRRVHLSETAASLRPATLRQ 369

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            ++  R  +            Q+L         ++++  + RE    +       + +L 
Sbjct: 370 LVEGRRNRL------------QNL-------SSRLSLRPIQREMAAQK-----DALGRLA 405

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
            R++   + +I     +++ T R L+  +YK TL+RGY  ++ + +  +T +   A    
Sbjct: 406 QRLDAAQAVRIDRQRQALTATGRQLEILSYKATLERGYAVVR-SGDEILTTRAAAAKAGA 464

Query: 485 ILINFFDGQAN-AIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
           + I F DG  +       AP  E P        N   K G QG L 
Sbjct: 465 LQIEFADGTLDLGGGAADAPKTEGP--------NPLAKGGGQGTLL 502


>gi|294677914|ref|YP_003578529.1| exodeoxyribonuclease VII large subunit [Rhodobacter capsulatus SB
           1003]
 gi|294476734|gb|ADE86122.1| exodeoxyribonuclease VII, large subunit [Rhodobacter capsulatus SB
           1003]
          Length = 487

 Score =  348 bits (893), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 188/485 (38%), Positives = 264/485 (54%), Gaps = 48/485 (9%)

Query: 9   SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAII 68
           S + PE++VSE+S  +K ++E   + V VRGE+ G      SGH YF LKD ++ I A+ 
Sbjct: 16  SGNTPEFTVSEISGAVKRVIEGEFTRVRVRGEV-GRVSRPGSGHLYFDLKDPNAVIAAVS 74

Query: 69  WKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLL 128
           WKG + +++  PEEG+E +  GK+TTFPG SKYQ+I++ + P+G+G L+  LE R+K L 
Sbjct: 75  WKGQVARMQIRPEEGMEVIATGKLTTFPGQSKYQLIVDDVEPAGAGALMAMLEARRKALA 134

Query: 129 EEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPK 188
            EGLF    K PIP++P +I V+TSP+GAVIRDIL R+  RFP RV+I+PV VQG  C  
Sbjct: 135 AEGLFDPARKKPIPYLPAVIGVVTSPSGAVIRDILHRLRDRFPRRVLIWPVAVQGQACAA 194

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           E+A AI   N L  G   PRPD+II+ARGGGS+EDLW FN+E +VRA A S IP+ISA+G
Sbjct: 195 EVAAAIRGFNALAPGGKVPRPDLIIVARGGGSLEDLWGFNEEAVVRAAAESKIPLISAVG 254

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HETD TL D+AAD RAPTPT AAEMAVPV+  L + L  ++AR++      +  +   L 
Sbjct: 255 HETDTTLIDFAADRRAPTPTAAAEMAVPVRAELATRLSEMQARISRATQTRMASRAQRLA 314

Query: 309 SLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQK 368
            L +AL   +      R R D +   L   L +++ RK   F  +  RI    L      
Sbjct: 315 DLSRALGRPEAITRPRRQRFDLVADRLLPALRMVVVRKRAAFAPLEARISPKLLQT---- 370

Query: 369 NRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIE 428
                                Y+ +E+     +   L    + R+        +L     
Sbjct: 371 ---------------------YLRVERDRLAGLSDRLLRAEQARLTRAQDRFARLAA--- 406

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
                              +LQ+  Y+ TL+RGY  ++   +  +T     A    + I 
Sbjct: 407 -------------------MLQTLGYQETLRRGYAVVRGPADQVLTSAATAAGLAPLEIE 447

Query: 489 FFDGQ 493
           F DG+
Sbjct: 448 FQDGR 452


>gi|94496131|ref|ZP_01302709.1| exodeoxyribonuclease VII large subunit [Sphingomonas sp. SKA58]
 gi|94424310|gb|EAT09333.1| exodeoxyribonuclease VII large subunit [Sphingomonas sp. SKA58]
          Length = 493

 Score =  347 bits (891), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 192/518 (37%), Positives = 276/518 (53%), Gaps = 51/518 (9%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           P  SVSELS  LK  VE    HV +RGEISG++   +SGH Y  LKD+++ ID ++WKG 
Sbjct: 25  PPLSVSELSGMLKRTVEDRFGHVRLRGEISGFK-RAASGHLYLCLKDDNAVIDGVMWKGG 83

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
             ++ F P++G+E +  GK+TT+PG SKYQI+IE +  +G G L+  LEK K KL  EGL
Sbjct: 84  AQRLAFAPQDGVEVIATGKLTTYPGRSKYQIVIERMELAGEGALMALLEKLKAKLAGEGL 143

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F+ + K P+PF+P+ I V+TSPTGAVIRDIL R++ R P +V+++PV VQG    +++A 
Sbjct: 144 FAPERKKPLPFLPRTIGVVTSPTGAVIRDILHRLADRCPTQVLLWPVLVQGQGAAEQVAR 203

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           A+   + +      PRP+++I+ARGGGSIEDLW FN+E++VRA+A  SIPIISA+GHETD
Sbjct: 204 AVRGFSEMAGDGALPRPELVIVARGGGSIEDLWSFNEEIVVRAVAECSIPIISAVGHETD 263

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            TL DYAAD RAPTPT AAEMAVPV+  L + L ++  R    + R        L+   +
Sbjct: 264 TTLCDYAADRRAPTPTAAAEMAVPVRAELLAGLTDMGLRAGRAVRRGAAQARERLDMQAR 323

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
            +P  D  LS  R RLD++   L   L                        H +   R H
Sbjct: 324 LMPTPDTLLSPQRQRLDQVSDGLASGLR-----------------------HRLADARAH 360

Query: 373 ILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILS 432
           + +    +   +   LR       E+   L  LR + +N                   L 
Sbjct: 361 LGQASGALRPAL---LRQQLARAGER---LDRLRLRPEN-------------------LV 395

Query: 433 HKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDG 492
              + C T+    +R   S      L+RGY  +    +  +          +++++F DG
Sbjct: 396 RAQRDCATAFDRVSRHFASLNPDLPLQRGYARVM-AGDRLVRSVEAARAAGQVVLHFHDG 454

Query: 493 QANAIVIN-KAPPKEQPTKKCQLHNNKREKQGTQGELF 529
             +A V   +AP    P+   +     R+    Q +LF
Sbjct: 455 TVDAAVGQAEAPAGMAPSPSARPTRKPRDPAHAQQDLF 492


>gi|110679217|ref|YP_682224.1| exodeoxyribonuclease VII large subunit [Roseobacter denitrificans
           OCh 114]
 gi|109455333|gb|ABG31538.1| exodeoxyribonuclease VII, large subunit, putative [Roseobacter
           denitrificans OCh 114]
          Length = 513

 Score =  347 bits (889), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 180/495 (36%), Positives = 283/495 (57%), Gaps = 13/495 (2%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHS-SGHAYFSLKDN 60
           +P   +N+   PE++VSE+S  +K  +E     V VRGE+S  R I + SGH Y+ +KD+
Sbjct: 6   DPTPGQNT---PEFTVSEISGAVKRTLEGEFGRVRVRGEVS--RVIRARSGHMYYDIKDD 60

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            +++    WKG + ++  +PEEG+E +V G+IT +   SKY + ++ +  +G G L+  L
Sbjct: 61  RNQLACTTWKGQVARLSVIPEEGLEVVVTGRITAYGAQSKYNMNVDEVAVAGKGALMALL 120

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           EKRKK+L  EGLF    K P+P++P+II V+TSPTGAVIRDIL R+  RFP +V+I+PV 
Sbjct: 121 EKRKKQLQAEGLFEASRKRPLPYLPEIIGVVTSPTGAVIRDILHRLRDRFPRKVLIWPVA 180

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQG+ C  E+A AI   N L  G   PRPD+II+ARGGGS+EDLW FN+E + RA A S 
Sbjct: 181 VQGERCAPEVAAAIAGFNALAPGGALPRPDLIIVARGGGSVEDLWGFNEESVARAAAASD 240

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP+ISA+GHETD TL DY +D RAPTPT AAE+AVPV+  L + +   +AR+   + + +
Sbjct: 241 IPLISAVGHETDTTLIDYVSDKRAPTPTAAAELAVPVRHELIAWVEQQDARMRQALSQGL 300

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
             +   L  + +ALP  D  L   R  +D     L   L   + R+      +   ++  
Sbjct: 301 TRRDQRLRDMARALPRPDSLLESPRQLVDTRGARLAPALMSGVQRRKIRLADVSGSLRPA 360

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHL--RYIFLEKKEKIAILHMLREQTKNRIFYLHT 418
            L   +Q   + + EK + ++  + + L  R   LE + +     +L ++ + +      
Sbjct: 361 MLTRAVQAEDRQLKEKVRRLQPALLRALATRKEQLETRVRRYRPAVLEQEYRRK----KQ 416

Query: 419 HIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRN 478
           H   ++ R+  +    + +    +    R+ ++ +YK TL RG+  ++  +   +T  + 
Sbjct: 417 HFDDVVHRLGKVGEQNLDAARRKLDALGRLNETLSYKATLARGFAVVR-ADGAVVTDSKT 475

Query: 479 LATKTRILINFFDGQ 493
             T + + I F DG+
Sbjct: 476 AKTASSLEIQFADGR 490


>gi|163733311|ref|ZP_02140754.1| exodeoxyribonuclease VII, large subunit, putative [Roseobacter
           litoralis Och 149]
 gi|161393099|gb|EDQ17425.1| exodeoxyribonuclease VII, large subunit, putative [Roseobacter
           litoralis Och 149]
          Length = 513

 Score =  346 bits (888), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 181/497 (36%), Positives = 284/497 (57%), Gaps = 17/497 (3%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHS-SGHAYFSLKDN 60
           +P   +N+   PE++VSE+S  +K  +E     V VRGE+S  R I + SGH Y+ +KD+
Sbjct: 6   DPTPGQNT---PEFTVSEISGAVKRTLEGEFGRVRVRGEVS--RVIKARSGHMYYDIKDD 60

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            +++    WKG + ++  +PEEG+E +V G+IT +   SKY + ++ +  +G G L+  L
Sbjct: 61  RNQLSCTTWKGQVARLSVIPEEGLEVVVTGRITAYGAQSKYNMNVDEVAVAGKGALMALL 120

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           EKRKK+L  EGLF    K P+P++P+II V+TSPTGAVIRDIL R+  RFP +V+I+PV 
Sbjct: 121 EKRKKQLEAEGLFEASRKRPLPYLPEIIGVVTSPTGAVIRDILHRLRDRFPRKVLIWPVA 180

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQG++C  E+A AI   N L  G   PRPD+II+ARGGGS+EDLW FN+E + RA A S 
Sbjct: 181 VQGEKCAPEVAAAIAGFNALVPGGALPRPDLIIVARGGGSVEDLWGFNEESVARAAAASD 240

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP+ISA+GHETD TL D+ +D RAPTPT AAE+AVPV+  L + +   +AR+   + + +
Sbjct: 241 IPLISAVGHETDTTLIDFVSDKRAPTPTAAAELAVPVRHELIAWVEQQDARMRQALSQGL 300

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
             +   L  + +ALP  D  L   R  +D     L   L   + R+      +   ++  
Sbjct: 301 TRRDQRLRDVARALPRPDSLLESPRQLVDTRGARLAPALMSGVQRRKIRLADVSGSLRPA 360

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLR----EQTKNRIFYL 416
            L   +Q   + + EK + ++  +   LR +   K++    +   R    EQ   R    
Sbjct: 361 MLTRAVQAEDRQLKEKARRLQPAL---LRALATRKEQLETRVRRYRPAVLEQDYRR---K 414

Query: 417 HTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQK 476
             H + ++ R+  +    + +    +    R+ ++ +YK TL RG+  ++ ++   +T  
Sbjct: 415 KQHFEDVVQRLGKVGEQNLDAARRKLDALGRLNETLSYKATLARGFAVVR-SDGAVVTDS 473

Query: 477 RNLATKTRILINFFDGQ 493
           +   T + + I F DG+
Sbjct: 474 KTAKTASSLEIQFADGR 490


>gi|260433213|ref|ZP_05787184.1| exodeoxyribonuclease VII, large subunit [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260417041|gb|EEX10300.1| exodeoxyribonuclease VII, large subunit [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 516

 Score =  346 bits (887), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 187/514 (36%), Positives = 283/514 (55%), Gaps = 38/514 (7%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           +P   +N+   PEY+VSE+S  +K  +E     + VRGE+ G      SGH Y+ +KD+ 
Sbjct: 26  DPIPGQNT---PEYTVSEISGEVKRTLEGTFGRIRVRGEV-GRVFKARSGHLYYDIKDDR 81

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           + +    WKG +  +  +PEEG+E +V G++T F   SKY + ++ +  +G G L+  LE
Sbjct: 82  NVLACTTWKGQIAGLSVVPEEGLEVVVTGRLTAFGAQSKYNMNVDEVAVAGQGALMALLE 141

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           KRKK+L  EGLF+ + K P+PF+P+II V+TSP+GAVIRDIL R+  RFP +V+I+PV V
Sbjct: 142 KRKKQLESEGLFAPERKKPLPFLPQIIGVVTSPSGAVIRDILHRLRDRFPRKVLIWPVAV 201

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QG  C  E+ANAI   N L  G   PRPD+II+ARGGGSIEDLW FN+E++ RA A S I
Sbjct: 202 QGANCASEVANAIRGFNRLAPGGALPRPDLIIVARGGGSIEDLWGFNEEIVARAAAASEI 261

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETD TL DY +D RAPTPT AAE+AVPV+  L +      ARL+      ++
Sbjct: 262 PLISAVGHETDTTLIDYVSDRRAPTPTAAAELAVPVRMELLAWTGEQGARLSRAATDAVQ 321

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            +   L  L +ALP  +  L   R RLD +   L   L+                     
Sbjct: 322 RRAQRLRDLSRALPRPETLLDGPRQRLDLIADRLAPALQ--------------------- 360

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHL----RYIFLEKKEKIAILHMLREQTKNRIFYLH 417
               +Q  R  ++E   H+     ++L    R        +++I  + R+  + R     
Sbjct: 361 --RGVQNRRLQVVELSGHLRPSTLRNLVAARRDTLRNLSSRLSIRPIQRDIQQQR----- 413

Query: 418 THIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKR 477
             + +L  R+    + ++      +  T R+ ++ +YK TL+RGY  +  + +  +T K 
Sbjct: 414 DRVNQLAQRMTAAQTLRVDRLRQQLDATDRLRETLSYKATLQRGYAVVH-SESGVVTTKA 472

Query: 478 NLATKTRILINFFDGQANAIVIN-KAPPKEQPTK 510
             +    + I F DG+   + ++   P  ++P+K
Sbjct: 473 QASKHAALTIEFADGELKTVPLSGTTPTAKKPSK 506


>gi|332185492|ref|ZP_08387240.1| exodeoxyribonuclease VII, large subunit [Sphingomonas sp. S17]
 gi|332014470|gb|EGI56527.1| exodeoxyribonuclease VII, large subunit [Sphingomonas sp. S17]
          Length = 473

 Score =  345 bits (886), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 167/368 (45%), Positives = 233/368 (63%), Gaps = 1/368 (0%)

Query: 16  SVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNK 75
           SV ELS  LK +VE    HV +RGEISGY+   +SGH Y SLKD ++ IDA++WKG  N 
Sbjct: 27  SVGELSLKLKRMVEGEFGHVRLRGEISGYK-RATSGHVYMSLKDENAVIDAVMWKGAANT 85

Query: 76  IEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSD 135
           + F P++GIE +  G++TTFPG SKYQI++E +  +G+G L+   EK K KL  EGLF  
Sbjct: 86  LPFQPQDGIEVIATGRLTTFPGRSKYQIVVERMELAGAGALMALFEKLKAKLAGEGLFDR 145

Query: 136 QHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANAIL 195
             K  +PF+P +I V+TSPTGAVIRDIL R+  R P  VI++PVKVQG    +E+A A+ 
Sbjct: 146 DRKRALPFMPPVIGVVTSPTGAVIRDILHRLEDRCPTHVIVWPVKVQGAGSAEEVAAAVR 205

Query: 196 QLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWTL 255
             + ++ G   PRPD++I+ARGGGSIEDLW FN+E++VRA+A+ +IPIISA+GHETD TL
Sbjct: 206 GFDAIQPGGPVPRPDLVIVARGGGSIEDLWSFNEEIVVRAVADCAIPIISAVGHETDTTL 265

Query: 256 ADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKALP 315
            DYAADLRAPTPT AAE+AVPV   L+ ++ +   R      R ++     L ++ + LP
Sbjct: 266 CDYAADLRAPTPTAAAEIAVPVLADLRLTVASHRQRTERCARRYVERGRERLEAMARLLP 325

Query: 316 NSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHILE 375
             DQ L   R R D     L+  LE  +       +     ++   L   +++ R  +  
Sbjct: 326 KRDQLLGPQRQRADEAGARLDRGLERRVTLARGGLDRAGAALRPAILERQVERGRDRLAS 385

Query: 376 KQQHIEQI 383
             + ++ +
Sbjct: 386 TWRLVQSL 393


>gi|294013432|ref|YP_003546892.1| exodeoxyribonuclease VII large subunit [Sphingobium japonicum
           UT26S]
 gi|292676762|dbj|BAI98280.1| exodeoxyribonuclease VII large subunit [Sphingobium japonicum
           UT26S]
          Length = 499

 Score =  345 bits (885), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 176/415 (42%), Positives = 253/415 (60%), Gaps = 17/415 (4%)

Query: 6   QKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRID 65
           +++  + P  SVSELS  LK  VE    HV +RGEISG++    SGH Y  LKD+++ ID
Sbjct: 19  ERSGDNAPPLSVSELSALLKRTVEDRFGHVRLRGEISGFK-RAGSGHIYLCLKDDNAVID 77

Query: 66  AIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKK 125
            ++WKG   ++ F P++G+E +  GK+TT+PG SKYQI+I+ +  +G G L+  LEK K+
Sbjct: 78  GVMWKGGAARLPFAPQDGVEVIATGKLTTYPGRSKYQIVIDRMELAGEGALMALLEKLKQ 137

Query: 126 KLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDE 185
           KL  EGLF    K  +PF+P++I V+TSPTGAVIRDIL R+  R P +V+++PV VQG  
Sbjct: 138 KLAAEGLFDRSAKRRLPFMPRVIGVVTSPTGAVIRDILHRLEDRCPTQVLLWPVLVQGQG 197

Query: 186 CPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIIS 245
             +++A A+   + ++ G   PRPD++I+ARGGGSIEDLW FN+E++VRA+A SSIPIIS
Sbjct: 198 AAEQVARAVRGFSAMQPGGPIPRPDLVIVARGGGSIEDLWSFNEEIVVRAVAESSIPIIS 257

Query: 246 AIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKIN 305
           A+GHETD TL DYAAD+RAPTPT AAEMAVPV+  L + L     R++  + R       
Sbjct: 258 AVGHETDTTLCDYAADMRAPTPTAAAEMAVPVRAELLAMLTEQGLRMDRAVRRGAAQARE 317

Query: 306 TLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHN 365
            L+   + +P  D  L+  R RLD+L   L   L   I     H       ++   L   
Sbjct: 318 RLDMQARLMPTPDTLLAPQRQRLDQLSDGLASALRHRIADARTHLGQAGGALRPALL--- 374

Query: 366 IQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420
               RQ++    +  E++ +  LR  +LE+      ++  R    +R+  L T +
Sbjct: 375 ----RQYV---NRAAERVARLQLRPDYLER------VYRDRATAFDRVSRLFTSV 416


>gi|288958827|ref|YP_003449168.1| exodeoxyribonuclease VII large subunit [Azospirillum sp. B510]
 gi|288911135|dbj|BAI72624.1| exodeoxyribonuclease VII large subunit [Azospirillum sp. B510]
          Length = 578

 Score =  345 bits (885), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 193/526 (36%), Positives = 289/526 (54%), Gaps = 19/526 (3%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           PE++V +L+  LK  +E     V VRGEIS  +  HSSGH Y  LKD+ + I+A+ W+GT
Sbjct: 63  PEFTVGDLARRLKRSIEEEFGFVRVRGEISQPK-KHSSGHCYMRLKDDTAVIEAVCWRGT 121

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
           + K+   PEEG+E +V G++TT+PG S+YQ+I+ES+  +G G LL  LE+RK++L  EGL
Sbjct: 122 MAKLAIRPEEGLEVIVTGRMTTYPGRSQYQLIVESMELAGEGALLKMLEERKRRLTAEGL 181

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F    K PIPF+P +I V+TSPTGAVIRDIL R++ RFP  V+++PV VQG+    E+  
Sbjct: 182 FDPARKKPIPFLPDVIGVVTSPTGAVIRDILHRLNDRFPRHVLLWPVAVQGERAAAEVTA 241

Query: 193 AILQLNTLK----EGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           AI   N ++    +G   PRPD+II+ARGGGS+EDL  FN+E +VRA A S+IP+ISA+G
Sbjct: 242 AIEGFNRIQPGGPQGSRVPRPDLIIVARGGGSLEDLMAFNEESVVRAAAASAIPLISAVG 301

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HETD TL D+A+DLRAPTPT AAEMAVPV+  L + +++ E RL     R +  + N + 
Sbjct: 302 HETDTTLIDFASDLRAPTPTAAAEMAVPVRGELLAQILDDERRLIACASRAVADRRNRVE 361

Query: 309 SLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQK 368
            L + L +    L     RLD     L      ++ R+         R +   L   ++ 
Sbjct: 362 GLARGLGDPRALLEGHAQRLDDRAERLNLAASALLERR---------RTRVGELAAKLRH 412

Query: 369 NRQHILEKQQHI---EQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH--IKKL 423
            R+ + +  Q +    + +   LR+       +   +      T  R         +  L
Sbjct: 413 PREKLAQAGQRLASESRALDSALRHAVTTAGGRFERVAGRLSPTPARAMLAEGERRVADL 472

Query: 424 ITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKT 483
             R++   +  +     +++   ++L+S++YK  L RG+  I+D +   +T         
Sbjct: 473 APRLDRSHAKGVADKAAALASLGQLLESYSYKGVLARGFALIEDRDGRPVTGADQATPGL 532

Query: 484 RILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
            + I F D    A  I+   PK +   + +    K      QG LF
Sbjct: 533 AVTIVFADDAKVAATIDGGAPKPESKPEKKAEPRKPRPIPVQGSLF 578


>gi|307296250|ref|ZP_07576077.1| exodeoxyribonuclease VII, large subunit [Sphingobium
           chlorophenolicum L-1]
 gi|306878052|gb|EFN09275.1| exodeoxyribonuclease VII, large subunit [Sphingobium
           chlorophenolicum L-1]
          Length = 499

 Score =  343 bits (881), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 186/505 (36%), Positives = 275/505 (54%), Gaps = 50/505 (9%)

Query: 6   QKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRID 65
           +++  + P  SVSELS  LK  VE    HV +RGEISG++    SGH Y  LKD+++ ID
Sbjct: 19  ERSGDNAPPLSVSELSALLKRTVEDRFGHVRLRGEISGFK-RAGSGHIYLCLKDDNAVID 77

Query: 66  AIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKK 125
            ++WKG   ++ F P++G+E +  GK+TT+PG SKYQI+I+ +  +G G L+  LEK K+
Sbjct: 78  GVMWKGGAARLPFAPQDGVEVIATGKLTTYPGRSKYQIVIDRMELAGEGALMALLEKLKQ 137

Query: 126 KLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDE 185
           KL  EGLF    K  +PF+P++I V+TSPTGAVIRDIL R+  R P +V+++PV VQG  
Sbjct: 138 KLAAEGLFDRSAKRRLPFMPRVIGVVTSPTGAVIRDILHRLEDRCPTQVLLWPVLVQGQG 197

Query: 186 CPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIIS 245
             ++IA A+   + ++ G   PRPD++I+ARGGGSIEDLW FN+E++VRA+A  SIPIIS
Sbjct: 198 AAEQIARAVRGFSAMQPGGPIPRPDLVIVARGGGSIEDLWSFNEEIVVRAVAECSIPIIS 257

Query: 246 AIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKIN 305
           A+GHETD TL DYAAD+RAPTPT AAEMAVPV+  L + L     R++  + R       
Sbjct: 258 AVGHETDTTLCDYAADMRAPTPTAAAEMAVPVRAELLAMLTEQGLRMDRAVRRGAAQARE 317

Query: 306 TLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHN 365
            L    + +P  D  L+  R RLD+L   L   L   I     H       ++   L   
Sbjct: 318 RLEMQARLMPTPDTLLAPQRQRLDQLSDGLGSALRHRIADARTHLGQASGALRPALL--- 374

Query: 366 IQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLIT 425
               RQ++    +  E++ +  LR  +LE+      ++  R    +R+  L T +   + 
Sbjct: 375 ----RQYV---SRAAERVARLQLRPDYLER------VYRDRATAFDRLSRLFTSVNPDL- 420

Query: 426 RIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRI 485
                                           L+RG+  +    +  +    +      +
Sbjct: 421 -------------------------------PLQRGFARVM-AGDRLVKSVADAQAAGAV 448

Query: 486 LINFFDGQANAIVINKAPPKEQPTK 510
            + F DG  +A +   AP ++ P +
Sbjct: 449 SLRFRDGAVDATIGGAAPLEKPPAE 473


>gi|326386127|ref|ZP_08207751.1| exodeoxyribonuclease VII large subunit [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326209352|gb|EGD60145.1| exodeoxyribonuclease VII large subunit [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 493

 Score =  343 bits (880), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 167/345 (48%), Positives = 224/345 (64%), Gaps = 5/345 (1%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           P  S+SELS  LK  VE     V VRGE+SG +   +SGH Y SLKD ++R+D ++W+G+
Sbjct: 26  PALSISELSQLLKRTVEDRFGFVRVRGELSGVK-RAASGHLYLSLKDENARLDGVMWRGS 84

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
           + ++ F P +G+E +  GK+TT+PG S YQI+I+ +  +G G LL  LEK K +L  EGL
Sbjct: 85  VQRLGFQPADGVEVIATGKLTTYPGRSNYQIVIDRMEIAGEGALLALLEKTKARLAAEGL 144

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F    K P+P++P++I V+TSPTGAVIRDIL R+  RFP  V+++PV VQG     ++A 
Sbjct: 145 FDPARKRPLPYLPRVIGVVTSPTGAVIRDILHRLRDRFPSHVVVWPVLVQGQGAASQVAA 204

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           A+   + L+ G    RPD++I+ARGGGSIEDLW FN+E +VRAIA S+IP+ISA+GHETD
Sbjct: 205 AVRGFSELEPGGPVARPDLVIVARGGGSIEDLWSFNEEEVVRAIAASTIPVISAVGHETD 264

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            TLAD+AAD RAPTPT AAEMAVPV+  L + L +LEAR    + R +      L+   +
Sbjct: 265 TTLADFAADRRAPTPTAAAEMAVPVRAELMAGLADLEARRQRALGRQLAQARERLDQRAR 324

Query: 313 ALPNSDQTLSCSRYRLD----RLPRELEHNLEIIIFRKYRHFNHI 353
            LP     LS    RLD    RL R L H  E+      RH   +
Sbjct: 325 RLPPPHALLSGQAQRLDDLGERLRRSLGHRTELAAAMLARHAGSL 369


>gi|254474563|ref|ZP_05087949.1| exodeoxyribonuclease VII, large subunit [Ruegeria sp. R11]
 gi|214028806|gb|EEB69641.1| exodeoxyribonuclease VII, large subunit [Ruegeria sp. R11]
          Length = 521

 Score =  342 bits (877), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 193/542 (35%), Positives = 290/542 (53%), Gaps = 48/542 (8%)

Query: 5   SQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRI 64
           S +   + PE++VSE+S  +K  +E     + V+GE+ G      SGH Y+ +KD+ S +
Sbjct: 11  SDRPGQNAPEFTVSEISGEVKRTLEGTFGRIRVKGEV-GRVFKARSGHLYYDIKDDRSVL 69

Query: 65  DAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRK 124
               WKG ++ +  +PEEG+E +V G++T F G SKY + ++ +  +G G L+  LEKRK
Sbjct: 70  ACTTWKGQISSLSVVPEEGLEVVVTGRLTAFGGQSKYNMNVDEVAVAGQGALMALLEKRK 129

Query: 125 KKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGD 184
           K+L  EGLF+ + K P+P++P+II V+TSP+GAVIRDIL R+  RFP +V+++PV VQG 
Sbjct: 130 KQLESEGLFAPERKKPLPYLPQIIGVVTSPSGAVIRDILHRLRDRFPRKVLVWPVAVQGA 189

Query: 185 ECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPII 244
            C  E+A AI   N L  G   PRPD+II+ARGGGSIEDLW FN+E++ RA A S IP+I
Sbjct: 190 NCAAEVARAIDGFNQLTPGGALPRPDLIIVARGGGSIEDLWGFNEEIVARAAAGSQIPLI 249

Query: 245 SAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKI 304
           SA+GHETD TL D+ +D RAPTPT AAE+AVPV+  L   +    ARL     + ++ + 
Sbjct: 250 SAVGHETDTTLIDFVSDRRAPTPTAAAELAVPVRLELLGWVEQQGARLTRGAGQAVQIRR 309

Query: 305 NTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
             LN L +ALP  D  L   R RLD++               YR           D LI 
Sbjct: 310 QRLNDLSRALPKPDTLLETPRQRLDQV--------------SYRL---------PDALIR 346

Query: 365 NIQKNRQHILE-----KQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH 419
            + + R  + E     +   + Q+V Q  R        ++++  + RE  +         
Sbjct: 347 GVDRRRLKLSEAAASLRPATLRQLV-QGRRDGLKNLSSRLSLRPIEREVARQ-----GDR 400

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
           + +L  R+  + S +++     +  T R L+  +YK TL RGY  ++   ++ +T+    
Sbjct: 401 LTQLAQRMNALQSQRLQQARRGLDATGRQLEILSYKATLDRGYAVVRH-GSDVVTRAAGA 459

Query: 480 ATKTRILINFFDGQ---------ANAIVINKAPPKEQPTKKCQLHNNKRE---KQGTQGE 527
                + I F DG+         A A  + ++  +     K      K +     G QG 
Sbjct: 460 RGADHLRIEFADGEIAVHPDGSDAGAKTVQQSTAQTSAPSKPAARKPKADPGQDDGGQGT 519

Query: 528 LF 529
           LF
Sbjct: 520 LF 521


>gi|306841706|ref|ZP_07474393.1| exodeoxyribonuclease VII, large subunit [Brucella sp. BO2]
 gi|306288236|gb|EFM59620.1| exodeoxyribonuclease VII, large subunit [Brucella sp. BO2]
          Length = 437

 Score =  342 bits (877), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 170/429 (39%), Positives = 261/429 (60%), Gaps = 8/429 (1%)

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
           + ++ F PEEG+E +  GK+TT+PGSSKYQI+IE + P+G+G L+  LE+RK++L  EGL
Sbjct: 1   MGRLRFRPEEGMEVIATGKLTTYPGSSKYQIVIEQMEPAGAGALMALLEERKRRLAAEGL 60

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F    K  +PF+P++I V+TSPTGAVIRDI+ RIS R+PLRVI++PV+VQGD C  E+A 
Sbjct: 61  FDPALKQLLPFMPRVIGVVTSPTGAVIRDIIHRISDRYPLRVIVWPVRVQGDTCGPEVAM 120

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           A+   N L +    PRPD++I+ARGGGS+EDLW FNDE++VRA+A S IP+ISA+GHETD
Sbjct: 121 AVNGFNALPDDGPIPRPDVLIVARGGGSLEDLWGFNDEIVVRAVAASHIPVISAVGHETD 180

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           WTL D AAD+RAPTPTGAAEMAVPVK  LQ++L +  ARL++ + R    K     +  +
Sbjct: 181 WTLIDLAADMRAPTPTGAAEMAVPVKADLQAALASQSARLSSTMSRFFDQKRQAHRAAAR 240

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
           A+P++DQ L+  R R D     L   L +   +K  HF+    ++    L   + +  + 
Sbjct: 241 AMPSADQLLALPRRRFDEAASRLTRALFVNTQKKRVHFDGHARQLSPRLLQRRLVELERG 300

Query: 373 ILEKQQHIEQIVKQHL---RYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEF 429
           +    Q + + ++  L   R  F  +  +++   +LR     R     + +++L  R + 
Sbjct: 301 VTMLGQRLPRALEAFLRERRTAFTHRANRLSPEPILR-----RTRLTGSTLEQLDRRRDQ 355

Query: 430 ILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINF 489
            +   I+          R++++ +Y++ L+RG+  + D     + Q   ++    + + F
Sbjct: 356 AVRLLIERVKRRSQELDRLMRTLSYESVLERGFAVVFDAQGKPVKQAAAVSPGDALSVRF 415

Query: 490 FDGQANAIV 498
            DG    + 
Sbjct: 416 RDGDVGVVA 424


>gi|56696229|ref|YP_166586.1| exodeoxyribonuclease VII large subunit [Ruegeria pomeroyi DSS-3]
 gi|81820092|sp|Q5LTR9|EX7L_SILPO RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|56677966|gb|AAV94632.1| exodeoxyribonuclease VII, large subunit [Ruegeria pomeroyi DSS-3]
          Length = 482

 Score =  341 bits (875), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 185/505 (36%), Positives = 272/505 (53%), Gaps = 28/505 (5%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           PE++V+E+S  +K  +E +   + VRGE+ G      SGH Y+ +KD+ + +    WKG 
Sbjct: 2   PEFTVTEISGEVKRTLEGSFGRIRVRGEV-GRVFQARSGHLYYDIKDDRNVLACTTWKGQ 60

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
           +  +  +PEEG+E +V G++T F   SKY + ++ +  +G G L+  LEKRKK+L  EGL
Sbjct: 61  VASLSVVPEEGLEVVVTGRLTAFGAQSKYNLNVDEVAVAGQGALMALLEKRKKQLEAEGL 120

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F+ + K P+P++P+II VITSP GAVIRDIL R+  RFP +V+I+PV VQG  C  E+A 
Sbjct: 121 FAPERKRPLPYLPQIIGVITSPQGAVIRDILHRLRDRFPRKVLIWPVAVQGANCAPEVAR 180

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N    G   PRPD++I+ARGGGSIEDLW FN+E++ RA A S IP+ISA+GHETD
Sbjct: 181 AIEGFNMFSPGGALPRPDLLIVARGGGSIEDLWGFNEEIVARAAAASQIPLISAVGHETD 240

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            TL D+ +D RAPTPT AAEMAVPV+  L +      ARL+      ++ +   L  L +
Sbjct: 241 TTLIDFVSDRRAPTPTAAAEMAVPVRLELLAWTGEQGARLSRAASDAVQRRAQRLRDLSR 300

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
           ALP  D  L   R RLDR    L   L   + R+      +   ++   L   +   R H
Sbjct: 301 ALPRPDSLLDTPRQRLDRAAERLPAALTQGVQRRRLRLAELSAPLRPASLRALVSARRDH 360

Query: 373 ILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILS 432
           +             HL         +++   + RE     I      + +L  R+    +
Sbjct: 361 L------------AHL-------GSRLSPRALERE-----IAAQGERLTRLSDRLNSAQT 396

Query: 433 HKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDG 492
            +I+     +    R+ ++  YK TL RGY  ++D     +T +   A    + I F DG
Sbjct: 397 TRIERLRQRLESADRLRETLGYKATLARGYAVVRDDQGALLTTRAQAAKAAALQIEFADG 456

Query: 493 ---QANAIVINKAPPKEQPTKKCQL 514
                 A     + PK++P ++  L
Sbjct: 457 TLDTGGAPAKPASKPKQKPPEQGSL 481


>gi|163797950|ref|ZP_02191892.1| Exodeoxyribonuclease VII [alpha proteobacterium BAL199]
 gi|159176744|gb|EDP61315.1| Exodeoxyribonuclease VII [alpha proteobacterium BAL199]
          Length = 494

 Score =  340 bits (873), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 186/488 (38%), Positives = 276/488 (56%), Gaps = 33/488 (6%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHS-SGHAYFSLKDNHSRIDAIIWKG 71
           PE++V E+S  +K  VES    V VRGEIS  R   + SGH Y SLKD+ + ++A+ W+G
Sbjct: 16  PEFTVGEVSLAVKRTVESAFERVRVRGEIS--RPTRAGSGHLYLSLKDDQAVLEAVCWRG 73

Query: 72  TLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEG 131
              ++   PEEG E +  GK+TT+PG SKYQ++IE +  +G G LL  LE R+K+L  EG
Sbjct: 74  QAQRLSIQPEEGTEVIATGKLTTYPGRSKYQMVIEQMELAGEGALLKLLEDRRKRLTAEG 133

Query: 132 LFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIA 191
           LF  + K PIPF+P +I V+TSPTGAVIRDIL R++ RFP+ VI++PV VQG+   ++IA
Sbjct: 134 LFEVERKRPIPFLPSVIGVVTSPTGAVIRDILHRLADRFPVHVIVWPVLVQGEGAKEQIA 193

Query: 192 NAILQLNTL-KEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHE 250
           NAI   N L   G    RPD++I+ARGGGS+EDLW FN+E++VRA A S IP+ISA+GHE
Sbjct: 194 NAIAGFNALPATGGKVARPDLLIVARGGGSLEDLWAFNEEIVVRAAAASDIPLISAVGHE 253

Query: 251 TDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSL 310
           TD TL D+A+D RAPTPT AAEMAVPV+  L + +    AR+ + + R +      L  L
Sbjct: 254 TDTTLIDFASDRRAPTPTAAAEMAVPVRADLVARIAENAARIAHAVARRLTDGTTRLTGL 313

Query: 311 LKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNR 370
            + L +    +  ++ RLD   +    +L   +    R  + +  R+ + F I    + R
Sbjct: 314 ARGLGDPAARIEQAQQRLDYAGQTAGASLTRTL---ERLADRVERRLPTPFEILARTEGR 370

Query: 371 QHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFI 430
                        +   LR +      +IA +    +QT      L       + R   +
Sbjct: 371 -------------LNAALRGL------RIAPVEQRLDQTSREFIRLAKASDSAVDRFLKV 411

Query: 431 LSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFF 490
            S ++K+         R+L++ ++   L RG+  ++D +   +T   +      + + F 
Sbjct: 412 ESDRLKALE-------RVLEANSFVRVLDRGFALVRDADGTPVTSADDARDGQAVTLRFR 464

Query: 491 DGQANAIV 498
           DG+  A+V
Sbjct: 465 DGERAAVV 472


>gi|254293365|ref|YP_003059388.1| exodeoxyribonuclease VII large subunit [Hirschia baltica ATCC
           49814]
 gi|254041896|gb|ACT58691.1| exodeoxyribonuclease VII, large subunit [Hirschia baltica ATCC
           49814]
          Length = 559

 Score =  340 bits (872), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 183/504 (36%), Positives = 283/504 (56%), Gaps = 15/504 (2%)

Query: 11  DHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           + PE SVSELS  LK  VE   S+V VRGE+ G   +  SGH Y  LKD+ + ++ I+WK
Sbjct: 27  NSPEMSVSELSNRLKRTVEDAYSYVRVRGEL-GRVTLAKSGHLYVDLKDDKAVLNTIMWK 85

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           G ++K+ F PEEG+E +  G+++T+PG S YQ+I ES+ P+G G L+  LE+RKKKL  E
Sbjct: 86  GQVSKLPFKPEEGLEVIAEGRLSTYPGRSNYQMIAESMRPAGVGALMQLLEERKKKLAAE 145

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEI 190
           GLF+ +HK  +PF+P+ I V+TSPTGAVIRDIL R+  RFP  V+I+P  VQG+    ++
Sbjct: 146 GLFNPEHKKELPFLPETIGVVTSPTGAVIRDILHRVKERFPTHVLIWPALVQGEHAAAQV 205

Query: 191 ANAILQLNTLK-EGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGH 249
           A  I   N +    R   RPD+II+ARGGGS+EDLW FNDE +VRA+  S IPIISA+GH
Sbjct: 206 AGGIRGFNAIGPAARKIKRPDLIIVARGGGSVEDLWPFNDEDVVRAVFESEIPIISAVGH 265

Query: 250 ETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNS 309
           ETD TL D+ +D RAPTPTGAAE+A+PV+  L ++   L AR    + R +      L +
Sbjct: 266 ETDTTLIDFVSDRRAPTPTGAAEIALPVRAELIATTDALGARGKRALQRGVDTSKVELRA 325

Query: 310 LLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKN 369
           +   +P  +  +   R RLD    +L   L+ I+ R         + ++   L       
Sbjct: 326 VTARMPRPEMLVQGVRQRLDYASEKLGFALKDIVVRMRSRLQQASSGLQPLAL------- 378

Query: 370 RQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILH-----MLREQTKNRIFYLHTHIKKLI 424
           ++ ++ ++  ++ +  +    +  +  ++  +LH      L    +N        ++   
Sbjct: 379 QREMVRRKTALDTLYMRASFALRRDAGDRSKLLHGIYGRFLARDPRNTFGRKQDLVEATF 438

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
            R    +   I   + ++    R+L S +++N L RG+  +Q  N   +    ++ +  R
Sbjct: 439 HRSTVAMERLIGKKYENLETVNRLLSSVSHENVLARGFVLVQRMNGELVRHASDVDSSER 498

Query: 485 ILINFFDGQANAIVINKAPPKEQP 508
           + + F D +   +  +   P+E P
Sbjct: 499 LRLQFIDDEVR-VTSDPKTPQEAP 521


>gi|167645191|ref|YP_001682854.1| exodeoxyribonuclease VII large subunit [Caulobacter sp. K31]
 gi|189037852|sp|B0SY33|EX7L_CAUSK RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|167347621|gb|ABZ70356.1| exodeoxyribonuclease VII, large subunit [Caulobacter sp. K31]
          Length = 528

 Score =  340 bits (871), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 186/525 (35%), Positives = 283/525 (53%), Gaps = 15/525 (2%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           P YSVSEL++ LK  +E++ + V +RGE+S     H +GH Y ++KD+ S ID ++WKG 
Sbjct: 11  PAYSVSELAFALKRTLETSYAFVRLRGELSKVTH-HGNGHVYLTIKDDKSAIDGVVWKGN 69

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
           +  +   PE G+E +V GKITT+P  S+YQI+IE++  +G G LL  LE+ K KL  EGL
Sbjct: 70  VRGLGIRPEHGLEVIVTGKITTYPAGSRYQIVIETMEAAGVGALLAQLERLKAKLNAEGL 129

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F+   K P+P +P ++ VITSPTGAVIRDIL RI  R+P +V+++P  VQGD    +++ 
Sbjct: 130 FAPDRKRPLPSMPAVVGVITSPTGAVIRDILHRIRDRWPCQVLVWPCVVQGDAAAGQVSA 189

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N L  G   PRPDI+I+ARGGGS+EDLW FNDE + R +A  +IP+ISA+GHETD
Sbjct: 190 AIRGFNALTPGGPVPRPDILIVARGGGSVEDLWAFNDEGLARTVAEGTIPLISAVGHETD 249

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            TL D+ +D RAPTPT AAEMA PV   L++ + + + RLNN   R ++ +   L S  +
Sbjct: 250 TTLIDFVSDRRAPTPTAAAEMATPVLAELRALVSDYDRRLNNCGGRAVEERRTRLTSAAR 309

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQ- 371
            LP     L+ ++ RLD   R L   L+ +     R F     R+ +      +Q+N   
Sbjct: 310 GLPRPADLLALAQQRLDLAVRGLPR-LDDLTAPAERRFKEAAARLDT-----ALQRNTDI 363

Query: 372 HILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRI---FYLHTHIKKLITRIE 428
           H  +  +   ++    L     +   ++  L    +    R+      H  +  L  R+ 
Sbjct: 364 HARDLLKVTARLSPDTLHRQRADAGRRVGDLGRRLDLAARRVPERVAQHARLPALQDRLN 423

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
            +   +++     ++   ++ QS      L+ G+  +   +         LA+  R+ + 
Sbjct: 424 AVARRRLERETDRLAGLEKLRQSLNPTRPLELGFALVHKADGGIARSASELASGERVRLQ 483

Query: 489 FFDGQANAIVINKA----PPKEQPTKKCQLHNNKREKQGTQGELF 529
           F  G  +A++  ++    PP   P         K      QG LF
Sbjct: 484 FRQGDRDAVIDGESSGVLPPSAAPAPTRPTPRPKPASSSDQGSLF 528


>gi|114771711|ref|ZP_01449115.1| exodeoxyribonuclease VII, large subunit [alpha proteobacterium
           HTCC2255]
 gi|114547783|gb|EAU50673.1| exodeoxyribonuclease VII, large subunit [alpha proteobacterium
           HTCC2255]
          Length = 452

 Score =  340 bits (871), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 180/397 (45%), Positives = 255/397 (64%), Gaps = 18/397 (4%)

Query: 11  DHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           + PE+SVSELS  LK ++E   S+V +RGE+ G     +SGH YF LKD+ S I ++ WK
Sbjct: 13  NAPEFSVSELSSVLKRMIEGEFSNVRIRGEV-GRVSRPASGHLYFDLKDDKSVIASVTWK 71

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           G  +K+   PEEG+E +  GKITTF G S+YQ+I+  +  +G G L+  LEKRKKKL  E
Sbjct: 72  GQASKLVTQPEEGLEVVATGKITTFAGQSRYQMIVSEMSVAGIGALMAQLEKRKKKLEAE 131

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEI 190
           GLF    K  IP++P+II V+TSP+GAVI+DIL R+S RFP +V+++PV VQG+ C  ++
Sbjct: 132 GLFDKSIKKEIPYLPEIIGVVTSPSGAVIQDILHRLSDRFPRKVLLWPVAVQGERCAPDV 191

Query: 191 ANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHE 250
           A AI   N L  G   PRP++II+ARGGGSIEDLW FN+E +VRA A S IP+ISA+GHE
Sbjct: 192 AAAINGFNRLTPGGAMPRPELIIVARGGGSIEDLWGFNEESVVRAAAESEIPLISAVGHE 251

Query: 251 TDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSL 310
           TD TL D+A+DLRAPTPT AAE AVPV+  L   L +++ R    +   ++ K   L  L
Sbjct: 252 TDTTLIDFASDLRAPTPTAAAEYAVPVRADLMGWLSSMDERRVRSLSAGLEIKRQRLKDL 311

Query: 311 LKALPNSDQTLSCSRYRLD----RLPREL---EHNLEIIIFRKYRHF------NHIINRI 357
            + LP  D+ ++ S  RLD    RLPR L    +N   ++ +           N +++R 
Sbjct: 312 SRGLPAPDELVAMSTQRLDSISERLPRALITVSNNKRTMLLQTSAGLRGSLLKNKLVDRS 371

Query: 358 KS-DFLIHNIQKNRQHILEKQQH-IEQI--VKQHLRY 390
           ++ +  + +IQ N + I+++ Q  +E +  ++Q L Y
Sbjct: 372 EAINRFVKSIQSNMKVIIQRNQSALESLERLRQTLGY 408


>gi|329851150|ref|ZP_08265907.1| exodeoxyribonuclease VII, large subunit [Asticcacaulis biprosthecum
           C19]
 gi|328839996|gb|EGF89568.1| exodeoxyribonuclease VII, large subunit [Asticcacaulis biprosthecum
           C19]
          Length = 520

 Score =  340 bits (871), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 190/491 (38%), Positives = 276/491 (56%), Gaps = 17/491 (3%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           P YSVSEL+  LK  +E    HV +RGEIS     H+SGH Y +LKD+ + ID +IWKG 
Sbjct: 18  PAYSVSELAGALKRTLEQTYDHVRLRGEISKVT-RHASGHIYLTLKDDKANIDGVIWKGQ 76

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
            ++++  P+ G+E +V G+ITTFP SSKYQI+IE +  +G G LL  LE+ K+KL  EGL
Sbjct: 77  ASRLQTQPDYGLEVIVTGRITTFPASSKYQIVIEQMEVAGVGALLAQLERLKQKLNAEGL 136

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F  + K P+P+ P+ I VITSPTGAVIRDIL RI  R+P RVI++PV VQGD  P +I N
Sbjct: 137 FRPERKKPLPYAPRTIGVITSPTGAVIRDILHRIRDRWPCRVIVWPVVVQGDAAPPQIIN 196

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           A+       E    PRPD+II+ARGGGS+EDLW FNDE + RA+   SIP+ISA+GHETD
Sbjct: 197 ALRGF----ESGAVPRPDVIIVARGGGSVEDLWPFNDEALARAVFACSIPVISAVGHETD 252

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            TL D+ +D RAPTPTGAAE+A PV   L++   +LE R    + R ++ +   L  L +
Sbjct: 253 TTLIDHVSDRRAPTPTGAAELATPVIGELRALAADLERRRQACMSRGLETRREKLALLAR 312

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
           ALP     +  ++ RLD + + L  +L   +   +  F     R+    L   ++ +RQ 
Sbjct: 313 ALPRPTDLIDSAQQRLDFVAQRLTGSLSQNLNLHHNAFTKASARLSPLLLTRQVEHSRQR 372

Query: 373 ILEKQQHIEQIVKQHL-----RYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRI 427
           +    Q +   +K H+     R+  LE +   A+   L       I   H  +  L  R+
Sbjct: 373 LDHAGQRLGGALKSHVDRATSRFAPLEGRLDGALTRRL------AIAQQHARLPDLERRM 426

Query: 428 EFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILI 487
              +   +      +    ++  S +    L  G+ ++ +   + +TQ   ++    + +
Sbjct: 427 GDAMQRLLSRQSERLQRLDQLRVSLSPTRPLDLGF-ALVEREGHVVTQAAAVSAGDVLTL 485

Query: 488 NFFDGQANAIV 498
            F DG+   I 
Sbjct: 486 TFKDGKTTVIA 496


>gi|114569179|ref|YP_755859.1| exodeoxyribonuclease VII large subunit [Maricaulis maris MCS10]
 gi|114339641|gb|ABI64921.1| Exodeoxyribonuclease VII large subunit [Maricaulis maris MCS10]
          Length = 485

 Score =  338 bits (868), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 165/326 (50%), Positives = 224/326 (68%), Gaps = 1/326 (0%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           E++VSEL+  LK  VE    HV +RGE+ G   +  SGH YF +KD+ + I +I WKGT 
Sbjct: 10  EFTVSELAGSLKRTVEDAFGHVRLRGEL-GRVVVAKSGHVYFDIKDDKAVIASIAWKGTA 68

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            +  F PEEG+E ++ G+++T+PG S+YQ+I+ES+ P+G+G L+  LE+RK+ L  EGLF
Sbjct: 69  QRFRFRPEEGLEVVIEGRLSTYPGRSQYQLIVESMEPAGAGALMALLEERKRTLAAEGLF 128

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
               K  +PF+P+ I V+TSPTGAVIRDIL R+  RFP  V+++PV VQGD    +IA A
Sbjct: 129 ETSRKQALPFLPRTIGVVTSPTGAVIRDILHRLQDRFPCHVLLWPVLVQGDSAAAQIAEA 188

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N L  G   PRPD++I+ARGGGSIEDLW FN+E++VRA A+S+IP+ISA+GHETD 
Sbjct: 189 IRGFNALPAGGKVPRPDVLIVARGGGSIEDLWAFNEEVVVRAAADSTIPLISAVGHETDT 248

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D+A+D RAPTPTGAAEMAVPV+  L++SL  L  RL   + R I+ +   L S  +A
Sbjct: 249 TLIDFASDRRAPTPTGAAEMAVPVRAELKASLDQLGGRLVAGLSRHIERRRTELRSAARA 308

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNL 339
           LP     +   R R D +  +L+  L
Sbjct: 309 LPRPAALMELKRQRFDMIADKLDPAL 334


>gi|159045267|ref|YP_001534061.1| exodeoxyribonuclease 7 large subunit [Dinoroseobacter shibae DFL
           12]
 gi|157913027|gb|ABV94460.1| exodeoxyribonuclease 7 large subunit [Dinoroseobacter shibae DFL
           12]
          Length = 523

 Score =  338 bits (867), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 191/524 (36%), Positives = 286/524 (54%), Gaps = 20/524 (3%)

Query: 11  DHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           + PE++VSELS  +K  +E     V VRGEI G      SGH YF LKD  + I+   WK
Sbjct: 15  NAPEFTVSELSGAIKRTLEGEFGRVRVRGEI-GRVMRAKSGHLYFDLKDARAVINCTTWK 73

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           G ++ +  +PEEG+E +  GK++ +  +S+Y I ++ +  +G G L+  LEKRK  L  E
Sbjct: 74  GQVSGLGVMPEEGLEVVAEGKLSAYAPASRYNINVDRISVAGIGALMAMLEKRKAALTAE 133

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEI 190
           GLF    K P+PF+P++I V+TSP+GAVIRDIL R+  R P +V+I+PV VQG  C  E+
Sbjct: 134 GLFEASRKQPLPFLPEVIGVVTSPSGAVIRDILHRLRDRCPRKVLIWPVAVQGQNCAPEV 193

Query: 191 ANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHE 250
           ANAI   N L  G   PRPD++I+ARGGGS+EDLW FN+E++VRA A S IP+ISA+GHE
Sbjct: 194 ANAIRGFNALGPGGPLPRPDLLIVARGGGSLEDLWGFNEEIVVRAAAESDIPLISAVGHE 253

Query: 251 TDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSL 310
           TD TL DYAAD RAPTPT AAE AVPV+  L ++L +L +R+   +   ++ +   +  L
Sbjct: 254 TDTTLIDYAADWRAPTPTAAAERAVPVRLDLLAALDSLGSRMLTGLTGGVRARAQRVRDL 313

Query: 311 LKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNR 370
            +ALP S+  LS  R RLD     L   L      K          ++   L   I+  R
Sbjct: 314 SRALPRSEDLLSTPRQRLDHATARLPAALRSATQTKRGALTQAAAVLRPRLLAGRIEAER 373

Query: 371 QHILEKQQHIEQIVKQHLRYIFLEKKEKIA-----ILHMLREQTKNRIFYLHTHIKKLIT 425
           + +      +   + + +       + ++A     IL   R + + R+  L   + +  T
Sbjct: 374 KDLRAASARLGAALPRAVAAQAERLRTRVARLRGEILTQGRARDQQRLEALSARLSRAGT 433

Query: 426 RIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRI 485
                   ++++   ++    R+  +  Y+ TLKRGY  ++D  ++ +T     AT   +
Sbjct: 434 -------AQVRTWRRTLDGLDRVRATVGYEATLKRGYAVVRD-QDSIVTTAAAAATHPSL 485

Query: 486 LINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
            + F DG+   ++ N +    +P K        +     QG LF
Sbjct: 486 EVQFADGRVT-VIPNASAEGARPRK-----GRSKSAPDDQGSLF 523


>gi|192973054|gb|ACF06953.1| exodeoxyribonuclease VII large subunit [uncultured Roseobacter sp.]
          Length = 517

 Score =  338 bits (866), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 180/487 (36%), Positives = 271/487 (55%), Gaps = 12/487 (2%)

Query: 11  DHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHS-SGHAYFSLKDNHSRIDAIIW 69
           + PE++VSE+S  +K  +E+    + V+GE+   R + + SGH YF +KD  + +    W
Sbjct: 13  NAPEFTVSEISGAVKRTLEAEFGRIRVKGEVG--RVVQARSGHMYFDVKDERNALACTTW 70

Query: 70  KGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLE 129
           KG ++K+  LPEEG+E +V GK+T+F G SKY + ++ +  +G G L+  LEKRK  L  
Sbjct: 71  KGQVSKLSVLPEEGMEVVVSGKMTSFGGQSKYNLNVDDVAVAGVGALMAMLEKRKTALAA 130

Query: 130 EGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKE 189
           EGLF    K  +PF+P +I V+TSPTGAVIRDIL R+  RFP +V+++PV VQG  C  E
Sbjct: 131 EGLFDPARKQALPFLPDVIGVVTSPTGAVIRDILHRLRDRFPRKVLVWPVAVQGANCAAE 190

Query: 190 IANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGH 249
           +A AI   N +  G   PRPD++I+ARGGGSIEDLW FN+E++ RA A S IP+ISA+GH
Sbjct: 191 VARAIAGFNAMTPGGALPRPDLLIVARGGGSIEDLWGFNEEIVARAAAASEIPLISAVGH 250

Query: 250 ETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNS 309
           ETD TL D+ +D+RAPTP+ AAE+AVPV+  L +      AR    +  ++  +   L  
Sbjct: 251 ETDTTLIDFVSDMRAPTPSAAAELAVPVRLDLLAETRAKGARAAQGLANIMARRKQRLAD 310

Query: 310 LLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH-NIQK 368
           + +ALP  D     ++ RLD     L   L  ++ ++         +IK   L    +Q+
Sbjct: 311 VSRALPRPDSLTQTAQQRLDHWEGRLPLGLRSLVQKQQLRLTASAGQIKPSALGRILVQE 370

Query: 369 NRQHILEKQQHIEQIVKQHLRYIFLEKKEKI-AILHMLREQT-KNRIFYLHTHIKKLITR 426
            RQ      Q + Q +   L    L  ++ + A    LR      R+  L   +  L TR
Sbjct: 371 ARQL-----QALGQRLPAGLDRAALSARQMLRACASRLRPAPLAERVARLRKDLDDLETR 425

Query: 427 IEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRIL 486
           +E     +++     +    R+ ++  Y+ TL+RGY  ++ +    IT          + 
Sbjct: 426 LEQTFERQLQRRREQLVACDRLRETLGYRETLRRGYAVVR-SGQALITNVAKAEAAKSLE 484

Query: 487 INFFDGQ 493
           I F DG+
Sbjct: 485 IEFADGR 491


>gi|83950855|ref|ZP_00959588.1| exodeoxyribonuclease VII, large subunit [Roseovarius nubinhibens
           ISM]
 gi|83838754|gb|EAP78050.1| exodeoxyribonuclease VII, large subunit [Roseovarius nubinhibens
           ISM]
          Length = 519

 Score =  337 bits (864), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 186/500 (37%), Positives = 277/500 (55%), Gaps = 25/500 (5%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           +P   +N    PEY+VSE+S  +K  +E N   V VRGE+ G      SGH Y+ +KD+ 
Sbjct: 7   DPLPGQN---MPEYTVSEISGEVKRTLEGNFGRVRVRGEV-GRVFKARSGHLYYDVKDDK 62

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           + +    WKG +  +   PEEG+E +V G++T F   SKY + ++ +  +G G L+  LE
Sbjct: 63  NVLACTTWKGQVAGLSVEPEEGLEVVVTGRLTAFGAQSKYNLNVDEVAVAGQGALMALLE 122

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           KR+K L  EGLF +  K PIP++P+II V+TSP+GAVIRDIL R+  RFP +V+I+PV V
Sbjct: 123 KRRKALAAEGLFDEGRKRPIPYLPEIIGVVTSPSGAVIRDILHRLRDRFPRKVLIWPVAV 182

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QG     E+A AI   N L  G   PRPD+II+ARGGGSIEDLW FN+E++VRA A S I
Sbjct: 183 QGQSSAAEVARAIAGFNALTPGGALPRPDLIIVARGGGSIEDLWGFNEEIVVRAAAASEI 242

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETD TL D+A+D RAPTPT AAE+AVPV+  L + L    ARL++ +   ++
Sbjct: 243 PLISAVGHETDTTLIDFASDKRAPTPTAAAELAVPVRLDLLAWLDGQSARLSHALSSGVE 302

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLD----RLPRELEHNLEIIIFRKYRHFNHIINRI 357
            +   L  L +ALP  D  L   R RLD    RLP  L  ++++   R+ R  +     +
Sbjct: 303 RRGQRLRDLGRALPRVDSLLDGPRQRLDVWGERLPAALIRSVQM---RRVR-LSDAAGAL 358

Query: 358 KSDFLIHNIQKNRQHILEKQQHIEQIV-----KQHLRYIFLEKKEKIAILHMLREQTKNR 412
           +   L   ++   Q + +  + +   +     +   RY  +  +         R +    
Sbjct: 359 RPAALRGKLRDQGQRLTQTGERLGHALGARTERGRERYDAMSAR-------FGRVEPHEA 411

Query: 413 IFYLHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNF 472
           +      + +L  R   + + +IK     +    R+ ++ +YK TL+RGY  ++  + + 
Sbjct: 412 LQRRREDLTRLSDRFGQVGARQIKDWRDRLDALDRLRETLSYKATLERGYAVVR-GDGDL 470

Query: 473 ITQKRNLATKTRILINFFDG 492
           I           + I F DG
Sbjct: 471 IKSAAAAGRAQNLEIEFADG 490


>gi|85709867|ref|ZP_01040932.1| exodeoxyribonuclease VII large subunit [Erythrobacter sp. NAP1]
 gi|85688577|gb|EAQ28581.1| exodeoxyribonuclease VII large subunit [Erythrobacter sp. NAP1]
          Length = 494

 Score =  336 bits (862), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 181/483 (37%), Positives = 271/483 (56%), Gaps = 49/483 (10%)

Query: 16  SVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNK 75
           S++E+S  LK  VE    +V +RGE+SG +   +SGH Y +LKD+ + +D ++W+G   +
Sbjct: 28  SITEISQALKRTVEERFGYVRLRGELSGVK-RAASGHMYLALKDDKAVLDGVMWRGNAGR 86

Query: 76  IEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSD 135
           + F+PE+GIE +  GK+TT+PG SKYQI+I+SL  +G G LL  LEK + +L  EGLF+ 
Sbjct: 87  LAFVPEDGIEVIATGKLTTYPGRSKYQIVIDSLEIAGEGALLALLEKTRLRLEAEGLFAR 146

Query: 136 QHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANAIL 195
           + K  +PF+P+ I V+TSPTG+VIRDIL R++ RFP  VI++PV VQG    +++A+AI 
Sbjct: 147 ERKRRLPFLPRTIGVVTSPTGSVIRDILHRLADRFPSHVIVWPVLVQGQGAAEQVADAIR 206

Query: 196 QLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWTL 255
             + L +     RPD++I+ARGGGSIEDLW FN+E++VRAIA  +IP+ISA+GHETD TL
Sbjct: 207 GFSELSQDDAVRRPDVVIVARGGGSIEDLWSFNEEIVVRAIAECTIPVISAVGHETDTTL 266

Query: 256 ADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKALP 315
           ADYAAD RAPTPT AAEMAVPV+  LQ++L +  AR    + R ++     L +  + +P
Sbjct: 267 ADYAADRRAPTPTAAAEMAVPVRADLQATLADFAARQRRAVHRPVELGRERLEARTRRMP 326

Query: 316 NSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHILE 375
             +  L     RLD L   L   L        +      +R+ +  L+      R+  L+
Sbjct: 327 RIEVLLQPQAQRLDDLAERLRRGLTDRAAHGRQQLAGTASRL-APRLLEGALSGRRERLD 385

Query: 376 KQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSHKI 435
           + +   Q+V++ +    L  +E++  L  L  Q       LH                  
Sbjct: 386 RTRLSPQLVERPI----LTAQERLKALARLASQ-------LHP----------------- 417

Query: 436 KSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDGQAN 495
                              K  L+RGY  ++      +T     A +  +++ F DG+ +
Sbjct: 418 -------------------KKPLERGYAIVRSETGEVVTSSAEAAKRAVLILEFSDGKLD 458

Query: 496 AIV 498
             V
Sbjct: 459 VGV 461


>gi|254511401|ref|ZP_05123468.1| exodeoxyribonuclease VII, large subunit [Rhodobacteraceae bacterium
           KLH11]
 gi|221535112|gb|EEE38100.1| exodeoxyribonuclease VII, large subunit [Rhodobacteraceae bacterium
           KLH11]
          Length = 495

 Score =  336 bits (862), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 192/511 (37%), Positives = 280/511 (54%), Gaps = 37/511 (7%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           +P   +N+   PEYSVS++S  +K  +E     + VRGE+ G      SGH Y+ +KD+ 
Sbjct: 7   DPVPGQNT---PEYSVSDISGEVKRTLEGTFGRIRVRGEV-GRVFKARSGHLYYDIKDDR 62

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           + +    WKG ++ +  +PEEG+E +V G++T F   SKY + ++ +  +G G L+  LE
Sbjct: 63  NVLACTTWKGQISGLSVVPEEGLEVVVTGRLTAFGAQSKYNLNVDEVAVAGQGALMALLE 122

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           KRKK+L  EGLF+ + K P+P++P+II VITSP+GAVIRDIL R+  RFP +V+I+PV V
Sbjct: 123 KRKKQLESEGLFAPERKKPLPYLPQIIGVITSPSGAVIRDILHRLRDRFPRKVLIWPVAV 182

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QG  C  E+  AI   N L  G   PRPD+II+ARGGGSIEDLW FN+E + RA A S+I
Sbjct: 183 QGANCAPEVTRAIEGFNQLTPGGALPRPDLIIVARGGGSIEDLWGFNEENVARAAAASAI 242

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETD TL DY +D RAPTPT AAE+AVPV+  L +      ARL+      ++
Sbjct: 243 PLISAVGHETDTTLIDYVSDRRAPTPTAAAELAVPVRMELLAWTREQGARLSRAATDAVQ 302

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            +   L  L +ALP  +  L   R RLD+    L                        + 
Sbjct: 303 RRSQRLRDLARALPRPETLLDSPRQRLDQAAERL-----------------------PNA 339

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHL----RYIFLEKKEKIAILHMLREQTKNRIFYLH 417
           LI  +Q  R  +L+   H+     ++L    R  +     ++++  + RE T  R     
Sbjct: 340 LIRGVQTRRVKLLDSAAHLRPSTLRNLVATRRDRWHNLSSRLSLRPIQRELTTRR----- 394

Query: 418 THIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKR 477
             + +L  R+      ++   H  +  T R+ ++ +YK TL+RGY  I+   ++ +T+K 
Sbjct: 395 DTLNRLTERLNTAQITRLDRLHQQLDATDRLRETLSYKATLERGYAVIR-AGDHVLTRKA 453

Query: 478 NLATKTRILINFFDGQANAIVINKAPPKEQP 508
                T   I F DG  N      A PK  P
Sbjct: 454 QAEKHTTFEIEFADGTLNTGQGGGAKPKRTP 484


>gi|295690267|ref|YP_003593960.1| exodeoxyribonuclease VII large subunit [Caulobacter segnis ATCC
           21756]
 gi|295432170|gb|ADG11342.1| exodeoxyribonuclease VII, large subunit [Caulobacter segnis ATCC
           21756]
          Length = 510

 Score =  336 bits (862), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 181/497 (36%), Positives = 277/497 (55%), Gaps = 24/497 (4%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           N  + P YSVSEL++ LK  +E     V +RGE+S     HS+GH Y ++KD+ + ID +
Sbjct: 7   NDSNAPPYSVSELAFALKRTLEDRYGFVRLRGELSKVTH-HSNGHVYLTIKDDKAAIDGV 65

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +WKG +  +   PE G+E +V GKITT+P  S+YQI+I+S+  +G G LL  LE+ K KL
Sbjct: 66  VWKGNVRGLGVRPEHGLEVIVTGKITTYPAGSRYQIVIDSMEAAGVGALLAQLERLKAKL 125

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECP 187
             EGLF+ + K P+P +P ++ VITSPTGAVIRDIL RI  R+P +V+++PV VQGD   
Sbjct: 126 AAEGLFAPERKRPLPSMPAVVGVITSPTGAVIRDILHRIRDRWPCQVLVWPVVVQGDAAA 185

Query: 188 KEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAI 247
            +++ A+   N ++ G   PRPDI+I+ARGGGS+EDLW FNDE + R +A S+IP+ISA+
Sbjct: 186 AQVSAAVRGFNAIQPGGPVPRPDILIVARGGGSVEDLWAFNDEALARTVAESAIPLISAV 245

Query: 248 GHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTL 307
           GHETD TL D+ +D RAPTPT AAEMA PV   L++ + + + RL+    R I+ +   L
Sbjct: 246 GHETDTTLIDFVSDRRAPTPTAAAEMATPVLGELRALISDFDRRLSRCGARTIEERRTRL 305

Query: 308 NSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQ 367
            S  + LP  +  L+ ++ R D     L+  L        +    +  R+  D L     
Sbjct: 306 TSAARGLPRPNDLLALAQQRFDMASGRLDAALHRNTAVHAQDLLKVTARLTPDAL----- 360

Query: 368 KNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRI 427
             RQH   K   +  + ++               L+    ++  R+   H  +  L TR+
Sbjct: 361 -RRQHA-AKADRVADLGRR---------------LNACGTRSVERVRD-HARLPLLWTRL 402

Query: 428 EFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILI 487
                 ++      ++   ++  S   +  L+ G+  ++  +   I     LA    + +
Sbjct: 403 GSAAERRLTRAEDQLTNLDKLRLSLNPRRPLELGFALVRKADGTIIRSAGALALGDHVAL 462

Query: 488 NFFDGQANAIVINKAPP 504
            F DG+  A++ N+APP
Sbjct: 463 QFADGEREAVIGNEAPP 479


>gi|126740019|ref|ZP_01755709.1| exodeoxyribonuclease VII, large subunit [Roseobacter sp. SK209-2-6]
 gi|126718838|gb|EBA15550.1| exodeoxyribonuclease VII, large subunit [Roseobacter sp. SK209-2-6]
          Length = 544

 Score =  335 bits (858), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 188/531 (35%), Positives = 287/531 (54%), Gaps = 40/531 (7%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           PE+SVSE+S  +K  +E     + V+GE+ G      SGH Y+ +KD+ S +    WKG 
Sbjct: 40  PEFSVSEISGEVKRTLEGTFGRIRVKGEV-GRVFKARSGHLYYDIKDDRSVLACTTWKGQ 98

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
           ++ +  +PEEG+E +V G++T F   SKY + ++ +  +G G L+  LEKRKK+L  EGL
Sbjct: 99  ISSLSVVPEEGLEVVVTGRLTAFGAQSKYNMNVDEVAVAGQGALMALLEKRKKQLEAEGL 158

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F+ + K P+P++P+II V+TSP+GAVIRDIL R+  RFP +V+++PV VQG  C  E+A 
Sbjct: 159 FAMERKKPLPYLPQIIGVVTSPSGAVIRDILHRLRDRFPRKVLVWPVAVQGQNCAPEVAR 218

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N L  G   PRPD+II+ARGGG+IEDLW FN+E++ RA A S IP+ISA+GHETD
Sbjct: 219 AIEGFNRLTPGGALPRPDLIIVARGGGAIEDLWGFNEEIVARAAAASEIPLISAVGHETD 278

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            TL D+ +DLRAPTPT AAE AVPV+  L +      ARL   + + ++ +   LN L +
Sbjct: 279 TTLIDFVSDLRAPTPTAAAEHAVPVRLELMAWSEAQGARLTRGVSQAVQQRRQRLNDLSR 338

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
           A+P  +  L   R RLDR+   L   L   + ++    +     ++   L       RQ 
Sbjct: 339 AIPRPETLLETPRQRLDRVSETLPRALMAGVQKRQVTLSRAAAALRPATL-------RQL 391

Query: 373 ILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILS 432
           +  +Q  +  +              +++   + +E  + +       + +L  R++    
Sbjct: 392 VSSRQDRLRNL------------SSRLSPRPLDQEVDRQK-----EQLSRLGIRLKSAQD 434

Query: 433 HKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDG 492
            +++    S++   R L+  +YK TL RGY  ++ +  + IT          + I F DG
Sbjct: 435 LRLERMQRSLATAGRQLEILSYKATLDRGYAVVR-SGADLITSSVEAQNAGPLTIEFADG 493

Query: 493 Q-------------ANAIVINKAPPKEQPTKKCQLHNNKREK-QGTQGELF 529
           +             A+      A  K+  +K  +    K EK  G QG LF
Sbjct: 494 EFRLENTEEAATEAASGPQQKSASSKQVTSKPVKQTKAKPEKPDGEQGSLF 544


>gi|148556052|ref|YP_001263634.1| exodeoxyribonuclease VII large subunit [Sphingomonas wittichii RW1]
 gi|148501242|gb|ABQ69496.1| Exodeoxyribonuclease VII large subunit [Sphingomonas wittichii RW1]
          Length = 492

 Score =  334 bits (857), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 190/502 (37%), Positives = 269/502 (53%), Gaps = 63/502 (12%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           P  SVSELS  LK  VE    HV VRGEISG++  HSSGH Y +LKD+ + ID +IWKG 
Sbjct: 27  PALSVSELSGALKRQVEEAFGHVRVRGEISGFK-RHSSGHCYLTLKDDRAAIDGVIWKGQ 85

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
              + F PE+GIE +  G++TT+PG SKYQI+IE +  +G G L+  L++R++ L  EGL
Sbjct: 86  AAAMRFRPEDGIEVIATGRLTTYPGRSKYQIVIERMELAGQGALMALLDQRRRMLAAEGL 145

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F +  K P+PF+P+II V+TSPTGAVIRDIL R+  R P  V+++PV VQG+    ++A 
Sbjct: 146 FDEDRKRPLPFMPRIIGVVTSPTGAVIRDILHRLEDRCPTHVVLWPVAVQGEGAAAQVAR 205

Query: 193 AILQLNTLKEGRTCPR----PDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           A+     +  G + PR    PD++I+ RGGGSIEDLW FN+E +VRAIA S IP+ISA+G
Sbjct: 206 AVRGFGAMAPGGSAPRPDLLPDLLIVGRGGGSIEDLWAFNEEEVVRAIAESPIPVISAVG 265

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HETD TLAD+AAD RAPTPT AAEMAVPV+  L   +  L AR   +  R  +       
Sbjct: 266 HETDTTLADFAADRRAPTPTAAAEMAVPVRADLAHHVRELGARAERLARRYRERAGERFE 325

Query: 309 SLLKALPNSDQTLSCSRYRL----DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
           ++ +  P  D   +  + RL    DRLPR L   + +                + D L H
Sbjct: 326 AVAERFPALDSLFAGQQQRLDDVADRLPRALGQRIAV---------------ARGD-LAH 369

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
                R  +L+++                  ++++  + +     + RI      +++L 
Sbjct: 370 AAGALRPSLLDRK--------------LDRARDRLEAVRLTDRPIRARIADGEIALERLW 415

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                                 RI +       L+RGY  ++      +T+         
Sbjct: 416 ----------------------RIAEQLHPDKPLQRGYVRVEKRGGGVLTEAAAARAAGL 453

Query: 485 ILINFFDGQANAIVIN--KAPP 504
           + ++F DG  +A V N  KAPP
Sbjct: 454 LTLHFADGAVDARVENGGKAPP 475


>gi|149185202|ref|ZP_01863519.1| exodeoxyribonuclease VII large subunit [Erythrobacter sp. SD-21]
 gi|148831313|gb|EDL49747.1| exodeoxyribonuclease VII large subunit [Erythrobacter sp. SD-21]
          Length = 488

 Score =  333 bits (855), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 191/514 (37%), Positives = 270/514 (52%), Gaps = 53/514 (10%)

Query: 16  SVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNK 75
           SVSE+S  LK  VE     V +RGE+SG +   +SGH Y +LKD  + IDA++W+G   +
Sbjct: 27  SVSEISNILKRTVEDRFGFVRLRGELSGVK-RAASGHLYAALKDEKAVIDAVMWRGNTQR 85

Query: 76  IEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSD 135
           + F PE+G+E +  GK+TT+PG SKYQI++E +  +G G LL  LEK + +L  EGLF +
Sbjct: 86  LPFNPEDGLEVVASGKLTTYPGRSKYQIVVERMELAGEGALLALLEKTRARLAAEGLFDE 145

Query: 136 QHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANAIL 195
             K  +PF+PK I V+TSPTGAVIRDIL R++ RFP RV+++PV VQG    +++A A+ 
Sbjct: 146 GRKRRLPFLPKTIGVVTSPTGAVIRDILHRLADRFPSRVVVWPVLVQGQGAAEQVAGAVR 205

Query: 196 QLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWTL 255
             + L EG    RPD++I+ARGGGSIEDLW FN+E +VRAIA  SIP ISA+GHETD TL
Sbjct: 206 GFSHLPEGHPD-RPDLVIVARGGGSIEDLWSFNEEQVVRAIAECSIPTISAVGHETDTTL 264

Query: 256 ADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKALP 315
           ADYAAD RAPTPT AAE+AVPV+  L ++L + EAR    I+R ++     L +    LP
Sbjct: 265 ADYAADRRAPTPTAAAEIAVPVRAELAATLADFEARTKRAILRPVQLGRERLEARADRLP 324

Query: 316 NSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHILE 375
           ++   L      LD L   L                          L+    K R+ +  
Sbjct: 325 SAQTLLQPQGQALDDLAEALRRG-----------------------LMDRTGKAREAL-- 359

Query: 376 KQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSHKI 435
             +H  +     L+ I  E K K+  L +                         +L+  +
Sbjct: 360 -ARH--RFSPGTLKGIVREGKNKLDGLRL----------------------PPSLLTRPL 394

Query: 436 KSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDGQAN 495
               + +    R+         L RGY  +  +    +T +   A +  + + F DG   
Sbjct: 395 GEKRSQLDALARLASQLHPDRPLSRGYVRVTTSGGRTLTDRAEAAKEAALTLKFRDGDL- 453

Query: 496 AIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
           A+    A P   PT   +    K+     Q +LF
Sbjct: 454 AVSTGDAAPPSWPTPPKKRAAPKKRTPSAQDDLF 487


>gi|114797378|ref|YP_759647.1| exodeoxyribonuclease VII large subunit [Hyphomonas neptunium ATCC
           15444]
 gi|114737552|gb|ABI75677.1| exodeoxyribonuclease VII, large subunit [Hyphomonas neptunium ATCC
           15444]
          Length = 475

 Score =  333 bits (853), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 187/528 (35%), Positives = 271/528 (51%), Gaps = 60/528 (11%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
            P     + +HPE +VSEL+  LK  +E+N   V VRGE+ G   I  SGH Y  LKD+ 
Sbjct: 8   QPMPDSPTTNHPELTVSELAASLKRTIETNYDQVTVRGEL-GRVTIAKSGHMYADLKDDK 66

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           + ++ I+W+G ++++ F PEEG+E +  G+++T+ G S YQ+I  ++ P+G+G L+  LE
Sbjct: 67  AVLNTIMWRGQVDRLTFRPEEGLEVVATGRLSTYEGRSAYQMIASTMRPAGAGALMQLLE 126

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           +RKKKL  EGLF   HK PIP++P+ I VITSPTGAVIRDIL RI  RFP+RVI++P  V
Sbjct: 127 ERKKKLAAEGLFDQAHKKPIPYMPRTIGVITSPTGAVIRDILHRIRERFPVRVIVWPALV 186

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QG++   ++   I   N +       RPD++I+ARGGGSIEDLW FN+E++VRA   S I
Sbjct: 187 QGEQAASQVTAGIRGFNAMT---GADRPDVLIVARGGGSIEDLWPFNEEVVVRAAFESEI 243

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETD TL DY +D RAPTPTGAAE+AVPV+  L   +     RL   + R + 
Sbjct: 244 PLISAVGHETDTTLIDYVSDRRAPTPTGAAEIAVPVRTELMLGIEESGQRLKRALTRALS 303

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
              + L +    LP  +  L   R RLD     L      +  R     + +  ++    
Sbjct: 304 RSRDKLAA--ARLPRPESLLQSKRQRLDFASASLPRAALALTQRARLKLSRL--QLSPAT 359

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIK 421
           L   I+  RQ +                                    ++        + 
Sbjct: 360 LKAEIRGQRQRL------------------------------------RDTAVRARPALM 383

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLAT 481
           +LI + +  L+ + K   T            +Y+ TLKRGY  ++DT    +       T
Sbjct: 384 RLIDQKKAALTSEGKLLET-----------LSYQATLKRGYVIVRDTGGQLVRNAAQAQT 432

Query: 482 KTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
              + + F DG      I  AP + +             ++G QG LF
Sbjct: 433 LDTLRVTFADGD-----ITAAPFEGETPPPAPKPKPAPRRKGEQGNLF 475


>gi|304320146|ref|YP_003853789.1| Exonuclease VII, large subunit [Parvularcula bermudensis HTCC2503]
 gi|303299049|gb|ADM08648.1| Exonuclease VII, large subunit [Parvularcula bermudensis HTCC2503]
          Length = 550

 Score =  332 bits (850), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 174/480 (36%), Positives = 266/480 (55%), Gaps = 5/480 (1%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           EYSVSELS  +K  +E    +V VRGE+ G      +GH Y  LKD  + + ++IWKG  
Sbjct: 16  EYSVSELSGAVKRTIEDGFGYVRVRGEL-GRVSRSGNGHCYLDLKDERAVLSSVIWKGGW 74

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
           ++++  PE+G+E +  G++TTF G S+YQ++I++L P+G+G L+   E RKK L  EGLF
Sbjct: 75  SRLKVKPEQGMEVIATGRMTTFAGQSRYQLVIDTLEPAGAGALMALFEARKKALEAEGLF 134

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
           + + K P+P +P++I V+TSPTGAVIRDIL R+  RFP+ V+++P  VQG++CPK +   
Sbjct: 135 AAERKRPLPPMPQVIGVVTSPTGAVIRDILHRLRDRFPVHVLVWPAVVQGEQCPKSVVAG 194

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           +   N L      PRPD++I+ARGGGS+EDLW FNDE + RA+A SSIP+ISAIGHETD 
Sbjct: 195 VEGFNALPTDGPVPRPDVLIVARGGGSLEDLWGFNDEAVARAVAASSIPVISAIGHETDV 254

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL DY AD RAPTPT AAEMAVPV+  L   L  L  RL   I   ++ +   L S  + 
Sbjct: 255 TLIDYVADRRAPTPTAAAEMAVPVRMDLSGRLDALNVRLTQRIGHHLEAQSLALQSAARG 314

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           L   +  +  +  R DR    L  +L++ + R  +        + +  +   +    + +
Sbjct: 315 LGRKESLIEPAEQRFDRAVSHLTQSLKVRVERATQRMERAAGGLSAALVTAAVAMKAETL 374

Query: 374 LEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSH 433
               Q +  I     R+   + + K+    +     +  +      +KK+  R+  +   
Sbjct: 375 KGMSQRL--ITAPPRRW--EQARSKVISARLSPHLVRRSLDRGGEEVKKIGGRLGRLTRE 430

Query: 434 KIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDGQ 493
            +      +    R+L S +Y+  L RG+  + D +   I   R +       + F +G+
Sbjct: 431 NVDRKSARLDDQARLLHSLSYQGVLARGFALVLDESQGVIRSPRQMRAGETYHLRFAEGE 490


>gi|315500485|ref|YP_004089288.1| exodeoxyribonuclease vii, large subunit [Asticcacaulis excentricus
           CB 48]
 gi|315418497|gb|ADU15137.1| exodeoxyribonuclease VII, large subunit [Asticcacaulis excentricus
           CB 48]
          Length = 547

 Score =  332 bits (850), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 167/325 (51%), Positives = 221/325 (68%), Gaps = 8/325 (2%)

Query: 5   SQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRI 64
           SQ NS   P +SVSEL+  LK  +ES   HV +RGEIS     H+SGH Y +LKD+ + I
Sbjct: 11  SQSNS---PPWSVSELAGALKRTIESAYDHVRLRGEISKVT-RHTSGHVYLTLKDDRAAI 66

Query: 65  DAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRK 124
           D +IWKG +++++  P+ G+E +V GK+TTFP SSKYQI+IESL  +G G LL  LE+ K
Sbjct: 67  DGVIWKGNISRLKAQPQAGLEVIVTGKLTTFPASSKYQIVIESLEAAGIGALLAQLERTK 126

Query: 125 KKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGD 184
            KL  EGLF+ + K  +PF PK I VITSPTGAVIRDIL RI  R+P RVI++PV VQGD
Sbjct: 127 AKLHGEGLFAAERKKRLPFAPKTIGVITSPTGAVIRDILHRIRDRWPCRVIVWPVIVQGD 186

Query: 185 ECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPII 244
             P +I  A   LN  + G   PRPD++I+ARGGGS+EDLW FNDE + RA+A  ++P+I
Sbjct: 187 AAPAQIIQA---LNGFQSG-AVPRPDVLIVARGGGSVEDLWAFNDEGLARAVAACTLPVI 242

Query: 245 SAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKI 304
           SA+GHETD TL D+ +D RAPTPTGAAEMA PV   L+  +++LE R      + ++ + 
Sbjct: 243 SAVGHETDTTLIDFVSDRRAPTPTGAAEMATPVLSELRGFVLDLERRRLGSFDQALRNRR 302

Query: 305 NTLNSLLKALPNSDQTLSCSRYRLD 329
             +  L +ALP     +  ++ RLD
Sbjct: 303 ERVALLGRALPKPQDLIDAAQQRLD 327


>gi|254441004|ref|ZP_05054497.1| exodeoxyribonuclease VII, large subunit [Octadecabacter antarcticus
           307]
 gi|198251082|gb|EDY75397.1| exodeoxyribonuclease VII, large subunit [Octadecabacter antarcticus
           307]
          Length = 515

 Score =  332 bits (850), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 185/518 (35%), Positives = 277/518 (53%), Gaps = 45/518 (8%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHS-SGHAYFSLKDNHSRIDAIIWKG 71
           PE++VSELS  +K  +E    HV VR E+   R  H+ SGH YF LKD+ + +    WKG
Sbjct: 16  PEFTVSELSGAVKRTIEGEFGHVRVRAEVG--RVTHARSGHLYFDLKDDRNVLACTTWKG 73

Query: 72  TLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEG 131
            +  +  +PEEG+E +V G++TTF   SKYQ+    +  +G G L+  L+KRKK L  EG
Sbjct: 74  QVADLSVIPEEGMEVVVKGRMTTFGSQSKYQLNATEVAVAGVGALMAMLDKRKKALEAEG 133

Query: 132 LFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIA 191
           LF  + K  +PF+P +I VITSPTGAVIRDIL R+  RFP +VI++PV VQG +C  ++A
Sbjct: 134 LFGAERKQALPFLPDVIGVITSPTGAVIRDILHRLRDRFPRKVIVWPVAVQGKDCAPQVA 193

Query: 192 NAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHET 251
            AI   N +  G   PRPD+II+ARGGGSIEDLW FN+E++ RA A S+IP+ISA+GHET
Sbjct: 194 RAIDGFNAMTSGGALPRPDLIIVARGGGSIEDLWGFNEEIVARATAASTIPLISAVGHET 253

Query: 252 DWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLL 311
           D TL D+ +D RAPTPT AAEMAVPV+  L  ++  + AR +  +   +  +   +  L 
Sbjct: 254 DTTLIDFVSDQRAPTPTAAAEMAVPVRLELMVAVDQMGARASRAVTDGVTRRKQRVADLA 313

Query: 312 KALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQ 371
           + LP  +Q    ++ R D L  +L+  L   +             ++   L++ + + R+
Sbjct: 314 RVLPKPEQLTEDAKQRFDYLSEKLDAALIGRVTEGRLRMGEASGLLRPSVLVNRLAQGRE 373

Query: 372 HI---------------LEKQQHIEQIVKQHLRYIFLEKKEKIA--ILHMLREQTKNRIF 414
            +                + Q+ ++   ++    +    + + A     MLR  T     
Sbjct: 374 RMSGLDARLGPALGRKAAQAQRDLDGQARRLRPDVLAVAQTRAAKDFAVMLRRMTTAS-- 431

Query: 415 YLHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFIT 474
              T  +K  +R+E +                R+ ++  Y+ TLKRGY  ++  +   +T
Sbjct: 432 --RTQTQKQRSRLEAL---------------DRMRETLGYRETLKRGYAVVRG-DGAVVT 473

Query: 475 QKRNLATKTRILINFFDGQAN-----AIVINKAPPKEQ 507
             +     T + I F DG        A +  K PP +Q
Sbjct: 474 SAKAAKAATTLDIEFADGTMAPAGKPAKLKVKTPPPDQ 511


>gi|209966855|ref|YP_002299770.1| exodeoxyribonuclease VII, large subunit, putative [Rhodospirillum
           centenum SW]
 gi|259646298|sp|B6IXD4|EX7L_RHOCS RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|209960321|gb|ACJ00958.1| exodeoxyribonuclease VII, large subunit, putative [Rhodospirillum
           centenum SW]
          Length = 523

 Score =  332 bits (850), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 181/488 (37%), Positives = 283/488 (57%), Gaps = 9/488 (1%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           PE SV +L+  LK  VE    +V VRGEIS  +  HSSGH Y  LKD  + ++A+ WKG 
Sbjct: 17  PEMSVGDLARALKRTVEDAYGYVRVRGEISQPK-RHSSGHVYLRLKDETAVLEAVCWKGV 75

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
             ++   PEEG+E +  G++TT+PG S+YQ++IE++  +G G LL  LE+RK++L  EGL
Sbjct: 76  AARLSVRPEEGMEVVCTGRLTTYPGRSQYQLVIETMELAGEGALLKMLEERKRRLAAEGL 135

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F+ + K P+PF+P++I V+TSPTGAVIRDIL R++ RFP  V+++PV VQG+    ++A 
Sbjct: 136 FAPERKKPLPFLPEVIGVVTSPTGAVIRDILHRLADRFPRHVLLWPVAVQGEGAADQVAR 195

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N +  G   PRPD+II+ARGGGS+EDL  FN+E +VRA A S+IP+ISA+GHETD
Sbjct: 196 AIAGFNAIAPGGPVPRPDLIIVARGGGSLEDLMPFNEEAVVRAAAASAIPLISAVGHETD 255

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            TL D+A+D RAPTPT AAEMAVPV+  L + +++   RL+  + R I  + + +  L +
Sbjct: 256 TTLIDFASDRRAPTPTAAAEMAVPVRTELLAQVLDDGRRLHQCLSRAIDTRRSHVEGLGR 315

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIK--SDFLIHNIQKNR 370
            L +    L     RLD     LE +L   + R++     +  R++   + +     +  
Sbjct: 316 GLGDPRALLEGCIQRLDDRAERLELSLRTGLERRHAAVQQLGIRLRHPREVIGLAAARAD 375

Query: 371 QHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFI 430
                 +   ++ V    +  F    ++++ L + R+    R       +  L  R+   
Sbjct: 376 AAGRALRAGFDRAVTVE-QGRFHRVADRLSPLPLRRQIDAGR-----DRLDALPPRLAQA 429

Query: 431 LSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFF 490
            + ++      +    ++L+S++YK  L+RG+  + D     +T+  + A    + + F 
Sbjct: 430 HARRLDQAGQRLVALGQLLESYSYKGVLERGFVLVADAEGRPVTRAADTAPGQPVALRFA 489

Query: 491 DGQANAIV 498
           DG   A+V
Sbjct: 490 DGTVGAVV 497


>gi|16126485|ref|NP_421049.1| exodeoxyribonuclease large subunit [Caulobacter crescentus CB15]
 gi|221235265|ref|YP_002517702.1| exodeoxyribonuclease VII large subunit [Caulobacter crescentus
           NA1000]
 gi|22095679|sp|Q9A649|EX7L_CAUCR RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|254783694|sp|B8GYM1|EX7L_CAUCN RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|13423755|gb|AAK24217.1| exodeoxyribonuclease large subunit [Caulobacter crescentus CB15]
 gi|220964438|gb|ACL95794.1| exodeoxyribonuclease VII large subunit [Caulobacter crescentus
           NA1000]
          Length = 505

 Score =  330 bits (846), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 176/490 (35%), Positives = 273/490 (55%), Gaps = 32/490 (6%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           P YSVSEL++ LK  +E     V +RGE+S     HS+GH Y ++KD+ S ID ++WKG 
Sbjct: 12  PPYSVSELAFALKRTLEDRYGFVRLRGELSKVTH-HSNGHVYLTIKDDKSAIDGVVWKGN 70

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
           +  +   PE G+E +V GKITT+P  S+YQI+I+S+  +G G LL  LE+ K KL  EGL
Sbjct: 71  VRGLGVRPEHGLEVIVTGKITTYPAGSRYQIVIDSMEAAGVGALLAQLERLKAKLAAEGL 130

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F+ + K P+P +P ++ VITSPTGAVIRDIL RI  R+P +V+++P  VQGD    +++ 
Sbjct: 131 FAPERKRPLPSMPAVVGVITSPTGAVIRDILHRIRDRWPCQVLVWPCVVQGDAAAGQVSA 190

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N ++ G   PRPD++I+ARGGGS+EDLW FNDE + R +A  +IP+ISA+GHETD
Sbjct: 191 AIRGFNAIQPGGPVPRPDVLIVARGGGSVEDLWAFNDEGLARTVAEGTIPLISAVGHETD 250

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            TL D+ +D RAPTPT AAEMA PV   L++ + +L+ RLN    R I+ +   L S  +
Sbjct: 251 TTLIDFVSDRRAPTPTAAAEMATPVLAELRALISDLDRRLNRCGARTIEERRTRLVSAAR 310

Query: 313 ALPNSDQTLSCSRYRLD----RLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQK 368
            LP  +  L+ ++ R D    RL   L+ N  +      +    +  R+  + L      
Sbjct: 311 GLPRPNDLLALAQQRFDIASGRLDAALDRNTTV----HAQSLLKVTARLTPEAL------ 360

Query: 369 NRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIE 428
            RQ  ++ +           R   L ++     L +   +  +R+   H  +  L  R+ 
Sbjct: 361 GRQRAVKAE-----------RLADLSRR-----LDLAARRAPDRVAQ-HARLPALWDRLN 403

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
                +++     +    ++ QS   +  L+ G+  ++  +        +L +  R+ + 
Sbjct: 404 AAGQRRLQRDADRLENLEKLRQSLNPERPLELGFALVRKGDGTLARSAADLVSGERVNLK 463

Query: 489 FFDGQANAIV 498
           F  G  +A++
Sbjct: 464 FKSGDRDAVI 473


>gi|254419247|ref|ZP_05032971.1| exodeoxyribonuclease VII, large subunit [Brevundimonas sp. BAL3]
 gi|196185424|gb|EDX80400.1| exodeoxyribonuclease VII, large subunit [Brevundimonas sp. BAL3]
          Length = 533

 Score =  329 bits (844), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 182/494 (36%), Positives = 283/494 (57%), Gaps = 15/494 (3%)

Query: 11  DHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           ++P  S+SELS+ LK  +E    HV +RGE+S     H+SGH Y +LKD+ S ID +IWK
Sbjct: 20  NNPPLSISELSFALKRTLEERFGHVRLRGEVSKVN-RHASGHIYLTLKDDKSAIDGVIWK 78

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           G++  +   PE G+E +V GKIT++P  S YQI+IES+  +G+G LL  LE+ K +L EE
Sbjct: 79  GSVRGLGVQPEAGLEVIVTGKITSYPARSSYQIVIESMEAAGAGALLAQLERLKVRLREE 138

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEI 190
           GLF    K P+P  P+ I VITSPTGAVIRD+L RI+ R+P RVI++PV VQG+    ++
Sbjct: 139 GLFEPGRKKPLPQFPRTIGVITSPTGAVIRDVLHRIAERWPCRVIVWPVVVQGEAACGQV 198

Query: 191 ANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHE 250
           +NAI   + +      PRPD++I+ARGGGS+EDLW FNDE + R +A + IPIISA+GHE
Sbjct: 199 SNAIRGFDAMTVDGPIPRPDLLIVARGGGSVEDLWCFNDEGLARTVAAARIPIISAVGHE 258

Query: 251 TDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSL 310
           TD TL D+ +D RAPTPTGAAE+A PV   L+ ++ +L+ R+     RLI+ +   L ++
Sbjct: 259 TDTTLIDFVSDRRAPTPTGAAEIATPVLADLRYAVADLDRRMVLAGGRLIEDRRTRLRAV 318

Query: 311 LKALP-NSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKN 369
            + LP   +  L+ ++ RLD     L   L+  +    RH      ++    L   I++ 
Sbjct: 319 ARGLPARPEDLLALAQQRLDNAASRLGSGLQRNVALHERHLAVTGGKLSPALLRARIERG 378

Query: 370 RQHILEKQQHI-----EQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
           +  +      +       + +   R + +  +   A LH   +Q + R       ++ L 
Sbjct: 379 QDRLRGAGDRLGAALQAGVARGERRLLQVSARLSPAPLHRRLDQREAR-------LQALG 431

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
            R++ ++  +++     ++  TR L +       K G+  +++ + ++IT    L     
Sbjct: 432 ARLDGVMPRRLERDADRLAGLTRALATL-DPGRPKPGFARVENPDGDWITSAATLEAGQA 490

Query: 485 ILINFFDGQANAIV 498
           + + F DG   AI+
Sbjct: 491 VRLVFGDGARGAII 504


>gi|86136622|ref|ZP_01055201.1| exodeoxyribonuclease VII, large subunit [Roseobacter sp. MED193]
 gi|85827496|gb|EAQ47692.1| exodeoxyribonuclease VII, large subunit [Roseobacter sp. MED193]
          Length = 479

 Score =  328 bits (841), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 179/482 (37%), Positives = 273/482 (56%), Gaps = 26/482 (5%)

Query: 11  DHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           + PE+SVSELS  +K  +E     + VRGE+ G      SGH Y+ +KD+ S +    WK
Sbjct: 13  NAPEFSVSELSGEVKRTLEGTFGRIRVRGEV-GRVFKARSGHLYYDIKDDRSVLACTTWK 71

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           G ++ +  +PEEG+E +V G++T F   SKY + ++ +  +G G L+  LEKRKK+L  E
Sbjct: 72  GQISSLSVVPEEGLEVVVTGRLTAFGAQSKYNMNVDEVAVAGQGALMALLEKRKKQLELE 131

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEI 190
           GLF+ + K P+P++P+II V+TSP+GAVIRDIL R+  RFP +V+++PV VQG  C  E+
Sbjct: 132 GLFAPERKKPLPYLPQIIGVVTSPSGAVIRDILHRLRERFPRKVLVWPVAVQGANCAPEV 191

Query: 191 ANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHE 250
           A+AI   N +  G   PRPD+II+ARGGG+IEDLW FN+E++ RA A S IP+ISA+GHE
Sbjct: 192 AHAIEGFNKMTPGGALPRPDLIIVARGGGAIEDLWGFNEEVVARAAAASDIPLISAVGHE 251

Query: 251 TDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSL 310
           TD TL D+ +D RAPTPT AAE+AVPV+  L + + +  ARL     + ++ +   LN L
Sbjct: 252 TDTTLIDFVSDRRAPTPTAAAELAVPVRLELMAWIEDQGARLLRGTGQAVQQRRQRLNDL 311

Query: 311 LKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNR 370
            +A+P ++  L   R RLD+    L   L   + +++ + +     ++   L + +Q+ R
Sbjct: 312 SRAMPRAESLLESPRQRLDQAGYNLPRALMSAVQQRHVNLSRASAGLRPAALRNLVQRRR 371

Query: 371 QHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFI 430
                                F     K++   + RE ++ +       ++KL  R+   
Sbjct: 372 GQ-------------------FETAIAKLSPYPIAREISRQK-----ADLEKLTARMVAA 407

Query: 431 LSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFF 490
              ++      +    R L+  +YK TL RGY  ++       TQ R  A  + + I F 
Sbjct: 408 QGVRMARQSHQLEAAGRQLEILSYKATLLRGYAVVRSGAEVITTQARAAAAPS-LTIEFA 466

Query: 491 DG 492
           DG
Sbjct: 467 DG 468


>gi|296282929|ref|ZP_06860927.1| exodeoxyribonuclease VII large subunit [Citromicrobium
           bathyomarinum JL354]
          Length = 491

 Score =  323 bits (829), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 185/484 (38%), Positives = 258/484 (53%), Gaps = 55/484 (11%)

Query: 16  SVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNK 75
           SVS+LS  LK +VE     V +RGE+SG +   +SGH Y SLKD+ S ID ++WK    +
Sbjct: 27  SVSDLSRSLKRVVEDRFGFVRIRGELSGVK-RAASGHLYCSLKDDKSVIDGVMWKSAAPR 85

Query: 76  IEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSD 135
           + F PE+G+E +  GK+TT+ G SKYQI+IE +  +G G LL  LEK K +L  EGLF+D
Sbjct: 86  LAFRPEDGVEVIASGKVTTYAGRSKYQIVIERMELAGEGALLALLEKTKARLEAEGLFAD 145

Query: 136 QHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANAIL 195
             K P+PF+P+ I V+TSPTGAVIRDIL R+S RFP  VI++PV VQG+    +++ A+ 
Sbjct: 146 ARKKPLPFLPRTIGVVTSPTGAVIRDILHRLSDRFPSHVIVWPVVVQGETAKGQVSAAVR 205

Query: 196 QLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWTL 255
             N L+ G    RPD++I+ARGGGSIEDLW FN+E +VRAIA S IP+ISA+GHETD TL
Sbjct: 206 GFNALERGGAIARPDLLIVARGGGSIEDLWAFNEEEVVRAIAESEIPVISAVGHETDTTL 265

Query: 256 ADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKALP 315
           AD+AAD RAPTPT AAE AVPV+  L + + +L AR      R +      L        
Sbjct: 266 ADFAADHRAPTPTAAAERAVPVRAELAAGIADLGARQMRCATRPVALGRERLE------- 318

Query: 316 NSDQTLSCSRYRLDRLPRELEHNLEIIIFRKY---RHFNHIINRIKSDFLIHNIQKNRQH 372
                 +CS+    RLPR                 RH   +++R+            R  
Sbjct: 319 ------ACSQ----RLPRPDALLQAAAQALDDAIERHRRALVDRVA---------IGRAT 359

Query: 373 ILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILS 432
           + E    +                   A L+    Q + R+ ++      L TR      
Sbjct: 360 LGEAAARLSP-----------------ATLNWRLGQARERLEHVRLMPATLTTR------ 396

Query: 433 HKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDG 492
           H   +   + ++   +L+S      L+RGY  + D     +    +  T   + + F DG
Sbjct: 397 HARATERLAANVA--MLRSLDPDAPLQRGYAMVFDGQGALVRSAGDARTAGTLSLKFADG 454

Query: 493 QANA 496
           +  A
Sbjct: 455 RVAA 458


>gi|103488581|ref|YP_618142.1| exodeoxyribonuclease VII large subunit [Sphingopyxis alaskensis
           RB2256]
 gi|98978658|gb|ABF54809.1| Exodeoxyribonuclease VII large subunit [Sphingopyxis alaskensis
           RB2256]
          Length = 475

 Score =  323 bits (829), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 164/334 (49%), Positives = 219/334 (65%), Gaps = 5/334 (1%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           P  SVS+LS  +K  VE   + V VRGE+SG +   +SGH Y +LKD+++ ID ++WKG 
Sbjct: 29  PPLSVSQLSAAIKRTVEDGFARVRVRGELSGAK-RAASGHFYAALKDDNALIDMVMWKGQ 87

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
             ++ F PE+GIE +  GK+TT+PG SKYQ+++ESL  +G G L+   EK K +L  EGL
Sbjct: 88  AARLAFRPEDGIEVIATGKLTTYPGRSKYQLVVESLEVAGEGALMLLFEKLKARLGGEGL 147

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F    K P+P++P+ I V+TSPTGAVIRDIL R++ R P  VI++PV VQG+    ++A 
Sbjct: 148 FDRDRKQPLPYLPRTIGVVTSPTGAVIRDILHRLADRCPSHVIVWPVLVQGEGAAAQVAA 207

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   + L  G    RPD++I+ARGGGSIEDLW FN+E++VRAIA+  IP ISA+GHETD
Sbjct: 208 AIRGFDALAPGGKVARPDLVIVARGGGSIEDLWAFNEEVVVRAIADCRIPTISAVGHETD 267

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            TLADYAAD+RAPTPT AAEMAVPV+  LQ+ L     R+     R    +   L +L +
Sbjct: 268 VTLADYAADMRAPTPTAAAEMAVPVRAELQAQLATWGGRMIGAANRQQALRGERLTALAR 327

Query: 313 ALPNSDQTLSCSRYRLD----RLPRELEHNLEII 342
            LP  D   +  R RLD    RL R     L ++
Sbjct: 328 HLPRRDALYAPQRQRLDDVGERLGRGQRQRLAML 361


>gi|126725606|ref|ZP_01741448.1| exodeoxyribonuclease VII, large subunit [Rhodobacterales bacterium
           HTCC2150]
 gi|126704810|gb|EBA03901.1| exodeoxyribonuclease VII, large subunit [Rhodobacterales bacterium
           HTCC2150]
          Length = 510

 Score =  320 bits (821), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 193/483 (39%), Positives = 280/483 (57%), Gaps = 20/483 (4%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           PE++V+E+S  +K  +E + S V VR E+ G      SGH Y  LKD+ S +  +IWKG 
Sbjct: 15  PEFTVTEISGAVKRTIEGSFSRVRVRAEL-GRVSRPRSGHVYLDLKDDKSVLSGVIWKGV 73

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
            +++   PEEG+E +  G++TTF G SKYQ++IE L P+G G L+  LEKRK+    EGL
Sbjct: 74  ASRLATQPEEGLEVVATGRLTTFGGQSKYQMVIEDLAPAGMGALMAMLEKRKQAFAAEGL 133

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F    K P+P++P++I V+TSP+GAVIRDIL R+  RFP RV+I+PV VQG +C  E+A 
Sbjct: 134 FDASRKQPLPYLPEVIGVVTSPSGAVIRDILHRLRDRFPRRVLIWPVAVQGQKCAPEVAR 193

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N L  G   PRPD++I+ARGGGS+EDLW FN+E +VRA A S IP+ISA+GHETD
Sbjct: 194 AIAGFNALTPGGALPRPDLLIVARGGGSVEDLWGFNEEAVVRAAAASDIPLISAVGHETD 253

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            TL DY +DLRAPTPT AAE AVPV+  L S +  L AR    + + I  + +    L +
Sbjct: 254 TTLIDYVSDLRAPTPTAAAEAAVPVRMELMSVIDELGARSGRALRQGIMQRRDRARDLAR 313

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
            LP  +Q +  +R RLD L   L   L  +  R+    + I   ++   L        Q 
Sbjct: 314 ILPKPEQLVENARQRLDTLSDRLPKALASVRQRRQVALSRISGGLRPTTL--------QR 365

Query: 373 ILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILS 432
            LE ++     + + L    +  +++     +++E  ++R      ++  +  R +   +
Sbjct: 366 RLEAERRRSDDLARRLGPALVRGRDR-----LVQENRRSR-----ENLDVVFARFQRAAN 415

Query: 433 HKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDG 492
            +I    T++S   R+ Q+  YK TLKRGY  ++      ITQ+   A    + I F DG
Sbjct: 416 SQISDWKTALSGAERMRQTLGYKETLKRGYAVVRGA-GQVITQREEAAKHHALEIEFHDG 474

Query: 493 QAN 495
           + N
Sbjct: 475 RVN 477


>gi|254450924|ref|ZP_05064361.1| exodeoxyribonuclease VII, large subunit [Octadecabacter antarcticus
           238]
 gi|198265330|gb|EDY89600.1| exodeoxyribonuclease VII, large subunit [Octadecabacter antarcticus
           238]
          Length = 515

 Score =  319 bits (818), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 170/468 (36%), Positives = 258/468 (55%), Gaps = 31/468 (6%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHS-SGHAYFSLKDNHSRIDAIIWKG 71
           PE++V+ELS  +K  +E    HV V+ E+   R +H+ SGH YF LKD+ + +    WKG
Sbjct: 16  PEFTVTELSGAVKRAIEGEFGHVRVKAEVG--RVVHARSGHLYFDLKDDRNVLACTTWKG 73

Query: 72  TLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEG 131
            +  +  +PEEG+E +V G++TTF   SKYQ+    +  +G G L+  L++RKK L  EG
Sbjct: 74  QVADLSVIPEEGMEVVVKGRMTTFGSQSKYQLNATEVAVAGVGALMAMLDQRKKALEAEG 133

Query: 132 LFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIA 191
           LF+ + K  +PF+P +I VITSPTGAV+RDIL R+  RFP +VI++PV VQG +C  ++A
Sbjct: 134 LFAAERKQALPFLPDVIGVITSPTGAVVRDILHRLRDRFPRKVIVWPVAVQGKDCAPQVA 193

Query: 192 NAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHET 251
            AI   N +  G   PRPD+II+ARGGGSIEDLW FN+E++ RA A S+IP+ISAIGHET
Sbjct: 194 RAIDGFNAMTSGGALPRPDLIIVARGGGSIEDLWGFNEEIVARAAAASTIPLISAIGHET 253

Query: 252 DWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLL 311
           D TL D+ +D RAPTP+ AAEMAVPV+  L +++  + AR    +   +  +   +  L 
Sbjct: 254 DTTLIDFVSDQRAPTPSAAAEMAVPVRLELMAAVDQMGARATRAVTDGVARRKQRVADLA 313

Query: 312 KALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQ 371
           + LP   Q    ++ R D    +L+  L   +             ++   L + +   R+
Sbjct: 314 RVLPKPKQLTEDAKQRFDYWSEKLDVALIGRVAAGRLRLGDASGLLRPSVLGNRLTLGRE 373

Query: 372 HI----LEKQQHIEQIVKQHLRYIFLEKK----EKIAILHM-----LREQTKNRIFYLHT 418
            +          + ++  Q  R +  + +    E IA+        L    +      HT
Sbjct: 374 RMSGLNARLGPALGRMAAQARRDLDGQARRLRPETIAVAQTRAVKDLAATLRRMTTAAHT 433

Query: 419 HIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQ 466
             +K  +R+E +                R+ ++  Y+ TLKRGY  ++
Sbjct: 434 QTQKQRSRLEAL---------------DRMRETLGYRETLKRGYAVVR 466


>gi|218512834|ref|ZP_03509674.1| exodeoxyribonuclease VII large subunit [Rhizobium etli 8C-3]
          Length = 239

 Score =  318 bits (815), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 145/233 (62%), Positives = 184/233 (78%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           EYSVSELS  +K  VE+    V VRGEISGYRG HSSGHAYF+LKD+ +RIDA+IWKGT 
Sbjct: 7   EYSVSELSGSIKRTVETAFDQVRVRGEISGYRGPHSSGHAYFALKDDRARIDAVIWKGTF 66

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
           ++++F PEEG+E +  GK+TTFPGSSKYQI+IE+L P+G+G L+  +E+RK+KL  EGLF
Sbjct: 67  SRLKFRPEEGMEVIATGKVTTFPGSSKYQIVIETLEPAGAGALMALIEERKRKLGAEGLF 126

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
               K  +PF+PK+I V+TSPTGAVIRDIL RIS RFP+ V+++PVKVQG+    E+ANA
Sbjct: 127 DAARKKRLPFMPKVIGVVTSPTGAVIRDILHRISDRFPVHVLVWPVKVQGEGAGDEVANA 186

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           I   N L+ G    RPD++I+ARGGGS+EDLW FNDE++VRA A S IP+ISA
Sbjct: 187 IRGFNALEPGGAIARPDVLIVARGGGSLEDLWSFNDEIVVRAAAESRIPLISA 239


>gi|302382957|ref|YP_003818780.1| exodeoxyribonuclease VII large subunit [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302193585|gb|ADL01157.1| exodeoxyribonuclease VII, large subunit [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 529

 Score =  316 bits (810), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 194/529 (36%), Positives = 281/529 (53%), Gaps = 30/529 (5%)

Query: 11  DHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           ++P  S+SELS+ LK  +E    HV +RGEIS     H+SGH Y +LKD+ S ID ++WK
Sbjct: 21  NNPPLSISELSFALKRTLEDRFGHVRLRGEISKVN-RHASGHIYLTLKDDKSAIDGVVWK 79

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           G+   +   PE G+E +V GKIT++P  S YQI+IES+  +G+G LL  LE+ K +L  E
Sbjct: 80  GSARGLGVQPETGLEVIVTGKITSYPARSSYQIVIESMEAAGAGALLAQLERLKVRLSGE 139

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEI 190
           GLF    K  IP  P+ I VITSPTGAVIRDIL RI+ R+P  VI++PV VQGD    ++
Sbjct: 140 GLFDPARKRSIPLYPRTIGVITSPTGAVIRDILHRIAERWPCHVIVWPVVVQGDAACGQV 199

Query: 191 ANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHE 250
             AI   + +  G   PRPD++I+ARGGGS+EDLW FNDE + R +A ++IPIISA+GHE
Sbjct: 200 GAAIRGFDAMTPGGPIPRPDLLIVARGGGSVEDLWCFNDEGLARTVAAATIPIISAVGHE 259

Query: 251 TDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSL 310
           TD TL D+ +D RAPTPTGAAE+A PV   L++++ +LE RL+    RL++ +   L ++
Sbjct: 260 TDTTLIDFVSDRRAPTPTGAAEIATPVLADLRAAVTDLERRLDRAGARLLEDRRVRLRAV 319

Query: 311 LKALPNSDQTL-SCSRYRLD----RLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHN 365
            + LP   + L + ++ RLD    RL   L  N+E+     +R    +  R     L   
Sbjct: 320 ARGLPARPEDLIALAQQRLDHAASRLGSGLGRNVEL----HHRRLVGVAGRFSPRLLDRA 375

Query: 366 IQKNRQHILEKQQHI-----EQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420
           +++    +      +         +   R + +  +   A L    EQ  +R       +
Sbjct: 376 VEQRTARLDGLGSRLVAALGANAARHERRLLQVSGRLTPAPLRHRLEQRSDR-------L 428

Query: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480
              + R++      I      ++   R L +   +   K G+  I D     I     L+
Sbjct: 429 TATVARLDRARPQAILRASDRLAALARALATLDPRRP-KPGFARIDDETGKMIASAAALS 487

Query: 481 TKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
              R+ +NF DG   A +   A     P K        R     QG LF
Sbjct: 488 PGQRVSLNFADGSQGATIDGPASAPRPPGK-------PRTAPVDQGSLF 529


>gi|330991091|ref|ZP_08315045.1| Exodeoxyribonuclease 7 large subunit [Gluconacetobacter sp. SXCC-1]
 gi|329761912|gb|EGG78402.1| Exodeoxyribonuclease 7 large subunit [Gluconacetobacter sp. SXCC-1]
          Length = 486

 Score =  310 bits (795), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 168/490 (34%), Positives = 269/490 (54%), Gaps = 29/490 (5%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           PE+SV+E+S  ++  +E     + VRGEI+ ++  + SGH YFSLKD   ++ +++W+GT
Sbjct: 17  PEFSVAEISGAIRRTLEGTFGRIRVRGEITEFK-RYPSGHLYFSLKDEGGKLSSVVWRGT 75

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
           ++++   PE G+E +  GKI+ +   S YQ++I+ L  +G G LL  +E+ +  L EEGL
Sbjct: 76  VSRLGLKPENGVEVIATGKISAYGERSSYQMVIDRLEYAGEGALLARIERLRLSLAEEGL 135

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F    K P+PF+P++I V+TS  GAV+ DI   I+ RFP RV+++PV VQGD   + IA 
Sbjct: 136 FDSARKRPLPFLPRVIGVVTSAQGAVLHDIRTTIARRFPHRVLVWPVPVQGDGAAERIAQ 195

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   + ++     PRPD++I+ARGGGS+EDL  FNDE ++RA+A   IP+ISA+GHETD
Sbjct: 196 AIAGFDRIEGSPALPRPDVLIVARGGGSLEDLMAFNDEGVLRAVAACRIPVISAVGHETD 255

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            TL D+ +D RAPTPT AAEMAVPV+  L+++L   +ARL   + R ++     L+    
Sbjct: 256 TTLVDFVSDCRAPTPTAAAEMAVPVRAELEAALAQRDARLRGGLGRCLQLARARLDRAAA 315

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
            LP+    +  +R RLD L   L+  L   +        +  +R+ +    H +   R+ 
Sbjct: 316 GLPDLPGVVENARRRLDDLGYRLDLALPARVHAMRGRLQNASDRLPAP---HMLLALRRA 372

Query: 373 ILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILS 432
            L +     Q     L    L ++E  AIL  LR                       +L 
Sbjct: 373 DLARVGTASQQAMGAL----LRRRE--AILAGLRVPPA-------------------VLV 407

Query: 433 HKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDG 492
            ++++  + ++ T   L + + +  L+RGY  + D+    +           +++ F DG
Sbjct: 408 SQLRASTSRLAGTGGRLDALSPRAVLERGYVLVTDSAGRPLAHAAQARGAPEVVMTFADG 467

Query: 493 QANAIVINKA 502
           +  A  + +A
Sbjct: 468 KVAARPLGEA 477


>gi|148285036|ref|YP_001249126.1| exodeoxyribonuclease VII large subunit [Orientia tsutsugamushi str.
           Boryong]
 gi|146740475|emb|CAM81010.1| exodeoxyribonuclease VII large subunit [Orientia tsutsugamushi str.
           Boryong]
          Length = 456

 Score =  310 bits (794), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 176/491 (35%), Positives = 279/491 (56%), Gaps = 52/491 (10%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           +  +  EY+V ELS H+K  +E     + VRGE+SG + I SSGH+YF+LKD+ + ++ +
Sbjct: 16  DEFNAKEYTVHELSLHIKSAIEYQFGVLKVRGEVSGLK-IASSGHSYFNLKDDKAVLNCV 74

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
            WK TLN ++   E+GIE +  G++TT+ G S+YQ+++E++  +G G+L+    +RK+KL
Sbjct: 75  CWKTTLNLVKIKVEDGIEVIATGRLTTYSGQSRYQLVVENICIAGLGSLMQIFFQRKEKL 134

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECP 187
           ++EGLF +  K  +P  P II VITS +GAVIRDI  R++ RFP R++I+PV VQG+   
Sbjct: 135 MKEGLFDNSRKKKLPAFPMIIGVITSISGAVIRDIAHRVNDRFPSRLLIWPVTVQGNNSA 194

Query: 188 KEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAI 247
            E+A+AI + N +        P++II+ARGGGS+EDLW FN+E++VRAIA+S IPI+SAI
Sbjct: 195 NEVASAIQECNNMLASNHDLAPEVIIIARGGGSVEDLWSFNEEIVVRAIASSVIPIVSAI 254

Query: 248 GHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTL 307
           GHE D+TLAD+AADLRAPTP+ AAEM VPV       L +++ RLNN         +N +
Sbjct: 255 GHEVDFTLADFAADLRAPTPSAAAEMVVPV-------LADIKMRLNN--------SMNQI 299

Query: 308 NSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQ 367
           N +      +   L CS   L+     +   L+ +I   Y+ F+ ++ R  +        
Sbjct: 300 NHV------TFNYLKCSVMLLNNCG-NIVQKLKTMIDLNYQKFDELVFRFDAKI------ 346

Query: 368 KNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRI 427
              +  +E Q+ I Q        + ++  + + +  +  E   N+++ L   +K+L   +
Sbjct: 347 ---EQFVELQKRILQ------NNVLIDPSKLVQLYALKLENLNNKLYQL---VKRLFVNL 394

Query: 428 EFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILI 487
           +             V +   +L +  Y   LKRG+  I+      ++    L +  +I I
Sbjct: 395 D-----------NKVYLLDSLLNNMDYSRVLKRGFAIIRLVEGPVVSSLSQLKSNDKIKI 443

Query: 488 NFFDGQANAIV 498
              DG   A +
Sbjct: 444 QLQDGVRQATI 454


>gi|87198197|ref|YP_495454.1| exodeoxyribonuclease VII large subunit [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87133878|gb|ABD24620.1| Exodeoxyribonuclease VII large subunit [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 453

 Score =  309 bits (791), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 157/334 (47%), Positives = 214/334 (64%), Gaps = 5/334 (1%)

Query: 24  LKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNKIEFLPEEG 83
           +K  VE     V VRGE+SG +   +SGH Y  LKD ++R+D ++W+G   ++ F PE+G
Sbjct: 1   MKRTVEDRFGFVRVRGELSGVK-RAASGHLYLCLKDENARLDGVMWRGNAQRLNFRPEDG 59

Query: 84  IEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSDQHKNPIPF 143
           +E +  GK+TT+PG S YQI+I+ +  +G G LL  L K K +L  EGLF    K  +PF
Sbjct: 60  VEVIATGKLTTYPGRSNYQIVIDRMEIAGEGALLALLAKLKARLEGEGLFDPARKKALPF 119

Query: 144 IPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANAILQLNTLKEG 203
           +P+ I V+TSPTGAVIRDIL R+S RFP RVI++PV VQG     ++ANA+   + ++ G
Sbjct: 120 LPRTIGVVTSPTGAVIRDILHRLSDRFPCRVIVWPVLVQGQGAAAQVANAVRGFSAMEPG 179

Query: 204 RTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWTLADYAADLR 263
              PRPD++I+ARGGGSIEDLW FN+E +VRA+A+ +IPIISA+GHETD TL D+AADLR
Sbjct: 180 GPIPRPDLVIVARGGGSIEDLWSFNEEEVVRAVADCTIPIISAVGHETDTTLCDFAADLR 239

Query: 264 APTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKALPNSDQTLSC 323
           APTPT AAE+AVPV+  L + + +L AR    + R +      L +  + LP     L  
Sbjct: 240 APTPTAAAELAVPVQAELAAFVADLNARQRRALGRQLGQARERLEARSQRLPQPHALLQG 299

Query: 324 SRYRL----DRLPRELEHNLEIIIFRKYRHFNHI 353
              R+    DRL   L H  EI   +  RH   +
Sbjct: 300 QAQRVDDLGDRLRLALLHRTEIAASQLARHAGAL 333


>gi|148260334|ref|YP_001234461.1| exodeoxyribonuclease VII, large subunit [Acidiphilium cryptum JF-5]
 gi|326403524|ref|YP_004283606.1| exodeoxyribonuclease VII large subunit [Acidiphilium multivorum
           AIU301]
 gi|146402015|gb|ABQ30542.1| exodeoxyribonuclease VII, large subunit [Acidiphilium cryptum JF-5]
 gi|325050386|dbj|BAJ80724.1| exodeoxyribonuclease VII large subunit [Acidiphilium multivorum
           AIU301]
          Length = 462

 Score =  309 bits (791), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 182/507 (35%), Positives = 274/507 (54%), Gaps = 51/507 (10%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M+  +   + + PE +VSEL+  +K  VE+    V VRGEI+  +  ++SGH Y +LKD 
Sbjct: 1   MSETTDTATGNLPELTVSELAGAVKRTVETAFGRVRVRGEITEMK-TYASGHTYMALKDE 59

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            ++I AIIW+G   ++   PE G+E +  G+ITT+P  S+YQ+IIE L  +G G LL  +
Sbjct: 60  GAKIRAIIWRGNAARLGLKPENGVEVIATGRITTYPERSEYQLIIERLDYAGEGALLARI 119

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           EK + +L EEGLF    K  +P +P+I+ V++SP GAVI+DI   I+ RFP R+I++PV 
Sbjct: 120 EKLRLRLTEEGLFDAARKRALPLLPRIVGVVSSPQGAVIQDIRTTIARRFPRRIILWPVA 179

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQG+    +IA AI     L E    PRPD++I+ARGGGS+EDL  FNDE +VRA A+  
Sbjct: 180 VQGEAAAAQIAAAIRGFGALPEAGEVPRPDVLIVARGGGSLEDLMAFNDEEVVRAAASCP 239

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP+ISA+GHETD TL D+A+D RAPTPT AAE+AVP +  L + L    ARL   + R+ 
Sbjct: 240 IPLISAVGHETDTTLIDFASDRRAPTPTAAAELAVPDRMALAADLAQSGARLTGALTRVT 299

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           +     L+    ALP+    +  +R RLD     L   L  ++  K      +  R    
Sbjct: 300 QSVRLRLDRAAAALPDLPSMIGTARQRLDDRGERLALALPRLVAAKRAQAREVAAR---- 355

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420
            L+H      + I+  ++H   ++ Q L               +LRE   NR+      +
Sbjct: 356 -LVHP-----REIIAARRHSLALLGQRL---------AAPAPGLLRE---NRL-----RL 392

Query: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480
             L  R+E                      + +Y  TL RG+  +   + + +T +R+  
Sbjct: 393 GALAARLE----------------------ALSYHATLARGFVMVATPSGDPVTTRRDAG 430

Query: 481 TKTRILINFFDGQANA-IVINKAPPKE 506
           +K  ++++F DG        ++APP +
Sbjct: 431 SKRHLVLHFGDGTLGVRPEADRAPPAQ 457


>gi|15604518|ref|NP_221036.1| exodeoxyribonuclease VII large subunit [Rickettsia prowazekii str.
           Madrid E]
 gi|14194742|sp|Q9ZCP8|EX7L_RICPR RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|3861212|emb|CAA15112.1| EXODEOXYRIBONUCLEASE LARGE SUBUNIT (xseA) [Rickettsia prowazekii]
 gi|292572306|gb|ADE30221.1| Exodeoxyribonuclease VII,large subunit [Rickettsia prowazekii Rp22]
          Length = 453

 Score =  307 bits (787), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 185/492 (37%), Positives = 287/492 (58%), Gaps = 68/492 (13%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           E+SVSE+S  +K ++E+N  ++ V+GEISG +   SSGHAYF+LK+N + +    W+  L
Sbjct: 13  EFSVSEISNKIKELLENNFGYIKVKGEISGLKR-ASSGHAYFNLKENTAILACTCWRPIL 71

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            KI+F   +G+E ++ GK++++ G+S+YQ+ +++L P+G G +L  L +RK +L +EGLF
Sbjct: 72  AKIKFPLNDGMEVVIGGKLSSYSGNSRYQLSVDNLQPAGLGAMLQILNERKTRLEKEGLF 131

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
            ++ + PIPF+P  I VITS TGAVI+DI+ RI  RFP R+II+ V VQG+    E+A A
Sbjct: 132 -NKKRIPIPFLPDKIGVITSITGAVIKDIIHRIRERFPTRIIIWQVSVQGENSGHEMAEA 190

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N L+E     +P +II+ARGGGSIEDLW FNDE++VRA  NS IPIISA+GHE D+
Sbjct: 191 IEGFNNLEE---IHKPSVIIVARGGGSIEDLWSFNDEILVRAAYNSKIPIISAVGHEADY 247

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D AAD RAPTPT AAE AVPV+  L +++ + E  L N   RLIKY           
Sbjct: 248 TLIDLAADKRAPTPTAAAEFAVPVRSILNNTIQSYEKILFNNTNRLIKY----------- 296

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRK-YRHFNHIINRIKSDFLIHNIQKNRQH 372
                                  H   I+ + K + +F++ IN             NRQ 
Sbjct: 297 -----------------------HEQSIVNYDKIHSYFSYYIN-------------NRQQ 320

Query: 373 ILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFY---LHTHIKKLITRIEF 429
           +L++      ++   +R+I L++ +       ++  +K RI Y   ++  I +L  +  +
Sbjct: 321 LLDEIGF--NLLDVLIRFIALKETK-------IKSFSKERINYAKIINYKILELTHQTAY 371

Query: 430 I---LSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRIL 486
           +   +++ +K+    + + + +L S  Y N LKRG+  ++    NF++ K     +  + 
Sbjct: 372 LFKSVNNTLKNFEYKLELNSTLLASLDYHNVLKRGFAIVKGDAGNFLSSKSAATNEQSLN 431

Query: 487 INFFDGQANAIV 498
           I FFDG+ N ++
Sbjct: 432 IKFFDGEINVVL 443


>gi|239947021|ref|ZP_04698774.1| exodeoxyribonuclease VII, large subunit [Rickettsia endosymbiont of
           Ixodes scapularis]
 gi|239921297|gb|EER21321.1| exodeoxyribonuclease VII, large subunit [Rickettsia endosymbiont of
           Ixodes scapularis]
          Length = 487

 Score =  307 bits (786), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 187/489 (38%), Positives = 270/489 (55%), Gaps = 72/489 (14%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           E+SVSE+S  +K ++E+N  ++ V+GEISG + I SSGHAYF+LK+N + +    W+  L
Sbjct: 56  EFSVSEISNKIKELLENNFGYIKVKGEISGLK-IASSGHAYFNLKENTAILACTCWRPIL 114

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            KI+F   +G+E ++ GK++++ G+S+YQ+ +++L P+G G +L  L +RK +L +EGLF
Sbjct: 115 AKIKFPLNDGMEVVISGKLSSYAGNSRYQLSVDNLRPAGLGAMLQILNERKARLEKEGLF 174

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
            ++ + PIPF+P  I VITS TGAVI+DI+ RI  RFP R+II+PV VQG+    EIA A
Sbjct: 175 -NKKRIPIPFLPDKIGVITSITGAVIKDIIHRIRERFPTRIIIWPVSVQGENSGNEIARA 233

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N L+E     +P +II+ARGGGSIEDLW FNDE++VR   NS IPIISA+GHE D+
Sbjct: 234 IEGFNNLEE---INKPSVIIVARGGGSIEDLWSFNDEILVRTAYNSKIPIISAVGHEVDY 290

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D AAD RAPTPT AAE AVPV+  L ++L + E  L N   RLIKY           
Sbjct: 291 TLIDLAADKRAPTPTAAAEFAVPVRSILNNTLQSYEKILLNNTSRLIKY----------- 339

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRK-YRHFNHIINRIKSDFLIHNIQKNRQH 372
                                  H   I+ + K YR+ +H IN             NRQ 
Sbjct: 340 -----------------------HEQNIVNYDKIYRYLSHYIN-------------NRQQ 363

Query: 373 ILEKQQH--------IEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
           +L++             ++    L+    E+     IL+    +  ++  YL       +
Sbjct: 364 LLDETGFNLLDALPCFIELQGTKLKSFSKERVNPAKILNYKTLELTHQTAYLSKSANNTL 423

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
              E+ L            + + +L S  Y N LKRG+  ++    NF++ K   A +  
Sbjct: 424 KNFEYKLE-----------LNSTLLASLDYHNVLKRGFAIVKGETGNFLSSKITAANEKI 472

Query: 485 ILINFFDGQ 493
             I F DG+
Sbjct: 473 FNIKFSDGE 481


>gi|296114490|ref|ZP_06833143.1| exodeoxyribonuclease VII large subunit [Gluconacetobacter hansenii
           ATCC 23769]
 gi|295978846|gb|EFG85571.1| exodeoxyribonuclease VII large subunit [Gluconacetobacter hansenii
           ATCC 23769]
          Length = 486

 Score =  306 bits (785), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 168/501 (33%), Positives = 273/501 (54%), Gaps = 31/501 (6%)

Query: 3   PFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHS 62
           P     + +  EYSVSE+S  ++  +E     + VRGEI+ ++  +SSGH YFSLKD   
Sbjct: 7   PSGAPGATNIAEYSVSEISGAIRSTLEGTFGRIRVRGEITEFK-RYSSGHLYFSLKDEKG 65

Query: 63  RIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEK 122
           ++ +++W+G+++++   PE G+E +  GKI+++   S YQ++I+ L  +G G LL  +EK
Sbjct: 66  KLSSVVWRGSVSRLGLKPENGVEVIATGKISSYGERSSYQMVIDRLEYAGEGALLARIEK 125

Query: 123 RKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQ 182
            + +L +EG+F  + K  IPF+P++I V+TS  GAV+ DI   ++ RFP  ++++PV VQ
Sbjct: 126 LRLRLAQEGVFDAERKQRIPFLPRVIGVVTSAQGAVLHDIRTTVARRFPRDLLVWPVPVQ 185

Query: 183 GDECPKEIANAILQLNTLKEGRTC-PRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           G+   + IA A+   + + +GRT   RPD++I+ARGGGS+EDL  FNDE ++RA+A  +I
Sbjct: 186 GEGAAERIAEAVAGFDRI-DGRTGIARPDVLIVARGGGSLEDLMAFNDESVLRAVAACTI 244

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETD TL D+ +D RAPTPT AAEMAVPV+  L++ L +  ARL+N + R+++
Sbjct: 245 PVISAVGHETDTTLIDFVSDRRAPTPTAAAEMAVPVRTELEADLAHRMARLSNGLGRVLQ 304

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
                L      LP+    L  +R RLD     L+  L  ++ R+        +R+ +  
Sbjct: 305 LGRARLGRAAAGLPDLPSLLETARIRLDDRGYRLDMALPALLERRRARLQAACDRLPTPG 364

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIK 421
            I  I   R  +      + +   Q+LR                    + R+  L     
Sbjct: 365 TI--IALKRSGLTLASAALARGGPQYLR------------------DRRGRVTALRPSAP 404

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLAT 481
            L+          ++     V      L+S + +  L+RGY  +QD   + +T    +  
Sbjct: 405 ALLA--------LLRERRARVQGEGGRLESLSPRAVLERGYVLVQDRAGHPLTLAAEVKA 456

Query: 482 KTRILINFFDGQANAIVINKA 502
             ++++ F DG   A V   A
Sbjct: 457 GAQVIMTFADGDVAARVERAA 477


>gi|51473854|ref|YP_067611.1| exodeoxyribonuclease VII large subunit [Rickettsia typhi str.
           Wilmington]
 gi|81826290|sp|Q68W63|EX7L_RICTY RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|51460166|gb|AAU04129.1| E.coli exonuclease VII [Rickettsia typhi str. Wilmington]
          Length = 453

 Score =  306 bits (785), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 187/492 (38%), Positives = 283/492 (57%), Gaps = 68/492 (13%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           E+SVSE+S  +K ++E+N  H+ V+GEISG + I SSGHAYF+LK+N + +    W+  L
Sbjct: 13  EFSVSEISNKIKELIENNFGHIKVKGEISGLK-ISSSGHAYFNLKENTAILACTCWRPIL 71

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            KI+F   +G+E ++ GK++++ G+S+YQ+ +++L P+G G ++  L +RK +L +EGLF
Sbjct: 72  VKIKFPLNDGMEVVIGGKLSSYSGNSRYQLSVDNLQPAGLGAMIQILNERKIRLEKEGLF 131

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
            ++ + PIPF+P  I VITS TGAVI+DI+ RI  R P R+II+ V VQG+    E+A A
Sbjct: 132 -NKKRIPIPFLPDKIGVITSITGAVIKDIIHRIRERCPTRIIIWQVSVQGENSSHEMAEA 190

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N L+E     +P +II+ARGGGSIEDLW FNDE++VRA  NS IPIISA+GHE D+
Sbjct: 191 IEGFNNLEE---IHKPSVIIVARGGGSIEDLWSFNDEILVRAAYNSKIPIISAVGHEADY 247

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D A D RAPTPT AAE AVPV+  L +++ + E  L N   RLIKY           
Sbjct: 248 TLIDLAVDKRAPTPTAAAEFAVPVRSILNNTIQSYEKILLNNTNRLIKY----------- 296

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRK-YRHFNHIINRIKSDFLIHNIQKNRQH 372
                                  H   I+ + K +R+F + IN             NRQ 
Sbjct: 297 -----------------------HEQSIVNYDKIHRYFAYYIN-------------NRQQ 320

Query: 373 ILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFY---LHTHIKKLITRIEF 429
           +L++      ++   +R I L++ +       L+   K RI Y   ++  I +L  +  +
Sbjct: 321 LLDETGF--NLLDVLIRCIALKETK-------LKSFAKERINYAKIINYKILELTHQTAY 371

Query: 430 IL---SHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRIL 486
           +L   ++ +K+    + + + +L S  Y N LKRG+  +     NF++ K     +  + 
Sbjct: 372 LLKSVNNTLKNFEYKLELNSTLLASLDYHNVLKRGFAIVTGDAGNFLSSKSTATNEQSLN 431

Query: 487 INFFDGQANAIV 498
           I FFDG+ N ++
Sbjct: 432 IKFFDGEINVVL 443


>gi|157826084|ref|YP_001493804.1| exodeoxyribonuclease VII large subunit [Rickettsia akari str.
           Hartford]
 gi|166232361|sp|A8GPH1|EX7L_RICAH RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|157800042|gb|ABV75296.1| exodeoxyribonuclease VII large subunit [Rickettsia akari str.
           Hartford]
          Length = 444

 Score =  306 bits (784), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 189/481 (39%), Positives = 274/481 (56%), Gaps = 56/481 (11%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           E+SVSE+S  +K ++E+N  ++ V+GEISG + I SSGHAYF+LK+N + +    W+  L
Sbjct: 13  EFSVSEISNKIKELLENNFGYIKVKGEISGLK-IASSGHAYFNLKENTAILACTCWRPIL 71

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            KI+F   +GIE ++ GK++++ G+S+YQ+ +++L P+G G +L  L  RK +L +EGLF
Sbjct: 72  AKIKFPLNDGIEVVISGKLSSYAGNSRYQLSVDNLQPAGLGAMLQILNDRKARLEKEGLF 131

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
            ++ + PIPF+P  I VITS TGAVI+DI+ RI  RFP R+II+PV VQG+    EIA A
Sbjct: 132 -NKIRIPIPFLPDKIGVITSITGAVIKDIIHRIRERFPTRIIIWPVSVQGENSSNEIAEA 190

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N L E     +P +II+ARGGGSIEDLW FNDE++VRA  NS IPIISA+GHE D+
Sbjct: 191 IEGFNNLAE---VNKPSVIIVARGGGSIEDLWSFNDEILVRAAYNSKIPIISAVGHEVDY 247

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D AAD RAPTPT AAE AVPV+  L ++L + E  L N   RLIKY           
Sbjct: 248 TLIDLAADKRAPTPTAAAEFAVPVRSILNNTLHSYEKILLNNTSRLIKYH---------- 297

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRK-YRHFNHIINRIKSDFLIHNIQKNRQH 372
                                 EHN  II + K +R+ +H ++             NRQ 
Sbjct: 298 ----------------------EHN--IINYDKIHRYLSHYMD-------------NRQQ 320

Query: 373 ILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILS 432
           +L++      ++   L +I L++  KI      R      + Y    +      +    +
Sbjct: 321 LLDETGF--NLLDALLCFIELQET-KIKSFSKERVNPAKILNYKTLELTHQTAYLSKSAN 377

Query: 433 HKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDG 492
           + +K+    + + + +L S  Y N LKRG+  ++    NF++ K   A +    I F DG
Sbjct: 378 NTLKNFEYKLELNSTLLASLDYNNVLKRGFAIVKGETGNFLSSKIAAANEKIFNIKFSDG 437

Query: 493 Q 493
           +
Sbjct: 438 E 438


>gi|15892949|ref|NP_360663.1| exodeoxyribonuclease VII large subunit [Rickettsia conorii str.
           Malish 7]
 gi|15620143|gb|AAL03564.1| exodeoxyribonuclease large subunit [Rickettsia conorii str. Malish
           7]
          Length = 457

 Score =  305 bits (782), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 187/481 (38%), Positives = 272/481 (56%), Gaps = 56/481 (11%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           E+SVSE+S  +K ++E+N  ++ V+GEISG + I +SGHAYF+LK+N + +    W+  L
Sbjct: 26  EFSVSEISNKIKELLENNFGYIKVKGEISGLK-IANSGHAYFNLKENTAILACTCWRPIL 84

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            KI F   +G+E ++ GK++++ G+S+YQ+ +++L P+G G +L  L +RK KL +EGLF
Sbjct: 85  AKITFPLNDGMEVVISGKLSSYAGNSRYQLSVDNLQPTGLGAMLQILNERKAKLEKEGLF 144

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
            ++ + PIPF+P  I VITS TGAVI+DI+ RI  RFP R+II+PV VQG+    EIA A
Sbjct: 145 -NKIRIPIPFLPDKIGVITSITGAVIKDIIHRIRERFPTRIIIWPVSVQGENSGNEIAEA 203

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N L+E     +P +II+ARGGGSIEDLW FNDE++VRA  NS IPIISA+GHE D+
Sbjct: 204 IEGFNNLEE---VNKPRVIIVARGGGSIEDLWSFNDEILVRAAYNSKIPIISAVGHEVDY 260

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D AAD RAPTPT AAE AVPV+  L ++L + E  L N   RLIKY           
Sbjct: 261 TLIDLAADKRAPTPTAAAEFAVPVRSILNNTLQSYEKILLNNTSRLIKY----------- 309

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRK-YRHFNHIINRIKSDFLIHNIQKNRQH 372
                                  H   I+ + K +R+ +H IN             NRQ 
Sbjct: 310 -----------------------HEQNIVNYNKIHRYLSHYIN-------------NRQQ 333

Query: 373 ILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILS 432
           +L++      ++     +I L++  KI      R      I Y    +      +    +
Sbjct: 334 LLDETGF--NLLDALPCFIELQET-KIKSFSKERVNPAKIINYKTLELTHQTAYLSKSAN 390

Query: 433 HKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDG 492
           + +K+    + + + +L S  Y N LKRG+  ++    NF++ K   A +    I F DG
Sbjct: 391 NTLKNFEYKLELNSTLLASLDYHNVLKRGFAIVKGETGNFLSSKMTAANEKIFNIKFSDG 450

Query: 493 Q 493
           +
Sbjct: 451 E 451


>gi|22095672|sp|Q92GU6|EX7L_RICCN RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
          Length = 444

 Score =  305 bits (782), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 187/481 (38%), Positives = 272/481 (56%), Gaps = 56/481 (11%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           E+SVSE+S  +K ++E+N  ++ V+GEISG + I +SGHAYF+LK+N + +    W+  L
Sbjct: 13  EFSVSEISNKIKELLENNFGYIKVKGEISGLK-IANSGHAYFNLKENTAILACTCWRPIL 71

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            KI F   +G+E ++ GK++++ G+S+YQ+ +++L P+G G +L  L +RK KL +EGLF
Sbjct: 72  AKITFPLNDGMEVVISGKLSSYAGNSRYQLSVDNLQPTGLGAMLQILNERKAKLEKEGLF 131

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
            ++ + PIPF+P  I VITS TGAVI+DI+ RI  RFP R+II+PV VQG+    EIA A
Sbjct: 132 -NKIRIPIPFLPDKIGVITSITGAVIKDIIHRIRERFPTRIIIWPVSVQGENSGNEIAEA 190

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N L+E     +P +II+ARGGGSIEDLW FNDE++VRA  NS IPIISA+GHE D+
Sbjct: 191 IEGFNNLEE---VNKPRVIIVARGGGSIEDLWSFNDEILVRAAYNSKIPIISAVGHEVDY 247

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D AAD RAPTPT AAE AVPV+  L ++L + E  L N   RLIKY           
Sbjct: 248 TLIDLAADKRAPTPTAAAEFAVPVRSILNNTLQSYEKILLNNTSRLIKY----------- 296

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRK-YRHFNHIINRIKSDFLIHNIQKNRQH 372
                                  H   I+ + K +R+ +H IN             NRQ 
Sbjct: 297 -----------------------HEQNIVNYNKIHRYLSHYIN-------------NRQQ 320

Query: 373 ILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILS 432
           +L++      ++     +I L++  KI      R      I Y    +      +    +
Sbjct: 321 LLDETGF--NLLDALPCFIELQET-KIKSFSKERVNPAKIINYKTLELTHQTAYLSKSAN 377

Query: 433 HKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDG 492
           + +K+    + + + +L S  Y N LKRG+  ++    NF++ K   A +    I F DG
Sbjct: 378 NTLKNFEYKLELNSTLLASLDYHNVLKRGFAIVKGETGNFLSSKMTAANEKIFNIKFSDG 437

Query: 493 Q 493
           +
Sbjct: 438 E 438


>gi|189184650|ref|YP_001938435.1| exodeoxyribonuclease VII large subunit [Orientia tsutsugamushi str.
           Ikeda]
 gi|189181421|dbj|BAG41201.1| exodeoxyribonuclease large subunit [Orientia tsutsugamushi str.
           Ikeda]
          Length = 456

 Score =  305 bits (782), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 176/485 (36%), Positives = 276/485 (56%), Gaps = 52/485 (10%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           EY+V ELS H+K  +E     + VRGE+SG + I SS H+YF+LKD+ + ++ + WK TL
Sbjct: 22  EYTVHELSLHIKSAIEYQFGVLKVRGEVSGLK-IASSCHSYFNLKDDKAVLNCVCWKTTL 80

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
           N ++   E+GIE +  G++TT+ G S+YQ+++E++  +G G+L+    +RK+KL++EGLF
Sbjct: 81  NLVKIKVEDGIEVIATGRLTTYSGQSRYQLVVENICIAGLGSLMQIFFQRKEKLMKEGLF 140

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
            +  K  +P  P +I VITS +GAVIRDI  R++ RFP +++++PV VQG+    E+A+A
Sbjct: 141 DNSRKKKLPAFPMVIGVITSISGAVIRDIAHRVNDRFPSKLLVWPVTVQGNNSANEVASA 200

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I + N +        P++II+ARGGGS+EDLW FN+E++VRAIA+S IPI+SAIGHE D+
Sbjct: 201 IQECNNMLTSNNDLAPEVIIIARGGGSVEDLWSFNEEIVVRAIASSVIPIVSAIGHEVDF 260

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TLAD+AADLRAPTP+ AAEM VPV       L +++ RLNN         +N +N +   
Sbjct: 261 TLADFAADLRAPTPSAAAEMVVPV-------LADIKMRLNN--------SMNQINHV--- 302

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
              +   L CS   L+     +   L+ +I   Y+ F+ ++ R  +              
Sbjct: 303 ---TFNYLKCSVMSLNNCG-NIVQKLKTMIDLNYQKFDELVFRFDT-------------- 344

Query: 374 LEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSH 433
             K +   ++ K+ L+   L    K+  L+ L+ +  N   Y      +L+ R+   L +
Sbjct: 345 --KVEQFGELQKRILQNNVLIDPSKLVQLYALKLENLNNKLY------QLVKRLFVNLDN 396

Query: 434 KIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDGQ 493
           K       V +   +L +  Y   LKRG+  I+  +   ++    L    +I I   DG 
Sbjct: 397 K-------VYLLDSLLNNMDYSRVLKRGFAIIRLVDGPVVSSLSQLKGNDKIKIQLQDGV 449

Query: 494 ANAIV 498
             A +
Sbjct: 450 RQATI 454


>gi|67458645|ref|YP_246269.1| exodeoxyribonuclease VII large subunit [Rickettsia felis URRWXCal2]
 gi|67004178|gb|AAY61104.1| Exodeoxyribonuclease VII, large subunit [Rickettsia felis
           URRWXCal2]
          Length = 462

 Score =  305 bits (780), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 187/484 (38%), Positives = 272/484 (56%), Gaps = 62/484 (12%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           E+SVSE+S  +K ++E+N  ++ V+GEISG + I SSGHAYF+LK+N + +    W+  L
Sbjct: 25  EFSVSEISNKIKELLENNFGYIKVKGEISGLK-IASSGHAYFNLKENTAILACTCWRPIL 83

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            KI+F   +G+E ++ GK++++ G+S+YQ+ +++L P+G G +L  L +RK +L +EGLF
Sbjct: 84  AKIKFPLNDGMEVVISGKLSSYAGNSRYQLSVDNLQPAGLGAMLQILNERKARLEKEGLF 143

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
            ++ + PIPF+P  I VITS TGAVI+DI+ RI  RFP R+II+PV VQG+    EIA A
Sbjct: 144 -NKIRIPIPFLPDKIGVITSITGAVIKDIIHRIRERFPTRIIIWPVSVQGENSGNEIAEA 202

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N L+E     +P +II+ARGGGSIEDLW FNDE++VRA  NS IPIISA+GHE D+
Sbjct: 203 IEGFNNLEE---INKPSVIIVARGGGSIEDLWSFNDEILVRAAYNSKIPIISAVGHEVDY 259

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D AAD RAPTPT AAE AVPV+  L ++L + E  L N   RLIKY           
Sbjct: 260 TLIDLAADKRAPTPTAAAEFAVPVRSILNNTLQSYEKILLNNTSRLIKY----------- 308

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRK-YRHFNHIINRIKSDFLIHNIQKNRQH 372
                                  H   II + K +R+ +H +N                 
Sbjct: 309 -----------------------HEQNIINYDKIHRYLSHYMNN---------------- 329

Query: 373 ILEKQQHIEQIVKQHLRYI--FLEKKE-KIAILHMLREQTKNRIFYLHTHIKKLITRIEF 429
              KQQ +++     L  +  F+E +E KI      R      + Y    +      +  
Sbjct: 330 ---KQQLLDETGFNLLDALPCFIELQETKIKSFSKERVNPAKILNYKTLELTHQTAYLSK 386

Query: 430 ILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINF 489
             ++ +K+    + + + +L S  Y N LKRG+  ++    NF++ K   A +    I F
Sbjct: 387 SANNTLKNFEYKLELNSTLLASLDYNNVLKRGFAIVKGETGNFLSSKITAANEKIFNIKF 446

Query: 490 FDGQ 493
            DG+
Sbjct: 447 SDGE 450


>gi|238650991|ref|YP_002916847.1| exodeoxyribonuclease VII large subunit [Rickettsia peacockii str.
           Rustic]
 gi|238625089|gb|ACR47795.1| exodeoxyribonuclease VII large subunit [Rickettsia peacockii str.
           Rustic]
          Length = 457

 Score =  305 bits (780), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 186/481 (38%), Positives = 273/481 (56%), Gaps = 56/481 (11%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           E+SVSE+S  +K ++E+N  ++ V+GEISG + I +SGHAYF+LK+N + +    W+  L
Sbjct: 26  EFSVSEISNKIKELLENNFGYIKVKGEISGLK-IANSGHAYFNLKENTAILACTCWRPIL 84

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            KI+F   +G+E ++ GK++++ G+S+YQ+ +++L P+G G +L  L +RK +L +EGLF
Sbjct: 85  AKIKFPLNDGMEVVISGKLSSYAGNSRYQLSVDNLQPTGLGAMLQILNERKARLEKEGLF 144

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
            ++ + PIPF+P  I VITS TGAVI+DI+ RI  RFP R+II+PV VQG+    EIA A
Sbjct: 145 -NKIRIPIPFLPDKIGVITSITGAVIKDIIHRIRERFPTRIIIWPVSVQGENSGNEIAEA 203

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N L+E     +P +II+ARGGGSIEDLW FNDE++VRA  NS IPIISA+GHE D+
Sbjct: 204 IEGFNNLEE---VNKPRVIIVARGGGSIEDLWSFNDEILVRAAYNSKIPIISAVGHEVDY 260

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D AAD RAPTPT AAE AVPV+  L ++L + E  L N   RLIKY           
Sbjct: 261 TLIDLAADKRAPTPTAAAEFAVPVRSILNNTLQSYETILLNNTSRLIKY----------- 309

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRK-YRHFNHIINRIKSDFLIHNIQKNRQH 372
                                  H   I+ + K +R+ +H IN             NRQ 
Sbjct: 310 -----------------------HEQNIVNYNKIHRYLSHYIN-------------NRQQ 333

Query: 373 ILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILS 432
           +L++      ++     +I L++  KI      R      I Y    +      +    +
Sbjct: 334 LLDETGF--NLLDALPCFIELQET-KIKSFSKERVNPAKIINYKTLELTHQTAYLSKSAN 390

Query: 433 HKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDG 492
           + +K+    + + + +L S  Y N LKRG+  ++    NF++ K   A +    I F DG
Sbjct: 391 NTLKNFEYKLELNSTLLASLDYHNVLKRGFAIVKGETGNFLSSKITAANEKIFNIKFSDG 450

Query: 493 Q 493
           +
Sbjct: 451 E 451


>gi|34581352|ref|ZP_00142832.1| exodeoxyribonuclease large subunit [Rickettsia sibirica 246]
 gi|28262737|gb|EAA26241.1| exodeoxyribonuclease large subunit [Rickettsia sibirica 246]
          Length = 457

 Score =  304 bits (779), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 186/481 (38%), Positives = 273/481 (56%), Gaps = 56/481 (11%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           E+SVSE+S  +K ++E+N  ++ V+GEISG + I +SGHAYF+LK+N + +    W+  L
Sbjct: 26  EFSVSEISNKIKELLENNFGYIKVKGEISGLK-IANSGHAYFNLKENTAILACTCWRPIL 84

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            KI+F   +G+E ++ GK++++ G+S+YQ+ +++L P+G G +L  L +RK +L +EGLF
Sbjct: 85  AKIKFPLNDGMEVVISGKLSSYAGNSRYQLSVDNLQPTGLGAMLQILNERKARLEKEGLF 144

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
            ++ + PIPF+P  I VITS TGAVI+DI+ RI  RFP R+II+PV VQG+    EIA A
Sbjct: 145 -NKIRIPIPFLPDKIGVITSITGAVIKDIIHRIRERFPTRIIIWPVSVQGENSGNEIAEA 203

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N L+E     +P +II+ARGGGSIEDLW FNDE++VRA  NS IPIISA+GHE D+
Sbjct: 204 IEGFNNLEE---VNKPRVIIVARGGGSIEDLWSFNDEILVRAAYNSKIPIISAVGHEVDY 260

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D AAD RAPTPT AAE AVPV+  L ++L + E  L N   RLIKY           
Sbjct: 261 TLIDLAADKRAPTPTAAAEFAVPVRSILNNTLQSYEKILLNNTSRLIKY----------- 309

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRK-YRHFNHIINRIKSDFLIHNIQKNRQH 372
                                  H   I+ + K +R+ +H IN             NRQ 
Sbjct: 310 -----------------------HEQNIVNYNKIHRYLSHYIN-------------NRQQ 333

Query: 373 ILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILS 432
           +L++      ++     +I L++  KI      R      I Y    +      +    +
Sbjct: 334 LLDETGF--NLLDALPCFIELQET-KIKSFSKERVNPAKIINYKTLELTHQTAYLSKSAN 390

Query: 433 HKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDG 492
           + +K+    + + + +L S  Y N LKRG+  ++    NF++ K   A +    I F DG
Sbjct: 391 NTLKNFEYKLELNSTLLASLDYHNVLKRGFAIVKGETGNFLSSKITAANEKIFNIKFSDG 450

Query: 493 Q 493
           +
Sbjct: 451 E 451


>gi|157964823|ref|YP_001499647.1| exodeoxyribonuclease VII large subunit [Rickettsia massiliae MTU5]
 gi|157844599|gb|ABV85100.1| Exodeoxyribonuclease VII, large subunit [Rickettsia massiliae MTU5]
          Length = 458

 Score =  304 bits (779), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 186/481 (38%), Positives = 270/481 (56%), Gaps = 56/481 (11%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           E+SVSE+S  +K ++E+N  ++ V+GEISG + I SSGHAYF+LK+N + +    W+  L
Sbjct: 27  EFSVSEISNKIKELLENNFGYIKVKGEISGLK-IASSGHAYFNLKENTAILACTCWRPIL 85

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            KI+F   +G+E ++ GK++++ G+S+YQ+ +++L P+G G +L  L +RK +L +EGLF
Sbjct: 86  AKIKFPLNDGMEVVISGKLSSYAGNSRYQLSVDNLQPTGLGAMLQILNERKARLEKEGLF 145

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
            ++ + PIPF+P  I VITS TGAVI+DI+ RI  RFP R+II+PV VQG+    EIA A
Sbjct: 146 -NKIRIPIPFLPDKIGVITSITGAVIKDIIHRIRERFPTRIIIWPVSVQGENSGNEIAEA 204

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   + L+E     +P +II+ARGGGSIEDLW FNDE++VRA  NS IPIISA+GHE D+
Sbjct: 205 IEGFHNLEE---VNKPRVIIVARGGGSIEDLWSFNDEILVRAAYNSKIPIISAVGHEVDY 261

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D AAD RAPTPT AAE AVPV+  L ++L + E  L N   RLIKY           
Sbjct: 262 TLIDLAADKRAPTPTAAAEFAVPVRSILNNTLQSYEKILLNNTSRLIKY----------- 310

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRK-YRHFNHIINRIKSDFLIHNIQKNRQH 372
                                  H   I+ + K +R+ +H IN             NRQ 
Sbjct: 311 -----------------------HEQNIVNYDKIHRYLSHYIN-------------NRQQ 334

Query: 373 ILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILS 432
           +L++       +   L Y    +  KI      R      I Y    +      +    +
Sbjct: 335 LLDETGFN---LLDALPYFIELQDTKIKSFSKERVNPAKIINYKTLELTHQTAYLSKSAN 391

Query: 433 HKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDG 492
           + +K+    + + + +L S  Y N LKRG+  ++    NF++ K   A +    I F DG
Sbjct: 392 NTLKNFEYKLELNSTLLASLDYHNVLKRGFAIVKGETGNFLSSKITAANEKIFNIKFSDG 451

Query: 493 Q 493
           +
Sbjct: 452 E 452


>gi|124007173|sp|Q4UMV4|EX7L_RICFE RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
          Length = 450

 Score =  304 bits (778), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 187/484 (38%), Positives = 272/484 (56%), Gaps = 62/484 (12%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           E+SVSE+S  +K ++E+N  ++ V+GEISG + I SSGHAYF+LK+N + +    W+  L
Sbjct: 13  EFSVSEISNKIKELLENNFGYIKVKGEISGLK-IASSGHAYFNLKENTAILACTCWRPIL 71

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            KI+F   +G+E ++ GK++++ G+S+YQ+ +++L P+G G +L  L +RK +L +EGLF
Sbjct: 72  AKIKFPLNDGMEVVISGKLSSYAGNSRYQLSVDNLQPAGLGAMLQILNERKARLEKEGLF 131

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
            ++ + PIPF+P  I VITS TGAVI+DI+ RI  RFP R+II+PV VQG+    EIA A
Sbjct: 132 -NKIRIPIPFLPDKIGVITSITGAVIKDIIHRIRERFPTRIIIWPVSVQGENSGNEIAEA 190

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N L+E     +P +II+ARGGGSIEDLW FNDE++VRA  NS IPIISA+GHE D+
Sbjct: 191 IEGFNNLEE---INKPSVIIVARGGGSIEDLWSFNDEILVRAAYNSKIPIISAVGHEVDY 247

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D AAD RAPTPT AAE AVPV+  L ++L + E  L N   RLIKY           
Sbjct: 248 TLIDLAADKRAPTPTAAAEFAVPVRSILNNTLQSYEKILLNNTSRLIKY----------- 296

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRK-YRHFNHIINRIKSDFLIHNIQKNRQH 372
                                  H   II + K +R+ +H +N                 
Sbjct: 297 -----------------------HEQNIINYDKIHRYLSHYMNN---------------- 317

Query: 373 ILEKQQHIEQIVKQHLRYI--FLEKKE-KIAILHMLREQTKNRIFYLHTHIKKLITRIEF 429
              KQQ +++     L  +  F+E +E KI      R      + Y    +      +  
Sbjct: 318 ---KQQLLDETGFNLLDALPCFIELQETKIKSFSKERVNPAKILNYKTLELTHQTAYLSK 374

Query: 430 ILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINF 489
             ++ +K+    + + + +L S  Y N LKRG+  ++    NF++ K   A +    I F
Sbjct: 375 SANNTLKNFEYKLELNSTLLASLDYNNVLKRGFAIVKGETGNFLSSKITAANEKIFNIKF 434

Query: 490 FDGQ 493
            DG+
Sbjct: 435 SDGE 438


>gi|165933606|ref|YP_001650395.1| exodeoxyribonuclease VII large subunit [Rickettsia rickettsii str.
           Iowa]
 gi|165908693|gb|ABY72989.1| exodeoxyribonuclease VII large subunit [Rickettsia rickettsii str.
           Iowa]
          Length = 457

 Score =  303 bits (777), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 186/481 (38%), Positives = 272/481 (56%), Gaps = 56/481 (11%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           E+SVSE+S  +K ++E+N  ++ V+GEISG + I SSGHAYF+LK+N + +    W+  L
Sbjct: 26  EFSVSEISNKIKELLENNFGYIKVKGEISGLK-IASSGHAYFNLKENTAILACTCWRPIL 84

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            KI+F   +G+E ++ GK++++ G+S+YQ+ +++L P+G G +L  L +RK +L + GLF
Sbjct: 85  AKIKFPLNDGMEVVISGKLSSYAGNSRYQLSVDNLQPTGLGAMLQILNERKARLEKAGLF 144

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
            ++ + PIPF+P  I VITS TGAVI+DI+ RI  RFP R+II+PV VQG+    EIA A
Sbjct: 145 -NKIRIPIPFLPDKIGVITSITGAVIKDIIHRIRERFPTRIIIWPVSVQGENSGNEIAEA 203

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N L+E     +P +II+ARGGGSIEDLW FNDE++VRA  NS IPIISA+GHE D+
Sbjct: 204 IEGFNNLEE---VNKPRVIIVARGGGSIEDLWSFNDEILVRAAYNSKIPIISAVGHEVDY 260

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D AAD RAPTPT AAE AVPV+  L ++L + E  L N   RLIKY           
Sbjct: 261 TLIDLAADKRAPTPTAAAEFAVPVRSILNNTLQSYEKILLNNTSRLIKY----------- 309

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRK-YRHFNHIINRIKSDFLIHNIQKNRQH 372
                                  H   I+ + K +R+ +H IN             NRQ 
Sbjct: 310 -----------------------HEQNIVNYNKIHRYLSHYIN-------------NRQQ 333

Query: 373 ILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILS 432
           +L++      ++     +I L++  KI      R      I Y    +      +    +
Sbjct: 334 LLDETGF--NLLDALPCFIELQET-KIKSFSKERVNPAKIINYKTLELTHQTAYLSKSAN 390

Query: 433 HKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDG 492
           + +K+    + + + +L S  Y N LKRG+  ++    NF++ K   A +    I F DG
Sbjct: 391 NTLKNFEYKLELNSTLLASLDYHNVLKRGFAIVKGETGNFLSSKITAANEKIFNIKFSDG 450

Query: 493 Q 493
           +
Sbjct: 451 E 451


>gi|114328962|ref|YP_746119.1| exodeoxyribonuclease VII large subunit [Granulibacter bethesdensis
           CGDNIH1]
 gi|114317136|gb|ABI63196.1| exodeoxyribonuclease VII large subunit [Granulibacter bethesdensis
           CGDNIH1]
          Length = 543

 Score =  303 bits (775), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 184/535 (34%), Positives = 281/535 (52%), Gaps = 18/535 (3%)

Query: 4   FSQKNSLDH-PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHS 62
            S    LD+ PEYSVS+LS  +K  +E     V VRGE++  +  + SGH Y SLKD   
Sbjct: 17  VSGSRGLDNIPEYSVSDLSGTIKRTLEGAFGRVRVRGELTEVK-RYPSGHIYLSLKDEGG 75

Query: 63  RIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEK 122
           +I  ++WK  + ++  LPE G+E +  GKI+++   S YQ+II+ +  +G+G LL  +E 
Sbjct: 76  KIAGVVWKFAVPRLGMLPENGVEVVATGKISSYADRSSYQLIIDRMEYAGAGALLARIEM 135

Query: 123 RKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQ 182
            +++L EEGLF    K  +P +P+++ V++S  GAV++DI   I+ RFP  V+++PV VQ
Sbjct: 136 LRQRLAEEGLFDAARKRALPRLPRVVGVVSSEKGAVLQDIRTTIARRFPRTVLLWPVPVQ 195

Query: 183 GDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIP 242
           G+    +IA AI     L      PRPD++I+ARGGGS+EDL  FN+E+++RA A   IP
Sbjct: 196 GEGAAAKIAAAIDGFGRLPPDGPVPRPDVLIVARGGGSLEDLMAFNEEIVIRAAAACPIP 255

Query: 243 IISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKY 302
           +ISA+GHETD TL DYA+D RAPTPT AAE+AVP++  L + L +  ARL   + R+ + 
Sbjct: 256 VISAVGHETDTTLIDYASDRRAPTPTAAAELAVPMRAELTADLAHKTARLGGALSRMTQG 315

Query: 303 KINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFL 362
               L    + LP+    L  +R RLD     L   L  ++  +     +   R+     
Sbjct: 316 AWLGLAQAERLLPDLPTLLGHARQRLDDRSLRLGMALPGLLAARRAGLRNAALRLPRP-- 373

Query: 363 IHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI-- 420
            H I + RQH+   +  +   +      + L  K     LH LR     R   LH H+  
Sbjct: 374 AHIITQTRQHLRGAENSLRVAMP-----MLLAHKRSALRLHALRLGASLR-HSLHLHLGD 427

Query: 421 -KKLITRIEFI-LSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRN 478
            + L  R+    L  +++     +      L+S +Y+  L RGY  + D + + +TQ   
Sbjct: 428 ARPLFVRMRAAPLPGRLREAQARLDGLCARLESVSYQAVLARGYALVLDHDGHAVTQAAR 487

Query: 479 LATKTRILINFFDG----QANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
           +A+   + + F DG    QA        PP    T   +    K+     QG+L 
Sbjct: 488 IASGQILTLRFSDGEKTVQATHNPAGSTPPAGNDTASVKRTARKKSGPQKQGDLL 542


>gi|157828879|ref|YP_001495121.1| exodeoxyribonuclease VII large subunit [Rickettsia rickettsii str.
           'Sheila Smith']
 gi|157801360|gb|ABV76613.1| exodeoxyribonuclease VII large subunit [Rickettsia rickettsii str.
           'Sheila Smith']
          Length = 457

 Score =  302 bits (773), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 185/481 (38%), Positives = 272/481 (56%), Gaps = 56/481 (11%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           E+SVSE+S  +K ++E+N  ++ V+GEISG + I +SGHAYF+LK+N + +    W+  L
Sbjct: 26  EFSVSEISNKIKELLENNFGYIKVKGEISGLK-IANSGHAYFNLKENTAILACTCWRPIL 84

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            KI+F   +G+E ++ GK++++ G+S+YQ+ +++L P+G G +L  L +RK +L + GLF
Sbjct: 85  AKIKFPLNDGMEVVISGKLSSYAGNSRYQLSVDNLQPTGLGAMLQILNERKARLEKAGLF 144

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
            ++ + PIPF+P  I VITS TGAVI+DI+ RI  RFP R+II+PV VQG+    EIA A
Sbjct: 145 -NKIRIPIPFLPDKIGVITSITGAVIKDIIHRIRERFPTRIIIWPVSVQGENSGNEIAEA 203

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N L+E     +P +II+ARGGGSIEDLW FNDE++VRA  NS IPIISA+GHE D+
Sbjct: 204 IEGFNNLEE---VNKPRVIIVARGGGSIEDLWSFNDEILVRAAYNSKIPIISAVGHEVDY 260

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D AAD RAPTPT AAE AVPV+  L ++L + E  L N   RLIKY           
Sbjct: 261 TLIDLAADKRAPTPTAAAEFAVPVRSILNNTLQSYEKILLNNTSRLIKY----------- 309

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRK-YRHFNHIINRIKSDFLIHNIQKNRQH 372
                                  H   I+ + K +R+ +H IN             NRQ 
Sbjct: 310 -----------------------HEQNIVNYNKIHRYLSHYIN-------------NRQQ 333

Query: 373 ILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILS 432
           +L++      ++     +I L++  KI      R      I Y    +      +    +
Sbjct: 334 LLDETGF--NLLDALPCFIELQET-KIKSFSKERVNPAKIINYKTLELTHQTAYLSKSAN 390

Query: 433 HKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDG 492
           + +K+    + + + +L S  Y N LKRG+  ++    NF++ K   A +    I F DG
Sbjct: 391 NTLKNFEYKLELNSTLLASLDYHNVLKRGFAIVKGETGNFLSSKITAANEKIFNIKFSDG 450

Query: 493 Q 493
           +
Sbjct: 451 E 451


>gi|89069372|ref|ZP_01156731.1| exodeoxyribonuclease VII, large subunit [Oceanicola granulosus
           HTCC2516]
 gi|89045139|gb|EAR51210.1| exodeoxyribonuclease VII, large subunit [Oceanicola granulosus
           HTCC2516]
          Length = 420

 Score =  301 bits (772), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 154/360 (42%), Positives = 219/360 (60%), Gaps = 1/360 (0%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           E++VSE+S  +K  +E     + VRGE+ G      SGH YF +KD+ S +   IW+G L
Sbjct: 15  EFTVSEISGAVKRALEDQFGRIRVRGEV-GRVFKARSGHLYFDVKDDKSVLACNIWRGQL 73

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             +  +PEEG+E +V G+++ F G SKY +I++ +  +G G L+   EKRKK L  EGLF
Sbjct: 74  AGLSVMPEEGLEVVVTGRLSAFGGQSKYNMIVDEVAVAGVGALMAMFEKRKKALEAEGLF 133

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
           + + K P+P++P++I V+TSP GAVIRDIL R+  RFP +V+++PV VQG  C  E+A A
Sbjct: 134 APECKRPLPYLPEVIGVVTSPQGAVIRDILHRLRERFPRKVLVWPVAVQGKACAPEVARA 193

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N L  G   PRP+++I+ARGGGSIEDLW FN+E + RA A S+IP+ISA+GHETD 
Sbjct: 194 IAGFNALTPGGALPRPELLIVARGGGSIEDLWGFNEEAVARAAAASTIPLISAVGHETDT 253

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D+ AD RAPTPT AAEMAVPV+  L   +    ARL+  + + +  +   L  L + 
Sbjct: 254 TLIDHVADRRAPTPTAAAEMAVPVRLELLGWVDGQAARLSRALGQGLLGRGQRLRDLGRV 313

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           L   +  L     R D   R L   L   + RK   F+H    ++   +   +   R+ +
Sbjct: 314 LGRPEALLERPSQRFDGQERRLVGALRGAMDRKRARFSHAAGALRPGAVRGRVADGRRRL 373


>gi|91205023|ref|YP_537378.1| exodeoxyribonuclease VII large subunit [Rickettsia bellii RML369-C]
 gi|157827646|ref|YP_001496710.1| exodeoxyribonuclease VII large subunit [Rickettsia bellii OSU
           85-389]
 gi|122426014|sp|Q1RK25|EX7L_RICBR RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|166232362|sp|A8GXS3|EX7L_RICB8 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|91068567|gb|ABE04289.1| Exodeoxyribonuclease VII large subunit [Rickettsia bellii RML369-C]
 gi|157802950|gb|ABV79673.1| exodeoxyribonuclease VII large subunit [Rickettsia bellii OSU
           85-389]
          Length = 442

 Score =  301 bits (770), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 199/501 (39%), Positives = 280/501 (55%), Gaps = 90/501 (17%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           E+SVSE+S  +K ++E+N  ++ V+GEISG + I SSGHAYF+LK+N + +    W+  L
Sbjct: 13  EFSVSEISNKIKELLENNFGYIKVKGEISGLK-IASSGHAYFNLKENTAILACTCWRPIL 71

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            KI+F   +G+E ++ GK++++ G+S+YQ+ +E+L P+G G ++  L +RK +L +EGLF
Sbjct: 72  AKIKFPLNDGMEVVISGKLSSYAGNSRYQLSVENLQPAGLGAMVQILNERKARLEKEGLF 131

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
           +   K PIPF+P  I VITS TGAVI+DI+ RI  RFP  VII+PV VQG+    EIA A
Sbjct: 132 NKIRK-PIPFLPNKIGVITSITGAVIQDIIHRIRERFPTHVIIWPVSVQGENSGNEIAEA 190

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N L+E     +PD+II+ARGGGSIEDLW FNDE++VRA  NS IPIISA+GHE D+
Sbjct: 191 IDGFNKLEEAN---KPDVIIVARGGGSIEDLWSFNDEVLVRATYNSKIPIISAVGHEVDY 247

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D AAD RAPTPT AAE AVPV+  L S+L + E  L     +L+K            
Sbjct: 248 TLIDLAADKRAPTPTAAAEFAVPVRSILNSTLQSYEKVLVTNTKQLVK------------ 295

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
             N +Q ++      D++ R L H           + NH                     
Sbjct: 296 --NHEQAIT----NYDKINRYLAH-----------YINH--------------------- 317

Query: 374 LEKQQHIEQIVKQHLRYI--FLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFIL 431
             KQQ +++     L  +   +  KE       L+  +K RI   H H  K+IT     L
Sbjct: 318 --KQQLLDETGFNLLDSLPCLISLKET-----KLKSFSKERI---HPH--KIITYKTLEL 365

Query: 432 SHKIKSCHTSVSITTRILQSFAYK--------------NTLKRGYTSIQDTNNNFITQKR 477
           +HK      S + T   L++F YK              N LKRG+  ++  + NF++ K 
Sbjct: 366 THKAAYIIKSANNT---LKNFEYKLELNSLLLLSLDYHNVLKRGFAIVKGESGNFVSSK- 421

Query: 478 NLATKTRIL-INFFDGQANAI 497
              T  ++L I FFDG   A+
Sbjct: 422 --TTTEKVLNIQFFDGNIKAV 440


>gi|229587029|ref|YP_002845530.1| exodeoxyribonuclease VII large subunit [Rickettsia africae ESF-5]
 gi|259646299|sp|C3PPC7|EX7L_RICAE RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|228022079|gb|ACP53787.1| Exodeoxyribonuclease VII, large subunit [Rickettsia africae ESF-5]
          Length = 444

 Score =  300 bits (767), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 186/484 (38%), Positives = 271/484 (55%), Gaps = 62/484 (12%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           E+SVSE+S  +K ++E+N  ++ V+GEISG + I +SGHAYF+LK+N + +    W+  L
Sbjct: 13  EFSVSEISNKIKELLENNFGYIKVKGEISGLK-IANSGHAYFNLKENTAILACTCWRPIL 71

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            KI+F   +G+E ++ GK++++ G+S+YQ+ +++L P+G G +L  L +RK +L +EGLF
Sbjct: 72  AKIKFPLNDGMEVVISGKLSSYAGNSRYQLSVDNLQPTGLGAMLQILNERKARLEKEGLF 131

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
            ++ + PIPF+P  I VITS TGAVI+DI+ RI  RFP R+II+PV VQG+    EIA A
Sbjct: 132 -NKIRIPIPFLPDKIGVITSITGAVIKDIIHRIRERFPTRIIIWPVSVQGENSGNEIAEA 190

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N L+E     +P +II+ARGGGSIEDLW FNDE++VRA  NS IPIISA+GHE D+
Sbjct: 191 IEGFNNLEE---VNKPRVIIVARGGGSIEDLWSFNDEILVRAAYNSKIPIISAVGHEVDY 247

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D AAD RAPTPT AAE AVPV   L ++L + E  L N   RLIKY           
Sbjct: 248 TLIDLAADKRAPTPTAAAEFAVPVHSILNNTLQSYEKILLNNTSRLIKY----------- 296

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRK-YRHFNHIINRIKSDFLIHNIQKNRQH 372
                                  H   I+ + K +R+ +H IN                 
Sbjct: 297 -----------------------HEQNIVNYNKIHRYLSHYINH---------------- 317

Query: 373 ILEKQQHIEQIVKQHLRYI--FLEKKE-KIAILHMLREQTKNRIFYLHTHIKKLITRIEF 429
              +QQ +++     L  +  F+E +E KI      R      I Y    +      +  
Sbjct: 318 ---RQQLLDETGFNLLDALPCFIELQETKIKSFSKERVNPAKIINYKTLELTHQTAYLSK 374

Query: 430 ILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINF 489
             ++ +K+    + + + +L S  Y N LKRG+  ++    NF++ K   A +    I F
Sbjct: 375 SANNTLKNFEYKLELNSTLLASLDYHNVLKRGFAIVKGETGNFLSSKITAANEKIFNIKF 434

Query: 490 FDGQ 493
            DG+
Sbjct: 435 SDGE 438


>gi|260577256|ref|ZP_05845230.1| Exodeoxyribonuclease VII [Rhodobacter sp. SW2]
 gi|259020500|gb|EEW23822.1| Exodeoxyribonuclease VII [Rhodobacter sp. SW2]
          Length = 287

 Score =  299 bits (766), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 154/276 (55%), Positives = 197/276 (71%), Gaps = 1/276 (0%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           PEY+VSELS  +K ++E     V VRGE+ G     +SGH YF LKD+ S I AI WKG 
Sbjct: 13  PEYTVSELSGAVKRVIEGEFGLVRVRGEV-GRVSRPASGHLYFDLKDDRSVIAAISWKGQ 71

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
           + K++  PEEG+E +  G +TTFPG SKYQ+I+  + P+G+G L+  LEKR+  L  EGL
Sbjct: 72  VAKMQVRPEEGMEVVATGTMTTFPGQSKYQLIVSDVAPAGAGALMAMLEKRRLALAAEGL 131

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F    K PIP++P +I V+TSP+GAVIRDIL R+  RFP  V+I+PV VQG  C  E+A 
Sbjct: 132 FDAAGKQPIPYLPGVIGVVTSPSGAVIRDILHRLRDRFPRHVLIWPVAVQGQACAAEVAA 191

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N +  G   PRPD+II+ARGGGS+EDLW FN+E++VRA A S IP+ISA+GHETD
Sbjct: 192 AIRGFNAIVPGGAVPRPDLIIVARGGGSLEDLWGFNEEVVVRAAAASVIPLISAVGHETD 251

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINL 288
            TL D+AAD+RAPTPT AAEMAVPV+  L ++L  L
Sbjct: 252 TTLIDFAADVRAPTPTAAAEMAVPVRLELLAALDGL 287


>gi|157804055|ref|YP_001492604.1| exodeoxyribonuclease VII large subunit [Rickettsia canadensis str.
           McKiel]
 gi|166232363|sp|A8EZN6|EX7L_RICCK RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|157785318|gb|ABV73819.1| exodeoxyribonuclease VII large subunit [Rickettsia canadensis str.
           McKiel]
          Length = 444

 Score =  298 bits (762), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 184/488 (37%), Positives = 276/488 (56%), Gaps = 70/488 (14%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           E+SVSE+S  +K ++E+N  ++ ++GEISG++ I SSGHAYF+LK+N + +    W+ TL
Sbjct: 13  EFSVSEISNKIKELLENNFGYIKIKGEISGFK-IASSGHAYFNLKENTAILACTCWRPTL 71

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            KI+F  ++G+E ++ GK++++ G+S+YQ+ +++L P+G GT+L  L +RK +L +EGLF
Sbjct: 72  AKIKFPLKDGMEVVISGKLSSYAGNSRYQLAVDNLQPAGLGTMLQILNERKTRLEKEGLF 131

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
            ++ + PIPF+P  I VITS TGAVI+DI+ RI  RFP  +II+PV VQG+    EIA A
Sbjct: 132 -NKRRIPIPFLPTRIGVITSITGAVIKDIIHRIRERFPTHIIIWPVSVQGENSGNEIAAA 190

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N L+E     +P +II+ARGGGSIEDLW FNDE++VRA  NS IPIISA+GHE D+
Sbjct: 191 IEGFNKLEEAN---KPSVIIVARGGGSIEDLWSFNDEILVRAAYNSKIPIISAVGHEVDY 247

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           TL D AAD RAPTPT AAE AVPV+     S++N                 NTL S  K 
Sbjct: 248 TLIDLAADKRAPTPTAAAEFAVPVR-----SILN-----------------NTLQSYEKV 285

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           L N+ + L               H   I  + K       I+R  ++++ H     RQ +
Sbjct: 286 LLNNTKQLINY------------HEQNIANYDK-------IHRYLTNYINH-----RQQL 321

Query: 374 LEKQQH--------IEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLIT 425
           L++             ++ +  L++   E+     I++    +  ++  YL       + 
Sbjct: 322 LDETGFNLLDVLPCFIELQETKLKFCSKERINPAKIINYKTLELTHQTAYLSKSANNTLK 381

Query: 426 RIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRI 485
             E+ L            + + +L S  Y N LKRG+  ++    NF++ K   A +   
Sbjct: 382 NFEYKLE-----------LNSTLLASLDYHNVLKRGFAIVKGAMGNFLSSKITAADEKIF 430

Query: 486 LINFFDGQ 493
            I F DG+
Sbjct: 431 NIKFSDGE 438


>gi|294084705|ref|YP_003551463.1| Exonuclease VII large subunit [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292664278|gb|ADE39379.1| Exonuclease VII large subunit [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 497

 Score =  296 bits (758), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 171/499 (34%), Positives = 261/499 (52%), Gaps = 56/499 (11%)

Query: 5   SQKNSL----DHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHS-SGHAYFSLKD 59
           SQ N+     + P  ++ ELS  +K  VE    +V VR EIS  R   + SGH YF+LKD
Sbjct: 15  SQNNAASAGDNAPYMTIGELSKRVKATVEGAFDYVRVRAEIS--RPTRAPSGHIYFTLKD 72

Query: 60  NHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTA 119
           + S + A+ WK     ++  PEEG+E +  GK+TT+PG SKYQI++  +  +G G +L  
Sbjct: 73  DRSTLAAVCWKTVAGNLQVQPEEGLEVICSGKLTTYPGQSKYQIVVNQMEIAGEGAMLKM 132

Query: 120 LEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPV 179
           LE+R++ L  EGLF    K PIP +P  I VITSPTGAVIRDIL R++ RF + V+++  
Sbjct: 133 LEERRRMLAAEGLFDADRKRPIPEMPTTIGVITSPTGAVIRDILHRLNARFGVHVLVWGT 192

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
            VQG     ++A AI   + +      PRPDI+I+ARGGG++EDLW FN+E +VRA+A+ 
Sbjct: 193 LVQGKNAAGQVAAAIRGFDAMPANGAIPRPDILIVARGGGALEDLWAFNEEEVVRAVADC 252

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
           S+P+ISAIGHETD TL D+ ADLRAPTPT AAE+AVPV   L + +   EARL     R 
Sbjct: 253 SLPVISAIGHETDTTLIDFVADLRAPTPTAAAELAVPVHADLAAYISETEARLK----RG 308

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
           I  ++ T N L++           +R  LD  P E+       I R+ +  ++ +  + +
Sbjct: 309 ISQRLETANQLVR---------MAARGLLD--PAEM-------IARRGQMLDYALAGLNT 350

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH 419
                                       L      ++  ++ L       + R+  +  H
Sbjct: 351 ---------------------------ALERALAARRLDLSGLAGRLRPPETRLAEMSGH 383

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
             +L  R+       I+    +V+   ++L + +++  L RG+  + D     + +  + 
Sbjct: 384 FTRLSDRLANRFGQMIERHEQAVNSAGKLLDAHSFERVLDRGFALVIDAEGTPLKRAIDA 443

Query: 480 ATKTRILINFFDGQANAIV 498
                + + F D    A++
Sbjct: 444 PQGAEVTLRFADASRQALL 462


>gi|197106405|ref|YP_002131782.1| exodeoxyribonuclease large subunit [Phenylobacterium zucineum HLK1]
 gi|196479825|gb|ACG79353.1| exodeoxyribonuclease large subunit [Phenylobacterium zucineum HLK1]
          Length = 487

 Score =  295 bits (756), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 170/488 (34%), Positives = 263/488 (53%), Gaps = 48/488 (9%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
           YSVSEL++ LK  +E     V +RGE+S     HS+GH Y +LKD+ + ID ++WKG + 
Sbjct: 21  YSVSELAFALKRTLEDAYGFVRLRGELSKVTH-HSNGHVYLTLKDDKAAIDGVVWKGQVR 79

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
            +   PE+G+E +V GKIT +P  S+YQI+IE++  +G G LL  LE+ K +L  EGLF+
Sbjct: 80  NLSIRPEQGMEVVVTGKITAYPQGSRYQIVIETMEAAGVGALLAQLERLKARLAGEGLFA 139

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANAI 194
            + K P+P +P ++ VITSPTGAVIRDIL RI  R+P  V+++PV VQGD    ++  AI
Sbjct: 140 AERKKPLPTMPSVVGVITSPTGAVIRDILHRIRDRWPCHVVVWPVVVQGDAAAGQVCAAI 199

Query: 195 LQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWT 254
                L      PRPD++I+ARGGGS+EDLW FNDE + R +A  +IP+ISA+GHETD T
Sbjct: 200 RGFCALDPAGPVPRPDVLIVARGGGSVEDLWPFNDETLARTVAGCTIPLISAVGHETDTT 259

Query: 255 LADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKAL 314
           L D+ +D RAPTPT AAEMA PV   L++++ +  ARL+    R+++ +           
Sbjct: 260 LIDFVSDRRAPTPTAAAEMATPVLSELKAAVGDHGARLHRCAGRVVEDR----------- 308

Query: 315 PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHIL 374
                     R R+    R L+   +++     R F  +  R+ +  L  N   + + ++
Sbjct: 309 ----------RGRVQHADRALKRVPDLVELAAQR-FGIVSGRLAAG-LSRNAAAHERDLV 356

Query: 375 EKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSHK 434
                    V   L  + L++ + +          + R+  L   +K  + R    LS +
Sbjct: 357 R--------VASRLSPLLLQRPQAV---------QRERLEALSVRLKPCMDRRLERLSER 399

Query: 435 IKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDGQA 494
           + +         ++  S      L+RG+  +   + + +    +LA+   + I F D   
Sbjct: 400 LDAL-------AKLYASVDPDRPLQRGFARVTRADGSIVHAGASLASGEEVAIKFGDAVT 452

Query: 495 NAIVINKA 502
              VI+ A
Sbjct: 453 RQAVIDGA 460


>gi|73666662|ref|YP_302678.1| exodeoxyribonuclease VII large subunit [Ehrlichia canis str. Jake]
 gi|72393803|gb|AAZ68080.1| Exodeoxyribonuclease VII large subunit [Ehrlichia canis str. Jake]
          Length = 388

 Score =  291 bits (746), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 173/370 (46%), Positives = 233/370 (62%), Gaps = 31/370 (8%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           PE++VSEL+   ++ V    +H+ VRGEIS       SGH YF+LKD+ + ++A+ W  T
Sbjct: 3   PEFTVSELTKIFQNFVHETFTHIKVRGEISNLSQ-PKSGHTYFTLKDDDAVLNAVCWNNT 61

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
             KIEF  + G+E +  G +TT+   SKYQ+I ES++ +G G L   LE+RK KL +EGL
Sbjct: 62  --KIEFDLKNGLEVICFGFLTTY--QSKYQLITESMLLAGIGNLKIMLEQRKAKLEKEGL 117

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F+  +K  +P +PKII VITS TGAVI DIL R+  RFP  ++I PV VQG+E   +I N
Sbjct: 118 FNQSNKKHLPLLPKIIGVITSTTGAVINDILNRVKSRFPSHIVISPVSVQGNEAINQIIN 177

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI +LN         RPD+II+ARGGGSIEDLW FNDE IVRA+A SSIPI+SAIGHETD
Sbjct: 178 AISKLN----NSDINRPDVIIIARGGGSIEDLWIFNDEAIVRAVAGSSIPIVSAIGHETD 233

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +TL DYAAD+RAPTPT A E+ +P K  L   LIN  +R N  I  ++ YKIN     L 
Sbjct: 234 FTLIDYAADIRAPTPTAAVEIVLPTKTQL-VELIN--SRFNK-IKTILHYKINIKKDRLF 289

Query: 313 ALPNSDQTLSCSRYRLDRLPRE-LEHN------LEIIIFRKYRHFNHIINRIKSDFLIHN 365
            L N+   L  +++++  L  + LEH       L+I++  K +  N +  +I        
Sbjct: 290 YLHNN---LMKTKHKIKVLKLQLLEHKSQIEVLLKIMLLNKKQSLNELYYKIN------- 339

Query: 366 IQKNRQHILE 375
            Q N++ ILE
Sbjct: 340 -QFNKEKILE 348



 Score = 37.7 bits (86), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 50/114 (43%), Gaps = 16/114 (14%)

Query: 400 AILHMLREQTKNRIFYLHTHIKKLITRIEFILSHKIKSCHTSVSITTRIL---------- 449
            ILH      K+R+FYLH ++ K   +I+ +L  ++    + + +  +I+          
Sbjct: 275 TILHYKINIKKDRLFYLHNNLMKTKHKIK-VLKLQLLEHKSQIEVLLKIMLLNKKQSLNE 333

Query: 450 -----QSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDGQANAIV 498
                  F  +  L+ GY  I DTNNN I   + L +   I I   DG   AI+
Sbjct: 334 LYYKINQFNKEKILEAGYAVIYDTNNNHINSIKKLQSNDIISIELKDGIVEAII 387


>gi|329114737|ref|ZP_08243494.1| Exodeoxyribonuclease 7 large subunit [Acetobacter pomorum DM001]
 gi|326695868|gb|EGE47552.1| Exodeoxyribonuclease 7 large subunit [Acetobacter pomorum DM001]
          Length = 484

 Score =  290 bits (743), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 167/488 (34%), Positives = 267/488 (54%), Gaps = 34/488 (6%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           PE++VSE+S  ++  +E   S V VRGEI+  +  + SGH YFSLKD   +I  ++W+G+
Sbjct: 15  PEFTVSEISGAIRRTLEGTFSRVRVRGEITELK-RYPSGHVYFSLKDERGKISGVVWRGS 73

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
           ++++  +PE G+E +  GKI+ +   S YQ+++E +  +G G LL  +E+ + KL EEGL
Sbjct: 74  VSRLGLVPENGVEIIATGKISAYGERSSYQLVVERMEYAGEGALLARIERLRLKLAEEGL 133

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F    K  IP +P++I V+TSP GAV+ DI   +  RFP  VI++PV VQG+     IA 
Sbjct: 134 FDTARKKAIPLLPRVIGVVTSPQGAVLHDICTTLQRRFPRPVIVWPVPVQGEGAAARIAA 193

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   + L      PRPD++I+ARGGGS+EDL  FNDE +VRA A   IP+ISA+GHETD
Sbjct: 194 AIDGFSQLDGLGAVPRPDVLIVARGGGSLEDLMAFNDEAVVRATAACLIPLISAVGHETD 253

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            TL D+A+D RAPTPT AAEMAVPV+  L + + +  AR    + RL++     L+    
Sbjct: 254 TTLIDFASDRRAPTPTAAAEMAVPVRTELLADIEHRNARAVGALSRLLQTARLRLDRASS 313

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
           A+P+    L  +R +LD   R L+  L  +                       +Q+ +  
Sbjct: 314 AMPDLPSLLQTARMQLDDRGRRLDVALPAL-----------------------VQRRKAD 350

Query: 373 ILEKQQHIEQIVKQHLRYIFLEKKEKIAIL-HMLREQTKNRIFYLHTHIKKLITRIEFI- 430
           ++  ++H+  +       +   ++ ++A+L +ML+    +        + +L  RI    
Sbjct: 351 LVAVERHMPAV-----ETLLAGRRTRLAVLANMLQASMAHTFQRQDARLGRL--RISPAP 403

Query: 431 LSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFF 490
           L   ++   T+++     L++ + +  L RGY ++       +T    L    R+ + F 
Sbjct: 404 LQALVRERRTALAGIAGQLEAISPRAVLARGY-ALVTAEGRPVTSAEQLNDGERVELTFG 462

Query: 491 DGQANAIV 498
           DG   A++
Sbjct: 463 DGARPAVI 470


>gi|212638786|ref|YP_002315306.1| exodeoxyribonuclease VII large subunit [Anoxybacillus flavithermus
           WK1]
 gi|212560266|gb|ACJ33321.1| Exonuclease VII large subunit [Anoxybacillus flavithermus WK1]
          Length = 449

 Score =  290 bits (742), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 179/488 (36%), Positives = 268/488 (54%), Gaps = 55/488 (11%)

Query: 16  SVSELSYHLKHI--VESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ ++K    V+ +L  + ++GEIS +   HS GH YF+LKD  +RI A+++ G  
Sbjct: 8   TVAALTKYIKRKFEVDPHLQDLWIKGEISNF-TYHSRGHMYFTLKDEQARIQAVMFAGYN 66

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            ++ F PE G+  LV G+I+ +  S  YQ+ ++ + P G G L  A E+ KKKL +EGLF
Sbjct: 67  RQLTFKPENGMTVLVRGEISVYEPSGTYQVYVKEMQPDGVGALYLAYEQLKKKLEQEGLF 126

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
           + +HK PIP  P+ I V+TSPTGA IRDIL  I  R+PL +VI+FP  VQG++ P  I  
Sbjct: 127 AKEHKKPIPKFPQHIGVVTSPTGAAIRDILTTIRRRYPLAKVILFPTLVQGEQAPLSIVQ 186

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           +I + N +         D++I+ RGGGSIE+LW FN+E++ RAI  S +PIISA+GHETD
Sbjct: 187 SIQKANDIG------YIDVLIVGRGGGSIEELWAFNEEIVARAIFASRVPIISAVGHETD 240

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ ADLRAPTPTGAAE+AVP    L S + + +ARL    IR  K ++N     L+
Sbjct: 241 YTIADFVADLRAPTPTGAAELAVPHVADLLSRVSDQQARL----IRATKERLNAEQKRLQ 296

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
           +L +S       RY   RL  + E  L++++ R  R  N ++             K ++H
Sbjct: 297 SLRSS----YAFRYP-KRLYEQKEQQLDMLVDRLQRQMNDML-------------KQKEH 338

Query: 373 ILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILS 432
            L++ Q                       L +     ++RI      I+ L   I   ++
Sbjct: 339 KLQQLQ-----------------------LTLFAHHPQSRIEKAADRIRTLQQTIVRNMN 375

Query: 433 HKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDG 492
             +K    S++ T   L + +    ++RGY+   D     I     L T  R+ I F DG
Sbjct: 376 DVMKQKKWSLATTMAKLDALSPLKIMERGYSLAYDEQETLIKTVTQLQTGDRVHIRFQDG 435

Query: 493 QANAIVIN 500
           +A+ IV N
Sbjct: 436 RAHCIVSN 443


>gi|258541125|ref|YP_003186558.1| exodeoxyribonuclease VII large subunit [Acetobacter pasteurianus
           IFO 3283-01]
 gi|256632203|dbj|BAH98178.1| exodeoxyribonuclease VII large subunit [Acetobacter pasteurianus
           IFO 3283-01]
 gi|256635260|dbj|BAI01229.1| exodeoxyribonuclease VII large subunit [Acetobacter pasteurianus
           IFO 3283-03]
 gi|256638315|dbj|BAI04277.1| exodeoxyribonuclease VII large subunit [Acetobacter pasteurianus
           IFO 3283-07]
 gi|256641369|dbj|BAI07324.1| exodeoxyribonuclease VII large subunit [Acetobacter pasteurianus
           IFO 3283-22]
 gi|256644424|dbj|BAI10372.1| exodeoxyribonuclease VII large subunit [Acetobacter pasteurianus
           IFO 3283-26]
 gi|256647479|dbj|BAI13420.1| exodeoxyribonuclease VII large subunit [Acetobacter pasteurianus
           IFO 3283-32]
 gi|256650532|dbj|BAI16466.1| exodeoxyribonuclease VII large subunit [Acetobacter pasteurianus
           IFO 3283-01-42C]
 gi|256653523|dbj|BAI19450.1| exodeoxyribonuclease VII large subunit [Acetobacter pasteurianus
           IFO 3283-12]
          Length = 484

 Score =  289 bits (739), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 166/488 (34%), Positives = 267/488 (54%), Gaps = 34/488 (6%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           PE++VSE+S  ++  +E   S V VRGEI+  +  + SGH YFSLKD   +I  ++W+G+
Sbjct: 15  PEFTVSEISGAIRRTLEGTFSRVRVRGEITELK-RYPSGHVYFSLKDERGKISGVVWRGS 73

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
           ++++   PE G+E +  GKI+ +   S YQ+++E +  +G G LL  +E+ + +L EEGL
Sbjct: 74  VSRLGLAPENGVEIIATGKISAYGERSSYQLVVERMEYAGEGALLARIERLRIRLAEEGL 133

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F    K  IP +P++I V+TSP GAV+ DI   +  RFP  VI++PV VQG+     IA 
Sbjct: 134 FDTACKKAIPLLPRVIGVVTSPQGAVLHDICTTLQRRFPRPVIVWPVPVQGEGAAARIAA 193

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   + L      PRPD++I+ARGGGS+EDL  FNDE +VRA A  +IP+ISA+GHETD
Sbjct: 194 AIDGFSQLDGQGAVPRPDVLIVARGGGSLEDLMAFNDEAVVRAAAACTIPLISAVGHETD 253

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            TL D+A+D RAPTPT AAEMAVPV+  L + + +  AR    + RL++     L+    
Sbjct: 254 TTLIDFASDRRAPTPTAAAEMAVPVRTELLADIEHRNARALGALSRLLQTARLRLDRASS 313

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
           A+P+    L  +R +LD   R L+  L  +                       +Q+ +  
Sbjct: 314 AMPDLPSLLQTARMQLDDRGRRLDVALPAL-----------------------VQRRKAD 350

Query: 373 ILEKQQHIEQIVKQHLRYIFLEKKEKIAIL-HMLREQTKNRIFYLHTHIKKLITRIEFI- 430
           ++  ++H+  +       +   ++ ++A+L +ML+    +        + +L  RI    
Sbjct: 351 LVAIERHMPAV-----ETLLAGRRTRLAVLANMLQASMAHTFQKQDARLGRL--RISPAP 403

Query: 431 LSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFF 490
           L   ++   T+++     L++ + +  L RGY ++       +T    L    R+ + F 
Sbjct: 404 LQALVRERRTALAGIAGQLEAVSPRAVLARGY-ALVTAEGRPVTSAEQLRDGERVELTFG 462

Query: 491 DGQANAIV 498
           DG   A++
Sbjct: 463 DGARPAVI 470


>gi|58040160|ref|YP_192124.1| exodeoxyribonuclease VII large subunit [Gluconobacter oxydans 621H]
 gi|58002574|gb|AAW61468.1| Exodeoxyribonuclease VII large subunit [Gluconobacter oxydans 621H]
          Length = 517

 Score =  287 bits (735), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 177/507 (34%), Positives = 277/507 (54%), Gaps = 25/507 (4%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           P+YSVSE+S  +K  +ES    V VRGE++  +  + SGH Y SLKD   +I  +IW+G+
Sbjct: 14  PQYSVSEISGAIKRTLESGFGRVRVRGEVTELK-RYPSGHVYLSLKDEGGKIAGVIWRGS 72

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
           ++++   PE G E +  G+++ +   S YQ++I+ +  +G G LL  +E+ ++KLLEEGL
Sbjct: 73  VSRLGMAPENGNEVIATGRVSAYGERSSYQLVIDRMEFAGEGALLANIERLRRKLLEEGL 132

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F  + K  IPF+P ++ VITS +GAV+ DI+  IS RFP  V+++PV VQG+    +IA 
Sbjct: 133 FEPERKKAIPFLPSLVGVITSRSGAVLHDIITTISRRFPRDVLLWPVPVQGEGAAAQIAA 192

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI  + +++  RT   PD++I+ARGGGS+EDL  FNDE ++RA+AN  +PIISA+GHETD
Sbjct: 193 AIEGM-SVRRPRT---PDVLIVARGGGSLEDLMAFNDERVLRAVANCPVPIISAVGHETD 248

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            TL D  +D RAPTPT AAEMAVP++  + + + +  ARL   + R+I+     L+    
Sbjct: 249 TTLIDLVSDRRAPTPTAAAEMAVPLRSEMVADMAHRNARLTGALTRIIQTARAQLDQAAA 308

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
            LP+    L  +R RLD   + L+  L   + R     +     + S  L+    + R  
Sbjct: 309 RLPDLPGLLDSARMRLDDRGQRLDLALPSFVMRVRNRLDAPGMHLPSPELLIGRSRARLQ 368

Query: 373 ILEKQQHIEQIVKQ----------HLRYIFLEKKEKIAILHMLRE------QTKNRIFYL 416
            L +    E +V +          HL    L  + + A L ++        Q   + F L
Sbjct: 369 AL-RLPAPELLVSRARARLTAPTTHLPSPELLIERRRAGLRLVSGELDTAWQRSLQTFQL 427

Query: 417 HTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQK 476
            T  ++L      IL   I+     +      L++ + +  L RGY  +QD N   +T  
Sbjct: 428 RTERQRLSPD---ILRSAIRLQQARLQGLGSHLEAVSPRAILSRGYVLVQDVNGQPVTSA 484

Query: 477 RNLATKTRILINFFDGQANAIVINKAP 503
                  R++++F DG   A + + +P
Sbjct: 485 EARPVADRVVLSFADGDRGARLDSLSP 511


>gi|68171557|ref|ZP_00544934.1| Exonuclease VII, large subunit [Ehrlichia chaffeensis str. Sapulpa]
 gi|88657931|ref|YP_506887.1| putative exodeoxyribonuclease VII, large subunit [Ehrlichia
           chaffeensis str. Arkansas]
 gi|67999023|gb|EAM85697.1| Exonuclease VII, large subunit [Ehrlichia chaffeensis str. Sapulpa]
 gi|88599388|gb|ABD44857.1| putative exodeoxyribonuclease VII, large subunit [Ehrlichia
           chaffeensis str. Arkansas]
          Length = 388

 Score =  280 bits (717), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 148/293 (50%), Positives = 198/293 (67%), Gaps = 13/293 (4%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           PE++VSE++   ++ V    +H+ VRGEIS       SGH YF+LKD+ + ++AI W  T
Sbjct: 3   PEFTVSEITKIFQNFVHETFTHIKVRGEISNLSQ-PKSGHTYFTLKDDAAVLNAICWNNT 61

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
             K+EF  + G+E +  G +TT+   SKYQ+I E+++ +G G L   LE+RK KL +EGL
Sbjct: 62  --KVEFDLKNGLEVICSGFLTTY--QSKYQLITENMLLAGIGNLKIMLEQRKAKLEKEGL 117

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F   +K P+P +PKI  VITS TGAVI DIL R+  RFP  ++I PV VQG+E   +I +
Sbjct: 118 FDQSNKKPLPLLPKITGVITSTTGAVINDILNRVKSRFPSHIVISPVSVQGNESINQIID 177

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI +LN         +PD+II+ARGGGSIEDLW FNDE IVRA+A SSIPI+SAIGHETD
Sbjct: 178 AISKLN----NADTNKPDVIIIARGGGSIEDLWIFNDESIVRAVARSSIPIVSAIGHETD 233

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKIN 305
           +TL DYAAD+RAPTPT A E+ +P K  L   + ++ ++ N I   L  YKIN
Sbjct: 234 FTLIDYAADVRAPTPTAAVEIVLPTKTQL---IEHINSKFNKIKTTL-HYKIN 282



 Score = 40.4 bits (93), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 61/129 (47%), Gaps = 6/129 (4%)

Query: 376 KQQHIEQI------VKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEF 429
           K Q IE I      +K  L Y   +KKE++  LH    +TK++I  L   + +   +IE 
Sbjct: 259 KTQLIEHINSKFNKIKTTLHYKINKKKERLFYLHNNLIKTKHQIKVLKLQLSEYKNKIEV 318

Query: 430 ILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINF 489
           +L   + +   S++     +  F  + TL+ GY  + DTN N I+  + L +   I I  
Sbjct: 319 LLKILLLNKKQSLNALYNKINKFNKEKTLEAGYAVLYDTNRNHISSIKKLKSNDIISIEL 378

Query: 490 FDGQANAIV 498
            DG   AI+
Sbjct: 379 KDGIIEAII 387


>gi|57238767|ref|YP_179903.1| putative exodeoxyribonuclease VII large subunit [Ehrlichia
           ruminantium str. Welgevonden]
 gi|58578688|ref|YP_196900.1| putative exodeoxyribonuclease VII large subunit [Ehrlichia
           ruminantium str. Welgevonden]
 gi|58616751|ref|YP_195950.1| putative exodeoxyribonuclease VII large subunit [Ehrlichia
           ruminantium str. Gardel]
 gi|57160846|emb|CAH57744.1| exodeoxyribonuclease VII large subunit [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58416363|emb|CAI27476.1| Probable exodeoxyribonuclease VII large subunit [Ehrlichia
           ruminantium str. Gardel]
 gi|58417314|emb|CAI26518.1| Probable exodeoxyribonuclease VII large subunit [Ehrlichia
           ruminantium str. Welgevonden]
          Length = 388

 Score =  278 bits (710), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 165/384 (42%), Positives = 233/384 (60%), Gaps = 32/384 (8%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           E++VSE++   +++V    +H+ VRGEIS       SGH YF+LKD+ + ++A+ W  T 
Sbjct: 4   EFTVSEITKIFQNLVHETFNHIKVRGEISNLSQ-PKSGHTYFTLKDHQAVLNAVCWNNT- 61

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            KIE   + G+E + IG +TT+   SKYQIIIES++ SG G L   L++RK KL +EGLF
Sbjct: 62  -KIEIDLKNGLEVICIGFLTTY--QSKYQIIIESMLLSGIGNLEIMLQQRKAKLEKEGLF 118

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
               K  +P +PK I VITS TGA I DIL R+  RFP  ++IFPV VQG++   +I NA
Sbjct: 119 DQSRKKTLPLLPKTIGVITSTTGAAINDILNRVKSRFPSHIVIFPVLVQGNDAVTQIVNA 178

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I + N  +    CP  D++I+ARGGGS+EDLW FNDE+IVRAIA S IPI+SAIGHETD+
Sbjct: 179 IHKSNNTETD--CP--DVLIIARGGGSVEDLWIFNDELIVRAIAKSRIPIVSAIGHETDF 234

Query: 254 TLADYAADLRAPTPTGAAEMAVPVK----EHLQSSLINLEARLNNIIIRLIKYKINTLNS 309
           TL DYAAD+RAPTPT A E+ +P K    E++ S    ++A L+        Y +NT  +
Sbjct: 235 TLVDYAADVRAPTPTAAVEIILPTKIQVTEYINSKFNKIKAALH--------YTVNTKRN 286

Query: 310 LLKALPNSDQTLSCSRYRLDRLPREL-------EHNLEIIIFRKYRHFNHIINRIKSDFL 362
            L    N    L  +R+++  L  +L       E  L++I+  K ++ N +  +I     
Sbjct: 287 KLLYFHNQ---LEITRHKIKVLKLQLFKHKNKVEILLKVILLNKRQYLNDLYYKISKYNK 343

Query: 363 IHNIQKNRQHILEK-QQHIEQIVK 385
             N++     I +K  QHI  + K
Sbjct: 344 EKNLELGYAVIYDKNHQHISSVKK 367


>gi|205374082|ref|ZP_03226882.1| exodeoxyribonuclease VII large subunit [Bacillus coahuilensis m4-4]
          Length = 445

 Score =  274 bits (701), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 147/389 (37%), Positives = 232/389 (59%), Gaps = 22/389 (5%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           S+  L+ ++K   E +  L+ V +RGE+S ++  HSSGH YF+LKD+ +RI +I++  + 
Sbjct: 8   SIGALTKYIKRKFERDPHLTGVHIRGELSNFKS-HSSGHLYFTLKDDKARISSIMFASSA 66

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             ++F PE G++ LV G +T +    +YQI ++++ P G G L  A E+ K  L +EGLF
Sbjct: 67  KSLKFNPENGMKVLVTGDVTVYESGGQYQIYVKTMEPDGIGALYLAYEQLKANLEQEGLF 126

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
              HK P+P  P+++ V+TSPTGA +RDI+  I  R+P+ ++++ P  VQG +    I  
Sbjct: 127 DTAHKKPLPLYPRVVGVVTSPTGAAVRDIITTIKRRYPIAKILVLPALVQGGQAAPSIVK 186

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI Q N++      P+ D+II+ RGGGSIE+LW FN+E + RAI  S++P+ISA+GHETD
Sbjct: 187 AIAQANSI------PKMDVIIVGRGGGSIEELWAFNEEAVARAIFQSNVPVISAVGHETD 240

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ AD RAPTPT AAE+AVP  E +   +++ E RLN  +   I+     L +L  
Sbjct: 241 FTIADFVADQRAPTPTAAAELAVPHIEEITERVLSRELRLNRAVNERIRQSQTALKALTD 300

Query: 313 --ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH-----N 365
             AL N  +       RLDRL   L      ++ +K      +  R++    IH     +
Sbjct: 301 SYALRNPKRLYEQHMERLDRLTESLGTEQNRMLDKKSEQLKGLARRLE---FIHPGKAMS 357

Query: 366 IQKNRQHILEKQQ--HIEQIVKQHLRYIF 392
            QK +   L KQQ  H++++++   + ++
Sbjct: 358 NQKEQLDRLTKQQNYHMKRMIESSQKELY 386


>gi|228998972|ref|ZP_04158554.1| Exodeoxyribonuclease 7 large subunit [Bacillus mycoides Rock3-17]
 gi|228760589|gb|EEM09553.1| Exodeoxyribonuclease 7 large subunit [Bacillus mycoides Rock3-17]
          Length = 452

 Score =  271 bits (694), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 166/406 (40%), Positives = 232/406 (57%), Gaps = 29/406 (7%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ ++K  +E +  L  V ++GEIS ++  HS GH YF+LKD ++RI A+++ G  
Sbjct: 7   TVTALTRYIKTKIEYDPHLQSVWLKGEISNFK-CHSRGHMYFTLKDENARIAAVMFAGHN 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             I+F PE+G++ LV GKI+ +  S  YQI +  + P G G L  A E+ K +L EEGLF
Sbjct: 66  RNIKFRPEDGMKVLVKGKISVYEASGSYQIYVHDMQPDGIGNLHLAYEQLKVRLEEEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
           S  +K PIP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+     I  
Sbjct: 126 SQVYKQPIPAYAKTIGVITSPTGAAIRDIIATIKRRYPIGNVIVFPVLVQGESAAPSIVQ 185

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N +K+       D +I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA+GHETD
Sbjct: 186 AIQTANEMKD------IDALIVGRGGGSIEELWAFNEEMVARAIFASEIPIISAVGHETD 239

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  ++  K   L +L K
Sbjct: 240 FTIADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRTMREMLHKKQEQLQTLQK 299

Query: 313 --ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS-DFLIHN---- 365
             A     Q       +LDR        LE +I  K R+    +N++K   F +      
Sbjct: 300 SYAFRYPKQVYEQKEEQLDR-------TLEQLILVKERYVEKKVNQLKQLSFYLEKHHPS 352

Query: 366 ---IQ-KNRQHILEKQQHIE-QIVKQHLRYIFLEKKEKIAILHMLR 406
              +Q K R   L+KQ   E Q + Q   + F+   +K+  L  L+
Sbjct: 353 QKIVQTKTRVETLQKQLQREMQTLLQTKEFAFMRAAQKLEALSPLK 398


>gi|228992928|ref|ZP_04152852.1| Exodeoxyribonuclease 7 large subunit [Bacillus pseudomycoides DSM
           12442]
 gi|228766785|gb|EEM15424.1| Exodeoxyribonuclease 7 large subunit [Bacillus pseudomycoides DSM
           12442]
          Length = 452

 Score =  271 bits (694), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 161/389 (41%), Positives = 225/389 (57%), Gaps = 21/389 (5%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ ++K  +E +  L  V ++GEIS ++  HS GH YF+LKD ++RI A+++ G  
Sbjct: 7   TVTALTRYIKTKIEYDPHLQSVWLKGEISNFK-CHSRGHMYFTLKDENARIAAVMFAGHN 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             I+F PE+G++ LV GKI+ +  S  YQI +  + P G G L  A E+ K +L EEGLF
Sbjct: 66  RNIKFRPEDGMKVLVKGKISVYEASGSYQIYVHDMQPDGIGNLHLAYEQLKVRLEEEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
           S  +K PIP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+     I  
Sbjct: 126 SQVYKQPIPAYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESAAPSIVQ 185

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N +K+       D +I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA+GHETD
Sbjct: 186 AIQTANEMKD------IDALIVGRGGGSIEELWAFNEEMVARAIFASEIPIISAVGHETD 239

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  ++  K   L +L K
Sbjct: 240 FTIADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMREMLHKKQEQLQTLQK 299

Query: 313 --ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNR 370
             A     Q       +LDR        LE +I  K R+    +N++K            
Sbjct: 300 SYAFRYPKQVYEQKEEQLDR-------TLEQLILVKERYVEKKVNQLKQLSFYLEKHHPS 352

Query: 371 QHILEKQQHIEQIVKQHLRYI--FLEKKE 397
           Q I++ +  +E + KQ  R +   L+ KE
Sbjct: 353 QKIVQTKTRVETLQKQLQREMQTLLQTKE 381


>gi|229086755|ref|ZP_04218921.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus Rock3-44]
 gi|228696576|gb|EEL49395.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus Rock3-44]
          Length = 452

 Score =  271 bits (693), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 161/404 (39%), Positives = 236/404 (58%), Gaps = 25/404 (6%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ ++K  +E +  L  V ++GEIS ++  HS GH YF+LKD ++RI A+++ G  
Sbjct: 7   TVTALTRYIKTKIEYDPHLQSVWLKGEISNFK-YHSRGHMYFTLKDENARIAAVMFAGHN 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L EEGLF
Sbjct: 66  RNIKFKPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGIGNLHLAYEQLKVRLEEEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
           S  +K PIP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+     I  
Sbjct: 126 SQVYKQPIPAYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESAAPSIVQ 185

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI + N + E       D++I+ RGGGSIE+LW FN+E + RAI  S+IPIISA+GHETD
Sbjct: 186 AIRKANEMNE------IDVLIVGRGGGSIEELWAFNEESVARAIFTSAIPIISAVGHETD 239

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ ADLRAPTPT AAE+A P    LQ  ++    R+   +  ++  +   L +L K
Sbjct: 240 FTIADFVADLRAPTPTAAAELAAPNILELQEKVLQRTLRMQRAMREMVHKRQEQLQTLQK 299

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS-DFLI---HNIQK 368
           +           R   ++   +L+  LE ++  K R+ +  +N+++   F +   H  QK
Sbjct: 300 SY-----AFRYPRQVYEQKEEQLDRALEQLMLAKGRYIDKKVNQLQQLSFYLEKHHPSQK 354

Query: 369 NRQ-----HILEKQ-QHIEQIVKQHLRYIFLEKKEKIAILHMLR 406
             Q      IL+KQ Q   Q + Q   + F+   +K+  L  L+
Sbjct: 355 ILQTKTKIEILQKQIQREMQTLMQTKEFAFMRAAQKLEALSPLK 398


>gi|228941341|ref|ZP_04103893.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar berliner ATCC 10792]
 gi|228974273|ref|ZP_04134842.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228980866|ref|ZP_04141170.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis Bt407]
 gi|228778802|gb|EEM27065.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis Bt407]
 gi|228785323|gb|EEM33333.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228818267|gb|EEM64340.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar berliner ATCC 10792]
          Length = 452

 Score =  271 bits (693), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 158/387 (40%), Positives = 226/387 (58%), Gaps = 17/387 (4%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ ++K  +E +  L  V ++GEIS ++  HS GH YF+LKD ++RI A+++ G  
Sbjct: 7   TVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAVMFAGHN 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L EEGLF
Sbjct: 66  RNIKFKPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGVGNLHLAYEQLKVRLEEEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
           S  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+     I  
Sbjct: 126 SQVYKKAIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESAAPSIVQ 185

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N ++E       D++I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA+GHETD
Sbjct: 186 AIRTANEMRE------IDVLIVGRGGGSIEELWAFNEEMVARAIFKSEIPIISAVGHETD 239

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   L  L K
Sbjct: 240 FTIADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMKELVHKKEEKLQVLQK 299

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
           +           R   ++   +L+  LE ++  K R+ +  +N++K            Q 
Sbjct: 300 SY-----AFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQK 354

Query: 373 ILEKQQHIEQIVKQHLRYI--FLEKKE 397
           I++ +  +E + KQ  R +   L+ KE
Sbjct: 355 IIQTKVAVETLQKQLQREMQTLLQTKE 381


>gi|319651491|ref|ZP_08005619.1| exodeoxyribonuclease 7 large subunit [Bacillus sp. 2_A_57_CT2]
 gi|317396806|gb|EFV77516.1| exodeoxyribonuclease 7 large subunit [Bacillus sp. 2_A_57_CT2]
          Length = 446

 Score =  270 bits (691), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 138/299 (46%), Positives = 198/299 (66%), Gaps = 14/299 (4%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ ++K   +++  L ++ V+GEIS ++  HSSGH YF+LKD  +RI A+++ G  
Sbjct: 8   TVNALTKYIKRKFDADPHLQNILVKGEISNFKQ-HSSGHMYFTLKDEKARILAVMFAGNA 66

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             ++F PE G++ LV G I+ +  S +YQI ++ + P G G L  A E+ K+KL +EG F
Sbjct: 67  RTMKFRPENGMKVLVRGAISVYESSGQYQIYVQEMQPDGIGELYLAYEQLKEKLEKEGFF 126

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
           S  HK  IP  PK +AVITSPTGA IRDIL  +  R+P+  ++I+P  VQG++    I  
Sbjct: 127 SPAHKKDIPRYPKTVAVITSPTGAAIRDILTTLKRRYPIANILIYPALVQGNQAAPSIVK 186

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI + NT ++       D++I+ RGGGSIE+LW FN+E + RAI  S IPIISA+GHETD
Sbjct: 187 AITEANTSRDA------DVLIIGRGGGSIEELWAFNEEAVARAIFKSEIPIISAVGHETD 240

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLL 311
           +T+AD+ ADLRAPTPTGAAE+AVP  + L   L N ++RL    IR +K ++   N  L
Sbjct: 241 FTIADFVADLRAPTPTGAAELAVPHIDDLTERLFNRQSRL----IRAMKEQVALQNERL 295


>gi|209544981|ref|YP_002277210.1| exodeoxyribonuclease VII large subunit [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209532658|gb|ACI52595.1| exodeoxyribonuclease VII, large subunit [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 486

 Score =  270 bits (691), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 169/486 (34%), Positives = 264/486 (54%), Gaps = 37/486 (7%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           PEYSVSE+S  ++  +E     V VRGEI+ ++  + SGH YFSLKD   +I +++W+G+
Sbjct: 17  PEYSVSEISGAIRRTLEGTFGRVRVRGEITEFK-RYPSGHLYFSLKDEGGKISSVVWRGS 75

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
           ++++   PE G+E +  GKI+++   S YQ+II+ L  +G G LL  +E+ + KL  EGL
Sbjct: 76  VSRLGLKPENGVEVVATGKISSYGERSSYQLIIDRLDYAGEGALLARIERLRLKLAAEGL 135

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F    K  +PF+P +I V+TS  GAV+ DI   I+ RFP R++++PV VQG+    +IA 
Sbjct: 136 FDAAGKRALPFLPDVIGVVTSAQGAVMHDIRTTIARRFPRRLLVWPVAVQGEAAAAQIAA 195

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   + +      PRPD++I+ARGGGS+EDL  FNDE+++RA A   IP+ISA+GHETD
Sbjct: 196 AIAGFDAIDGRGPIPRPDVLIVARGGGSLEDLMAFNDEVVLRAAAACRIPLISAVGHETD 255

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            TL D+ +D RAPTPT AAE+A P +  L + L +  ARL + + RL +     L+    
Sbjct: 256 TTLIDFVSDRRAPTPTAAAELAAPARAELVADLGHRAARLTSGLARLTQTLRLRLDRAAA 315

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
            LP+    L  +R RLD     L+  L  ++ R+      +   + S  L+   ++ R  
Sbjct: 316 RLPDLPSLLGTARMRLDDRGHRLDMALPALVARRRAALLAVERAMPSASLLTGPRRARLA 375

Query: 373 ILEKQQHIEQIVKQHLR----YIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIE 428
           +     H++  ++Q LR         +     +  MLRE+          H+  L  R+E
Sbjct: 376 L--AASHLQSGLRQALRDGHARADRTRLRPAPLAAMLRER--------RAHLAGLAGRLE 425

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
                                 S +    L+RGY  ++D     +T+  ++    R+++ 
Sbjct: 426 ----------------------SLSPMAVLERGYVLVRDPAGVPVTRAADVRPGGRLVLI 463

Query: 489 FFDGQA 494
           F DG+A
Sbjct: 464 FADGEA 469


>gi|30264255|ref|NP_846632.1| exodeoxyribonuclease VII large subunit [Bacillus anthracis str.
           Ames]
 gi|47529698|ref|YP_021047.1| exodeoxyribonuclease VII large subunit [Bacillus anthracis str.
           'Ames Ancestor']
 gi|49187082|ref|YP_030334.1| exodeoxyribonuclease VII large subunit [Bacillus anthracis str.
           Sterne]
 gi|65321565|ref|ZP_00394524.1| COG1570: Exonuclease VII, large subunit [Bacillus anthracis str.
           A2012]
 gi|165872985|ref|ZP_02217607.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis str.
           A0488]
 gi|167634492|ref|ZP_02392812.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis str.
           A0442]
 gi|167638588|ref|ZP_02396864.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis str.
           A0193]
 gi|170687494|ref|ZP_02878711.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis str.
           A0465]
 gi|170709012|ref|ZP_02899442.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis str.
           A0389]
 gi|177654828|ref|ZP_02936585.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis str.
           A0174]
 gi|190566009|ref|ZP_03018928.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis
           Tsiankovskii-I]
 gi|227816956|ref|YP_002816965.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis str.
           CDC 684]
 gi|229604498|ref|YP_002868474.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis str.
           A0248]
 gi|254683944|ref|ZP_05147804.1| exodeoxyribonuclease VII large subunit [Bacillus anthracis str.
           CNEVA-9066]
 gi|254721779|ref|ZP_05183568.1| exodeoxyribonuclease VII large subunit [Bacillus anthracis str.
           A1055]
 gi|254736292|ref|ZP_05193998.1| exodeoxyribonuclease VII large subunit [Bacillus anthracis str.
           Western North America USA6153]
 gi|254741330|ref|ZP_05199017.1| exodeoxyribonuclease VII large subunit [Bacillus anthracis str.
           Kruger B]
 gi|254754036|ref|ZP_05206071.1| exodeoxyribonuclease VII large subunit [Bacillus anthracis str.
           Vollum]
 gi|254757907|ref|ZP_05209934.1| exodeoxyribonuclease VII large subunit [Bacillus anthracis str.
           Australia 94]
 gi|81837607|sp|Q81M51|EX7L_BACAN RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|254783687|sp|C3P7V9|EX7L_BACAA RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|254783688|sp|C3LJV4|EX7L_BACAC RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|30258900|gb|AAP28118.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis str.
           Ames]
 gi|47504846|gb|AAT33522.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis str.
           'Ames Ancestor']
 gi|49181009|gb|AAT56385.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis str.
           Sterne]
 gi|164711268|gb|EDR16823.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis str.
           A0488]
 gi|167513436|gb|EDR88806.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis str.
           A0193]
 gi|167529944|gb|EDR92679.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis str.
           A0442]
 gi|170126039|gb|EDS94936.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis str.
           A0389]
 gi|170668689|gb|EDT19435.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis str.
           A0465]
 gi|172080489|gb|EDT65575.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis str.
           A0174]
 gi|190562928|gb|EDV16894.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis
           Tsiankovskii-I]
 gi|227004511|gb|ACP14254.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis str.
           CDC 684]
 gi|229268906|gb|ACQ50543.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis str.
           A0248]
          Length = 452

 Score =  270 bits (690), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 158/387 (40%), Positives = 226/387 (58%), Gaps = 17/387 (4%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ ++K  +E +  L  V ++GEIS ++  HS GH YF+LKD ++RI A+++ G  
Sbjct: 7   TVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAVMFAGHN 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L EEGLF
Sbjct: 66  RNIKFRPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGIGNLHLAYEQLKVRLEEEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
           S  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+     I  
Sbjct: 126 SQVYKKTIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESAAPSIVQ 185

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N ++E       D++I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA+GHETD
Sbjct: 186 AIRTANEMEE------IDVLIVGRGGGSIEELWAFNEEMVARAIFKSEIPIISAVGHETD 239

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   L  L K
Sbjct: 240 FTIADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMRELVHKKEEKLQVLQK 299

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
           +           R   ++   +L+  LE ++  K R+ +  +N++K            Q 
Sbjct: 300 SY-----AFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQK 354

Query: 373 ILEKQQHIEQIVKQHLRYI--FLEKKE 397
           I++ +  +E + KQ  R +   L+ KE
Sbjct: 355 IMQTKVAVETLQKQLQREMQTLLQAKE 381


>gi|206976322|ref|ZP_03237230.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus H3081.97]
 gi|206745518|gb|EDZ56917.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus H3081.97]
          Length = 452

 Score =  270 bits (690), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 160/387 (41%), Positives = 227/387 (58%), Gaps = 17/387 (4%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ ++K  +E +  L  V ++GEIS ++  HS GH YF+LKD ++RI A+++ G  
Sbjct: 7   TVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAVMFAGHN 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L EEGLF
Sbjct: 66  RNIKFRPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGVGNLHLAYEQLKVRLEEEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
           S  +K  IP   K I VITSPTGAVIRDI+  I  R+P+  VI+FPV VQG+     I  
Sbjct: 126 SQVYKKTIPPYAKTIGVITSPTGAVIRDIITTIKRRYPIGNVIVFPVLVQGESAAPSIVQ 185

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N + EG      D++I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA+GHETD
Sbjct: 186 AIRTANEM-EG-----IDVLIVGRGGGSIEELWAFNEEMVARAIFKSEIPIISAVGHETD 239

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   L  L K
Sbjct: 240 FTIADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMRELVHKKEEKLQVLQK 299

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
           +           R   ++   +L+  LE ++  K R+ +  +N++K            Q 
Sbjct: 300 SY-----AFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQK 354

Query: 373 ILEKQQHIEQIVKQHLRYI--FLEKKE 397
           I++ +  +E + KQ  R +   L+ KE
Sbjct: 355 IMQTKVAVETLQKQLQREMQTLLQTKE 381


>gi|49480925|ref|YP_038241.1| exodeoxyribonuclease VII large subunit [Bacillus thuringiensis
           serovar konkukian str. 97-27]
 gi|52141317|ref|YP_085513.1| exodeoxyribonuclease VII large subunit [Bacillus cereus E33L]
 gi|118479371|ref|YP_896522.1| exodeoxyribonuclease VII large subunit [Bacillus thuringiensis str.
           Al Hakam]
 gi|196046399|ref|ZP_03113625.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus 03BB108]
 gi|218905316|ref|YP_002453150.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus AH820]
 gi|228929226|ref|ZP_04092253.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
 gi|228935503|ref|ZP_04098321.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|228947897|ref|ZP_04110184.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|229093239|ref|ZP_04224357.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus Rock3-42]
 gi|229123700|ref|ZP_04252895.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus 95/8201]
 gi|229186423|ref|ZP_04313587.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus BGSC 6E1]
 gi|81824192|sp|Q635A4|EX7L_BACCZ RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|81828207|sp|Q6HDY5|EX7L_BACHK RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|158512496|sp|A0RIH2|EX7L_BACAH RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|226694634|sp|B7JM31|EX7L_BACC0 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|49332481|gb|AAT63127.1| exodeoxyribonuclease VII, large subunit [Bacillus thuringiensis
           serovar konkukian str. 97-27]
 gi|51974786|gb|AAU16336.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus E33L]
 gi|118418596|gb|ABK87015.1| Exodeoxyribonuclease VII large subunit [Bacillus thuringiensis str.
           Al Hakam]
 gi|196022869|gb|EDX61550.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus 03BB108]
 gi|218539843|gb|ACK92241.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus AH820]
 gi|228597050|gb|EEK54706.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus BGSC 6E1]
 gi|228659835|gb|EEL15480.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus 95/8201]
 gi|228690213|gb|EEL44007.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus Rock3-42]
 gi|228811884|gb|EEM58218.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|228824255|gb|EEM70069.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|228830516|gb|EEM76126.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
          Length = 452

 Score =  270 bits (690), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 158/387 (40%), Positives = 226/387 (58%), Gaps = 17/387 (4%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ ++K  +E +  L  V ++GEIS ++  HS GH YF+LKD ++RI A+++ G  
Sbjct: 7   TVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAVMFAGHN 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L EEGLF
Sbjct: 66  RNIKFRPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGIGNLHLAYEQLKVRLEEEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
           S  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+     I  
Sbjct: 126 SQVYKKTIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESAAPSIVQ 185

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N ++E       D++I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA+GHETD
Sbjct: 186 AIRTANEMEE------IDVLIVGRGGGSIEELWAFNEEMVARAIFKSEIPIISAVGHETD 239

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   L  L K
Sbjct: 240 FTIADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMRELVHKKEEKLQVLQK 299

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
           +           R   ++   +L+  LE ++  K R+ +  +N++K            Q 
Sbjct: 300 SY-----AFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQK 354

Query: 373 ILEKQQHIEQIVKQHLRYI--FLEKKE 397
           I++ +  +E + KQ  R +   L+ KE
Sbjct: 355 IMQTKVAVETLQKQLQREMQTLLQTKE 381


>gi|229111655|ref|ZP_04241205.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus Rock1-15]
 gi|228671790|gb|EEL27084.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus Rock1-15]
          Length = 452

 Score =  270 bits (690), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 158/387 (40%), Positives = 225/387 (58%), Gaps = 17/387 (4%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ ++K  +E +  L  V ++GEIS ++  HS GH YF+LKD ++RI A+++ G  
Sbjct: 7   TVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAVMFAGHN 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L EEGLF
Sbjct: 66  RNIKFKPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGVGNLHLAYEQLKVRLEEEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
           S  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+     I  
Sbjct: 126 SQVYKKAIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESAAPSIVQ 185

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N + E       D++I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA+GHETD
Sbjct: 186 AIRTANEMGE------IDVLIVGRGGGSIEELWAFNEEMVARAIFQSEIPIISAVGHETD 239

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   L  L K
Sbjct: 240 FTIADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMRELVHKKEEKLQVLQK 299

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
           +           R   ++   +L+  LE ++  K R+ +  +N++K            Q 
Sbjct: 300 SY-----AFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQK 354

Query: 373 ILEKQQHIEQIVKQHLRYI--FLEKKE 397
           I++ +  +E + KQ  R +   L+ KE
Sbjct: 355 IMQTKVAVETLQKQLQREMQTLLQTKE 381


>gi|225866162|ref|YP_002751540.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus 03BB102]
 gi|254783689|sp|C1ERQ3|EX7L_BACC3 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|225786828|gb|ACO27045.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus 03BB102]
          Length = 452

 Score =  270 bits (690), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 158/387 (40%), Positives = 226/387 (58%), Gaps = 17/387 (4%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ ++K  +E +  L  V ++GEIS ++  HS GH YF+LKD ++RI A+++ G  
Sbjct: 7   TVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAVMFAGHN 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L EEGLF
Sbjct: 66  RNIKFRPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGIGNLHLAYEQLKVRLEEEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
           S  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+     I  
Sbjct: 126 SQVYKKTIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESAAPSIVQ 185

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N ++E       D++I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA+GHETD
Sbjct: 186 AIRTANEMEE------IDVLIVGRGGGSIEELWAFNEEMVARAIFKSEIPIISAVGHETD 239

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   L  L K
Sbjct: 240 FTVADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMRELVHKKEEKLQVLQK 299

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
           +           R   ++   +L+  LE ++  K R+ +  +N++K            Q 
Sbjct: 300 SY-----AFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQK 354

Query: 373 ILEKQQHIEQIVKQHLRYI--FLEKKE 397
           I++ +  +E + KQ  R +   L+ KE
Sbjct: 355 IMQTKVAVETLQKQLQREMQTLLQTKE 381


>gi|228902698|ref|ZP_04066845.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis IBL
           4222]
 gi|228856885|gb|EEN01398.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis IBL
           4222]
          Length = 452

 Score =  270 bits (690), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 158/387 (40%), Positives = 225/387 (58%), Gaps = 17/387 (4%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ ++K  +E +  L  V ++GEIS ++  HS GH YF+LKD ++RI A+++ G  
Sbjct: 7   TVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAVMFAGHN 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L EEGLF
Sbjct: 66  RNIKFKPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGVGNLHLAYEQLKVRLEEEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
           S  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+     I  
Sbjct: 126 SQVYKKAIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESAAPSIVQ 185

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N + E       D++I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA+GHETD
Sbjct: 186 AIRTANEMGE------IDVLIVGRGGGSIEELWAFNEEMVARAIFKSEIPIISAVGHETD 239

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   L  L K
Sbjct: 240 FTIADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMRELVHKKDEKLQVLQK 299

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
           +           R   ++   +L+  LE ++  K R+ +  +N++K            Q 
Sbjct: 300 SY-----AFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQK 354

Query: 373 ILEKQQHIEQIVKQHLRYI--FLEKKE 397
           I++ +  +E + KQ  R +   L+ KE
Sbjct: 355 IMQTKVAVETLQKQLQREMQTLLQTKE 381


>gi|30022262|ref|NP_833893.1| exodeoxyribonuclease VII large subunit [Bacillus cereus ATCC 14579]
 gi|206971365|ref|ZP_03232316.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus AH1134]
 gi|218899344|ref|YP_002447755.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus G9842]
 gi|228922935|ref|ZP_04086229.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
 gi|228954466|ref|ZP_04116491.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
 gi|228967221|ref|ZP_04128257.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar sotto str. T04001]
 gi|229047876|ref|ZP_04193452.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus AH676]
 gi|229071687|ref|ZP_04204903.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus F65185]
 gi|229081439|ref|ZP_04213939.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus Rock4-2]
 gi|229129460|ref|ZP_04258431.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus BDRD-Cer4]
 gi|229146755|ref|ZP_04275120.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus BDRD-ST24]
 gi|229180460|ref|ZP_04307802.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus 172560W]
 gi|296504669|ref|YP_003666369.1| exodeoxyribonuclease VII large subunit [Bacillus thuringiensis
           BMB171]
 gi|81837301|sp|Q818R6|EX7L_BACCR RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|226694635|sp|B7IXH1|EX7L_BACC2 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|29897819|gb|AAP11094.1| Exodeoxyribonuclease VII large subunit [Bacillus cereus ATCC 14579]
 gi|206734137|gb|EDZ51308.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus AH1134]
 gi|218544494|gb|ACK96888.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus G9842]
 gi|228602884|gb|EEK60363.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus 172560W]
 gi|228636583|gb|EEK93048.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus BDRD-ST24]
 gi|228654065|gb|EEL09932.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus BDRD-Cer4]
 gi|228701854|gb|EEL54340.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus Rock4-2]
 gi|228711418|gb|EEL63377.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus F65185]
 gi|228723333|gb|EEL74702.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus AH676]
 gi|228792590|gb|EEM40156.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar sotto str. T04001]
 gi|228805123|gb|EEM51717.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
 gi|228836706|gb|EEM82053.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
 gi|296325721|gb|ADH08649.1| exodeoxyribonuclease VII large subunit [Bacillus thuringiensis
           BMB171]
          Length = 452

 Score =  270 bits (689), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 158/387 (40%), Positives = 225/387 (58%), Gaps = 17/387 (4%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ ++K  +E +  L  V ++GEIS ++  HS GH YF+LKD ++RI A+++ G  
Sbjct: 7   TVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAVMFAGHN 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L EEGLF
Sbjct: 66  RNIKFKPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGVGNLHLAYEQLKVRLEEEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
           S  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+     I  
Sbjct: 126 SQVYKKAIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESAAPSIVQ 185

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N + E       D++I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA+GHETD
Sbjct: 186 AIRTANEMGE------IDVLIVGRGGGSIEELWAFNEEMVARAIFKSEIPIISAVGHETD 239

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   L  L K
Sbjct: 240 FTIADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMRELVHKKEEKLQVLQK 299

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
           +           R   ++   +L+  LE ++  K R+ +  +N++K            Q 
Sbjct: 300 SY-----AFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQK 354

Query: 373 ILEKQQHIEQIVKQHLRYI--FLEKKE 397
           I++ +  +E + KQ  R +   L+ KE
Sbjct: 355 IMQTKVAVETLQKQLQREMQTLLQTKE 381


>gi|162149287|ref|YP_001603748.1| exodeoxyribonuclease VII large subunit [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161787864|emb|CAP57462.1| putative exodeoxyribonuclease VII large subunit [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 526

 Score =  270 bits (689), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 169/486 (34%), Positives = 264/486 (54%), Gaps = 37/486 (7%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           PEYSVSE+S  ++  +E     V VRGEI+ ++  + SGH YFSLKD   +I +++W+G+
Sbjct: 57  PEYSVSEISGAIRRTLEGTFGRVRVRGEITEFK-RYPSGHLYFSLKDEGGKISSVVWRGS 115

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
           ++++   PE G+E +  GKI+++   S YQ+II+ L  +G G LL  +E+ + KL  EGL
Sbjct: 116 VSRLGLKPENGVEVVATGKISSYGERSSYQLIIDRLDYAGEGALLARIERLRLKLAAEGL 175

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F    K  +PF+P +I V+TS  GAV+ DI   I+ RFP R++++PV VQG+    +IA 
Sbjct: 176 FDAAGKRALPFLPDVIGVVTSAQGAVMHDIRTTIARRFPRRLLVWPVAVQGEAAAAQIAA 235

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   + +      PRPD++I+ARGGGS+EDL  FNDE+++RA A   IP+ISA+GHETD
Sbjct: 236 AIAGFDAIDGRGPIPRPDVLIVARGGGSLEDLMAFNDEVVLRAAAACRIPLISAVGHETD 295

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            TL D+ +D RAPTPT AAE+A P +  L + L +  ARL + + RL +     L+    
Sbjct: 296 TTLIDFVSDRRAPTPTAAAELAAPARAELVADLGHRAARLTSGLARLTQTLRLRLDRAAA 355

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
            LP+    L  +R RLD     L+  L  ++ R+      +   + S  L+   ++ R  
Sbjct: 356 RLPDLPSLLGTARMRLDDRGHRLDMALPALVARRRAALLAVERAMPSASLLTGPRRARLA 415

Query: 373 ILEKQQHIEQIVKQHLR----YIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIE 428
           +     H++  ++Q LR         +     +  MLRE+          H+  L  R+E
Sbjct: 416 L--AASHLQSGLRQALRDGHARADRTRLRPAPLAAMLRER--------RAHLAGLAGRLE 465

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
                                 S +    L+RGY  ++D     +T+  ++    R+++ 
Sbjct: 466 ----------------------SLSPMAVLERGYVLVRDPAGVPVTRAADVRPGGRLVLI 503

Query: 489 FFDGQA 494
           F DG+A
Sbjct: 504 FADGEA 509


>gi|301055673|ref|YP_003793884.1| exodeoxyribonuclease VII large subunit [Bacillus anthracis CI]
 gi|300377842|gb|ADK06746.1| exodeoxyribonuclease VII large subunit [Bacillus cereus biovar
           anthracis str. CI]
          Length = 452

 Score =  270 bits (689), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 160/387 (41%), Positives = 227/387 (58%), Gaps = 17/387 (4%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ ++K  +E +  L  V ++GEIS ++  HS GH YF+LKD ++RI A+++ G  
Sbjct: 7   TVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAVMFAGHN 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L EEGLF
Sbjct: 66  RNIKFRPENGMKVLVKGKISIYEASGSYQIYIQDMQPDGVGNLHLAYEQLKVRLEEEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
           S  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+     I  
Sbjct: 126 SQVYKKTIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESAAPSIVQ 185

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N + EG      D++I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA+GHETD
Sbjct: 186 AIRTANEM-EG-----IDVLIVGRGGGSIEELWAFNEEMVARAIFKSEIPIISAVGHETD 239

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ ADLRAPTPT AAE+AVP    LQ  ++    RL   +  L+  K   L  L K
Sbjct: 240 FTIADFVADLRAPTPTAAAELAVPNIIELQEKVLQRTLRLQRAMRELVHKKEEKLQVLQK 299

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
           +           R   ++   +L+  LE ++  K R+ +  +N++K            Q 
Sbjct: 300 SY-----AFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQK 354

Query: 373 ILEKQQHIEQIVKQHLRYI--FLEKKE 397
           I++ +  +E + KQ  R +   L+ KE
Sbjct: 355 IMQTKVAVETLQKQLQREMQTLLQTKE 381


>gi|218231815|ref|YP_002368983.1| exodeoxyribonuclease VII large subunit [Bacillus cereus B4264]
 gi|229152382|ref|ZP_04280574.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus m1550]
 gi|226694636|sp|B7HB51|EX7L_BACC4 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|218159772|gb|ACK59764.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus B4264]
 gi|228630990|gb|EEK87627.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus m1550]
          Length = 452

 Score =  270 bits (689), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 158/387 (40%), Positives = 225/387 (58%), Gaps = 17/387 (4%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ ++K  +E +  L  V ++GEIS ++  HS GH YF+LKD ++RI A+++ G  
Sbjct: 7   TVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAVMFAGHN 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L EEGLF
Sbjct: 66  RNIKFKPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGVGNLHLAYEQLKVRLEEEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
           S  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+     I  
Sbjct: 126 SQVYKKAIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESAAPSIVQ 185

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N + E       D++I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA+GHETD
Sbjct: 186 AIRTANEMGE------IDVLIVGRGGGSIEELWAFNEEMVARAIFKSEIPIISAVGHETD 239

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   L  L K
Sbjct: 240 FTIADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMRELVHKKEEKLQVLQK 299

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
           +           R   ++   +L+  LE ++  K R+ +  +N++K            Q 
Sbjct: 300 SY-----AFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQK 354

Query: 373 ILEKQQHIEQIVKQHLRYI--FLEKKE 397
           I++ +  +E + KQ  R +   L+ KE
Sbjct: 355 IMQTKVAVETLQKQLQREMQTLLQTKE 381


>gi|228960448|ref|ZP_04122099.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar pakistani str. T13001]
 gi|228799212|gb|EEM46178.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar pakistani str. T13001]
          Length = 452

 Score =  270 bits (689), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 158/387 (40%), Positives = 225/387 (58%), Gaps = 17/387 (4%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ ++K  +E +  L  V ++GEIS ++  HS GH YF+LKD ++RI A+++ G  
Sbjct: 7   TVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAVMFAGHN 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L EEGLF
Sbjct: 66  RNIKFKPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGVGNLHLAYEQLKVRLEEEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
           S  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+     I  
Sbjct: 126 SQVYKKAIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESAAPSIVQ 185

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N + E       D++I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA+GHETD
Sbjct: 186 AIRTANEMGE------IDVLIVGRGGGSIEELWAFNEEMVARAIFQSEIPIISAVGHETD 239

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   L  L K
Sbjct: 240 FTIADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMRELVHKKEEKLQVLQK 299

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
           +           R   ++   +L+  LE ++  K R+ +  +N++K            Q 
Sbjct: 300 SY-----AFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQK 354

Query: 373 ILEKQQHIEQIVKQHLRYI--FLEKKE 397
           I++ +  +E + KQ  R +   L+ KE
Sbjct: 355 IMQTKVAVETLQKQLQREMQTLLQTKE 381


>gi|229174857|ref|ZP_04302377.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus MM3]
 gi|228608525|gb|EEK65827.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus MM3]
          Length = 452

 Score =  269 bits (688), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 157/387 (40%), Positives = 225/387 (58%), Gaps = 17/387 (4%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ ++K  +E +  L  V ++GEIS ++  HS GH YF+LKD ++RI A+++ G  
Sbjct: 7   TVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAVMFAGHN 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L EEGLF
Sbjct: 66  RNIKFRPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGVGNLHLAYEQLKVRLEEEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
           S  +K  IP   K I VITSPTGA IRD++  I  R+P+  VI+FPV VQG+     I  
Sbjct: 126 SQVYKKTIPPYAKTIGVITSPTGAAIRDVITTIKRRYPIGNVIVFPVLVQGESAAPSIVQ 185

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N + E       D++I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA+GHETD
Sbjct: 186 AIRTANEMGE------IDVLIVGRGGGSIEELWAFNEEMVARAIFKSEIPIISAVGHETD 239

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   L  L K
Sbjct: 240 FTIADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMRELVHKKEEKLQVLQK 299

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
           +           R   ++   +L+  LE ++  K R+ +  +N++K            Q 
Sbjct: 300 SY-----AFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPAQK 354

Query: 373 ILEKQQHIEQIVKQHLRYI--FLEKKE 397
           I++ +  +E + KQ  R +   L+ KE
Sbjct: 355 IMQTKVAVETLQKQLQREMQTLLQTKE 381


>gi|196041561|ref|ZP_03108853.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus
           NVH0597-99]
 gi|196027549|gb|EDX66164.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus
           NVH0597-99]
          Length = 452

 Score =  269 bits (688), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 158/387 (40%), Positives = 226/387 (58%), Gaps = 17/387 (4%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ ++K  +E +  L  V ++GEIS ++  HS GH YF+LKD ++RI A+++ G  
Sbjct: 7   TVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAVMFAGHN 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L EEGLF
Sbjct: 66  RNIKFRPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGIGNLHLAYEQLKVRLEEEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
           S  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+     I  
Sbjct: 126 SQVYKKTIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESAAPSIVQ 185

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N ++E       D++I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA+GHETD
Sbjct: 186 AIRTANEMEE------IDVLIVGRGGGSIEELWAFNEEMVARAIFKSEIPIISAVGHETD 239

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   L  L K
Sbjct: 240 FTIADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMRELVHKKEEKLQVLQK 299

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
           +           R   ++   +L+  LE ++  K R+ +  +N++K            Q 
Sbjct: 300 SY-----AFRYPRQIYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQK 354

Query: 373 ILEKQQHIEQIVKQHLRYI--FLEKKE 397
           I++ +  +E + KQ  R +   L+ KE
Sbjct: 355 IMQTKVAVETLQKQLQREMQTLLQTKE 381


>gi|229031829|ref|ZP_04187817.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus AH1271]
 gi|228729447|gb|EEL80436.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus AH1271]
          Length = 452

 Score =  269 bits (688), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 157/387 (40%), Positives = 225/387 (58%), Gaps = 17/387 (4%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ ++K  +E +  L  V ++GEIS ++  HS GH YF+LKD ++RI A+++ G  
Sbjct: 7   TVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAVMFAGHN 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L EEGLF
Sbjct: 66  RNIKFRPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGVGNLHLAYEQLKVRLEEEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
           S  +K  IP   K I VITSPTGA IRD++  I  R+P+  VI+FPV VQG+     I  
Sbjct: 126 SQVYKKTIPPYAKTIGVITSPTGAAIRDVITTIKRRYPIGNVIVFPVLVQGESAAPSIVQ 185

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N + E       D++I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA+GHETD
Sbjct: 186 AIRTANEMGE------IDVLIVGRGGGSIEELWAFNEEMVARAIFKSEIPIISAVGHETD 239

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   L  L K
Sbjct: 240 FTIADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMRELVHKKEEKLQVLQK 299

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
           +           R   ++   +L+  LE ++  K R+ +  +N++K            Q 
Sbjct: 300 SY-----AFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPAQK 354

Query: 373 ILEKQQHIEQIVKQHLRYI--FLEKKE 397
           I++ +  +E + KQ  R +   L+ KE
Sbjct: 355 IMQTKVAVETLQKQLQREMQTLLQTKE 381


>gi|229192392|ref|ZP_04319355.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus ATCC 10876]
 gi|228590969|gb|EEK48825.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus ATCC 10876]
          Length = 452

 Score =  269 bits (688), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 158/387 (40%), Positives = 225/387 (58%), Gaps = 17/387 (4%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ ++K  +E +  L  V ++GEIS ++  HS GH YF+LKD ++RI A+++ G  
Sbjct: 7   TVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAVMFAGHN 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L EEGLF
Sbjct: 66  RNIKFKPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGVGNLHLAYEQLKVRLEEEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
           S  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+     I  
Sbjct: 126 SQVYKKAIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESAAPSIVQ 185

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N + E       D++I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA+GHETD
Sbjct: 186 AIRTANEMGE------IDVLIVGRGGGSIEELWAFNEEMVARAIFKSEIPIISAVGHETD 239

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   L  L K
Sbjct: 240 FTIADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMRELVHKKEEKLQVLQK 299

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
           +           R   ++   +L+  LE ++  K R+ +  +N++K            Q 
Sbjct: 300 SY-----AFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKMNQLKQLSFYLEKHHPSQK 354

Query: 373 ILEKQQHIEQIVKQHLRYI--FLEKKE 397
           I++ +  +E + KQ  R +   L+ KE
Sbjct: 355 IMQTKVAVETLQKQLQREMQTLLQTKE 381


>gi|332799349|ref|YP_004460848.1| Exodeoxyribonuclease 7 large subunit [Tepidanaerobacter sp. Re1]
 gi|332697084|gb|AEE91541.1| Exodeoxyribonuclease 7 large subunit [Tepidanaerobacter sp. Re1]
          Length = 405

 Score =  269 bits (687), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 154/354 (43%), Positives = 226/354 (63%), Gaps = 16/354 (4%)

Query: 13  PEYSVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           P  +VSE++  +K++ ++N  L HV ++GEIS ++  H SGH YF+LKD  S+I  ++++
Sbjct: 3   PVLTVSEVTNIIKYLFDNNEILRHVYIKGEISNFKH-HISGHMYFTLKDEKSQIRCVMFR 61

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
                + F+PE G+  + +G I+ F  S +YQ+ IE L P G G L  A EK K++L +E
Sbjct: 62  NNNILLPFMPENGMRVVALGFISIFAKSGEYQLYIEDLQPDGIGALHIAFEKLKERLDKE 121

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKE 189
           GLF  Q K PIPF+PK I +ITS TGA IRD+L  I  RF  + +II PV VQG +  +E
Sbjct: 122 GLFELQRKQPIPFLPKKIGIITSLTGAAIRDLLTVIKRRFSNVDIIIAPVLVQGRDAAEE 181

Query: 190 IANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGH 249
           I +AIL+LN LK        D+II+ RGGGSIE+LW FN+E + RAIANS IP+ISA+GH
Sbjct: 182 ICSAILELNRLKN------IDVIIVGRGGGSIEELWAFNEEKVARAIANSLIPVISAVGH 235

Query: 250 ETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNS 309
           ETD+T++D+ AD RAPTP+ A E+AVP K  LQ+ +  +  RL N I+  I  +   L  
Sbjct: 236 ETDYTISDFVADKRAPTPSAAGEIAVPEKRVLQNEIRYISLRLINGILSYIGARRQKLEY 295

Query: 310 LLKA----LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
           L +A     P +   ++CS   +D+  + L+ ++++ I +     NH I R+++
Sbjct: 296 LKRAPIFKRPET-YIINCSLI-IDQTSKRLQKDIDLYISKNKSILNHYIARLEA 347


>gi|196034996|ref|ZP_03102403.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus W]
 gi|195992535|gb|EDX56496.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus W]
          Length = 452

 Score =  269 bits (687), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 157/387 (40%), Positives = 226/387 (58%), Gaps = 17/387 (4%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ ++K  +E +  L  V ++GEIS ++  HS GH YF+LKD ++RI A+++ G  
Sbjct: 7   TVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAVMFAGHN 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L EEGLF
Sbjct: 66  RNIKFRPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGIGNLHLAYEQLKVRLEEEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
           S  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+     I  
Sbjct: 126 SQVYKKTIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESAAPSIVQ 185

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N ++E       D++I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA+GHETD
Sbjct: 186 AIRTANEMEE------IDVLIVGRGGGSIEELWAFNEEMVARAIFKSEIPIISAVGHETD 239

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   L  L K
Sbjct: 240 FTIADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMRELVHKKEEKLQVLQK 299

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
           +           R   ++   +L+  +E ++  K R+ +  +N++K            Q 
Sbjct: 300 SY-----AFRYPRQVYEQKEEQLDRAIEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQK 354

Query: 373 ILEKQQHIEQIVKQHLRYI--FLEKKE 397
           I++ +  +E + KQ  R +   L+ KE
Sbjct: 355 IMQTKVAVETLQKQLQREMQTLLQTKE 381


>gi|42783299|ref|NP_980546.1| exodeoxyribonuclease VII large subunit [Bacillus cereus ATCC 10987]
 gi|47569439|ref|ZP_00240120.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus G9241]
 gi|217961670|ref|YP_002340240.1| exodeoxyribonuclease VII large subunit [Bacillus cereus AH187]
 gi|222097626|ref|YP_002531683.1| exodeoxyribonuclease vii large subunit [Bacillus cereus Q1]
 gi|229140914|ref|ZP_04269458.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus BDRD-ST26]
 gi|229157779|ref|ZP_04285854.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus ATCC 4342]
 gi|229198307|ref|ZP_04325014.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus m1293]
 gi|81830971|sp|Q731B3|EX7L_BACC1 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|226694637|sp|B7HNU3|EX7L_BACC7 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|254783690|sp|B9IXH3|EX7L_BACCQ RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|42739227|gb|AAS43154.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus ATCC
           10987]
 gi|47553854|gb|EAL12224.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus G9241]
 gi|217066432|gb|ACJ80682.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus AH187]
 gi|221241684|gb|ACM14394.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus Q1]
 gi|228585186|gb|EEK43297.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus m1293]
 gi|228625736|gb|EEK82488.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus ATCC 4342]
 gi|228642490|gb|EEK98777.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus BDRD-ST26]
 gi|324328094|gb|ADY23354.1| exodeoxyribonuclease VII large subunit [Bacillus thuringiensis
           serovar finitimus YBT-020]
          Length = 452

 Score =  269 bits (687), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 159/387 (41%), Positives = 226/387 (58%), Gaps = 17/387 (4%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ ++K  +E +  L  V ++GEIS ++  HS GH YF+LKD ++RI A+++ G  
Sbjct: 7   TVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAVMFAGHN 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L EEGLF
Sbjct: 66  RNIKFRPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGVGNLHLAYEQLKVRLEEEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
           S  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+     I  
Sbjct: 126 SQVYKKTIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESAAPSIVQ 185

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N + EG      D++I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA+GHETD
Sbjct: 186 AIRTANEM-EG-----IDVLIVGRGGGSIEELWAFNEEMVARAIFKSEIPIISAVGHETD 239

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   L  L K
Sbjct: 240 FTIADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMRELVHKKEEKLQVLQK 299

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
           +           R   ++   +L+  LE ++  K R+ +  +N++K            Q 
Sbjct: 300 SY-----AFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQK 354

Query: 373 ILEKQQHIEQIVKQHLRYI--FLEKKE 397
           I++ +  +E + KQ  R +   L+ KE
Sbjct: 355 IMQTKVAVETLQKQLQREMQTLLQTKE 381


>gi|228910016|ref|ZP_04073836.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis IBL
           200]
 gi|228849533|gb|EEM94367.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis IBL
           200]
          Length = 452

 Score =  268 bits (686), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 158/387 (40%), Positives = 225/387 (58%), Gaps = 17/387 (4%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ ++K  +E +  L  V ++GEIS ++  HS GH YF+LKD ++RI A+++ G  
Sbjct: 7   TVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAVMFAGHN 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L EEGLF
Sbjct: 66  RNIKFKPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGVGNLHLAYEQLKVRLEEEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
           S  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+     I  
Sbjct: 126 SQVYKKAIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESAAPSIVQ 185

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N + E       DI+I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA+GHETD
Sbjct: 186 AIRTANEMGE------IDILIVGRGGGSIEELWAFNEEMVARAIFKSEIPIISAVGHETD 239

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   L  L +
Sbjct: 240 FTIADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMRELVHKKEEKLQVLQR 299

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
           +           R   ++   +L+  LE ++  K R+ +  +N++K            Q 
Sbjct: 300 SY-----AFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQK 354

Query: 373 ILEKQQHIEQIVKQHLRYI--FLEKKE 397
           I++ +  +E + KQ  R +   L+ KE
Sbjct: 355 IIQTKVAVETLQKQLQREMQTLLQTKE 381


>gi|229163126|ref|ZP_04291082.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus R309803]
 gi|228620532|gb|EEK77402.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus R309803]
          Length = 452

 Score =  268 bits (686), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 159/387 (41%), Positives = 225/387 (58%), Gaps = 17/387 (4%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ ++K  +E +  L  V ++GEIS ++  HS GH YF+LKD ++RI A+++ G  
Sbjct: 7   TVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAVMFAGHN 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L EEGLF
Sbjct: 66  RNIKFRPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGIGNLHLAYEQLKVRLEEEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
           S  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+     I  
Sbjct: 126 SQVYKKIIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESAAPSIVQ 185

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N + E       D++I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA+GHETD
Sbjct: 186 AIRTANEMGE------IDVLIVGRGGGSIEELWAFNEEMVARAIFKSEIPIISAVGHETD 239

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   L  L K
Sbjct: 240 FTIADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMRELVHKKEEKLQVLQK 299

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
           +           R   ++   +L+  LE ++  K R+ +  +N++K            Q 
Sbjct: 300 SY-----AFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQK 354

Query: 373 ILEKQQHIEQIVKQHLRYI--FLEKKE 397
           I++ +  IE + KQ  R +   L+ KE
Sbjct: 355 IMQTKVAIETLQKQLQREMQTLLQTKE 381


>gi|228987371|ref|ZP_04147491.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
 gi|228772343|gb|EEM20789.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
          Length = 452

 Score =  268 bits (686), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 159/387 (41%), Positives = 226/387 (58%), Gaps = 17/387 (4%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ ++K  +E +  L  V ++GEIS ++  HS GH YF+LKD ++RI A+++ G  
Sbjct: 7   TVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAVMFAGHN 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L EEGLF
Sbjct: 66  RNIKFRPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGVGNLHLAYEQLKVRLEEEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
           S  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+     I  
Sbjct: 126 SQVYKKTIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESAAPSIVQ 185

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N + EG      D++I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA+GHETD
Sbjct: 186 AIRTANEM-EG-----IDVLIVGRGGGSIEELWAFNEEMVARAIFKSEIPIISAVGHETD 239

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   L  L K
Sbjct: 240 FTIADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMRELVHKKEEKLQVLQK 299

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
           +           R   ++   +L+  LE ++  K R+ +  +N++K            Q 
Sbjct: 300 SY-----AFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQK 354

Query: 373 ILEKQQHIEQIVKQHLRYI--FLEKKE 397
           I++ +  +E + KQ  R +   L+ KE
Sbjct: 355 IMQTKVAVETLQKQLQREMQTLLQTKE 381


>gi|229019399|ref|ZP_04176222.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus AH1273]
 gi|228741869|gb|EEL92046.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus AH1273]
          Length = 452

 Score =  268 bits (686), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 155/377 (41%), Positives = 224/377 (59%), Gaps = 15/377 (3%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ ++K  +E +  L  V ++GEIS ++  HS GH YF+LKD ++RI A+++ G  
Sbjct: 7   TVTALTRYIKTKIEYDPHLQSVWLKGEISNFK-YHSRGHMYFTLKDENARIAAVMFAGHN 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L EEGLF
Sbjct: 66  RNIKFKPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGIGNLHLAYEQLKVRLEEEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
           S  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+     I  
Sbjct: 126 SQVYKKTIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESAAPSIVQ 185

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N ++E       D++I+ RGGGSIE+LW FN+E++ RAI  S IPIISA+GHETD
Sbjct: 186 AIRTANEMEE------IDVLIVGRGGGSIEELWAFNEEVVARAIFTSEIPIISAVGHETD 239

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ ADLRAPTPT AAE+AVP    LQ  ++    RL     R ++ +++     L+
Sbjct: 240 FTIADFVADLRAPTPTAAAELAVPNVLELQEKVLQRTLRLQ----RAMRERVHKKEEKLQ 295

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
            L  S       R   ++   +L+  LE ++  K R+ +  +N++K            Q 
Sbjct: 296 VLQKS-YAFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQK 354

Query: 373 ILEKQQHIEQIVKQHLR 389
           I++ +  IE + KQ  R
Sbjct: 355 IMQTKVAIETLQKQLQR 371


>gi|228916816|ref|ZP_04080381.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
 gi|228843003|gb|EEM88086.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
          Length = 452

 Score =  268 bits (686), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 157/387 (40%), Positives = 226/387 (58%), Gaps = 17/387 (4%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ ++K  +E +  L  V ++GEIS ++  HS GH YF+LKD ++RI A+++ G  
Sbjct: 7   TVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAVMFAGHN 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L EEGLF
Sbjct: 66  RNIKFRPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGIGNLHLAYEQLKVRLEEEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
           S  +K  IP   K I V+TSPTGA IRDI+  I  R+P+  VI+FPV VQG+     I  
Sbjct: 126 SQVYKKIIPPYAKTIGVVTSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESAAPSIVQ 185

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N ++E       D++I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA+GHETD
Sbjct: 186 AIRTANEMEE------IDVLIVGRGGGSIEELWAFNEEMVARAIFKSEIPIISAVGHETD 239

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   L  L K
Sbjct: 240 FTIADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMRELVHKKEEKLQVLQK 299

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
           +           R   ++   +L+  LE ++  K R+ +  +N++K            Q 
Sbjct: 300 SY-----AFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQK 354

Query: 373 ILEKQQHIEQIVKQHLRYI--FLEKKE 397
           I++ +  +E + KQ  R +   L+ KE
Sbjct: 355 IMQTKVAVETLQKQLQREMQTLLQTKE 381


>gi|312110280|ref|YP_003988596.1| exodeoxyribonuclease VII large subunit [Geobacillus sp. Y4.1MC1]
 gi|311215381|gb|ADP73985.1| exodeoxyribonuclease VII, large subunit [Geobacillus sp. Y4.1MC1]
          Length = 451

 Score =  268 bits (686), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 169/472 (35%), Positives = 254/472 (53%), Gaps = 53/472 (11%)

Query: 28  VESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNKIEFLPEEGIEFL 87
           V+ +L  + ++GEIS ++  HS GH YF+LKD  +RI A+++ G    + F PE+G++ L
Sbjct: 22  VDPHLRDLWIKGEISNFK-YHSRGHMYFTLKDEQARIQAVMFAGYNQYLSFRPEDGMKVL 80

Query: 88  VIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSDQHKNPIPFIPKI 147
           V G+I+ +  S  YQI ++ + P G G L  A E+ KK+L  EGLFS +HK PIP  P+ 
Sbjct: 81  VRGEISVYEPSGNYQIYVKEMQPEGIGNLYLAYEQLKKRLEAEGLFSAEHKKPIPAFPRY 140

Query: 148 IAVITSPTGAVIRDILQRISCRFPLR-VIIFPVKVQGDECPKEIANAILQLNTLKEGRTC 206
           I V+TSPTGA IRDIL  I  R+P+  VI+FP  VQG+E    I  +I + N L     C
Sbjct: 141 IGVVTSPTGAAIRDILTTIRRRYPIATVILFPTLVQGEEAAGSIVRSIEKANEL----GC 196

Query: 207 PRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWTLADYAADLRAPT 266
              D++I+ RGGGSIE+LW FN+E + RAI  S +PIISA+GHETD+T+AD+ ADLRAPT
Sbjct: 197 --IDVLIVGRGGGSIEELWAFNEEAVARAIFASKVPIISAVGHETDFTIADFVADLRAPT 254

Query: 267 PTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKALPNSDQTLSCSRY 326
           PTGAAE+AVP    L   +   + RL    +R +K KI   +  L  L  S       RY
Sbjct: 255 PTGAAELAVPHVTELMERISQRKLRL----MRAMKEKIAAESERLLRLQKS----YAFRY 306

Query: 327 RLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHILEKQQHIEQIVKQ 386
             ++L  + E  L+ ++ R  RH   + ++                   K++ +EQ+  +
Sbjct: 307 P-EKLYEQKEQQLDALLERLQRHTERLFDK-------------------KREQLEQLRLK 346

Query: 387 HLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSHKIKSCHTSVSITT 446
            LR+   E+  ++   H    ++  +    H H ++L  R   ++SH             
Sbjct: 347 LLRHHPAEQLSRMKEKHESLVKSLEKEMRSHIHHQQL--RFTSLVSH------------- 391

Query: 447 RILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDGQANAIV 498
             L + +    ++RGY+ + +     +   R L     I +   DGQ +  V
Sbjct: 392 --LHALSPLKIMERGYSLVYNEKKELVKSIRQLQLGDTIQVRLQDGQVDCHV 441


>gi|227510478|ref|ZP_03940527.1| exodeoxyribonuclease VII large subunit [Lactobacillus brevis subsp.
           gravesensis ATCC 27305]
 gi|227190130|gb|EEI70197.1| exodeoxyribonuclease VII large subunit [Lactobacillus brevis subsp.
           gravesensis ATCC 27305]
          Length = 452

 Score =  268 bits (686), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 186/498 (37%), Positives = 281/498 (56%), Gaps = 71/498 (14%)

Query: 14  EY-SVSELSYHLKH--IVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           EY SV+ L+ ++K    V+  L  V + GEIS +R +    H YFSLKD+H++I AI++K
Sbjct: 4   EYLSVTALTKYIKRKFDVDPYLMKVYLTGEISNFR-LRPMRHQYFSLKDDHAKISAIMFK 62

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
              N+I+F+PEEG++ LV G I+ +  S  YQI ++S+ P G G L  A E+ KKKL +E
Sbjct: 63  SAFNRIKFVPEEGMKVLVTGHISVYEPSGSYQIYVDSMEPDGVGQLYQAYEQLKKKLDKE 122

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKE 189
           GLFS   +  + F PK IAV+TSP+GAVIRDI+  +  R+P+ ++++FP  VQGDE   +
Sbjct: 123 GLFSQPKRQLVQF-PKRIAVVTSPSGAVIRDIITTVRRRYPIAQIVLFPALVQGDEASTD 181

Query: 190 IANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGH 249
           I   I+++N L         D +I+ RGGGSIEDLW FN+E + RAI++S+IP+IS++GH
Sbjct: 182 IVKQIVKVNQLGHF------DTLIIGRGGGSIEDLWPFNEENVARAISSSTIPVISSVGH 235

Query: 250 ETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNS 309
           ETD T+AD  AD+RA TPT AAE+AVP    L   L+ L+A  N II             
Sbjct: 236 ETDTTIADLVADVRAATPTAAAELAVP---RLDQVLVELKATQNRII------------- 279

Query: 310 LLKALPNSD-QTLSCSRYRLDRLPRELEHNLEIIIF----RKYRHFNHIINRIKSDFLIH 364
                 N++ Q +  ++ RL RL +         +F    R Y  F+      K D L  
Sbjct: 280 ------NAEYQLIEQAKLRLKRLQQS-------TVFTSPQRIYETFSQ-----KLDLLRQ 321

Query: 365 NIQKNRQHIL-EKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKL 423
            ++     I   ++ ++ Q+   H+R         +A  +M++EQ K R+  L   +K+ 
Sbjct: 322 RLENQADKITTSRKNNLSQL---HMRLRL------VAPTYMIKEQ-KQRLNVLQLRLKQ- 370

Query: 424 ITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKT 483
             +++ +  +K+K  +    +    L   +    L RGYT   D N++FI++  +L  KT
Sbjct: 371 -NQLQNL--NKVKQQY---QMLVGSLDHLSPLKILGRGYTYTTDENDHFISKMADLKAKT 424

Query: 484 RILINFFDGQANAIVINK 501
            I ++F DG  NA  INK
Sbjct: 425 -INVHFSDGVINA-SINK 440


>gi|218778694|ref|YP_002430012.1| exodeoxyribonuclease VII, large subunit [Desulfatibacillum
           alkenivorans AK-01]
 gi|218760078|gb|ACL02544.1| exodeoxyribonuclease VII, large subunit [Desulfatibacillum
           alkenivorans AK-01]
          Length = 453

 Score =  268 bits (684), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 141/332 (42%), Positives = 213/332 (64%), Gaps = 14/332 (4%)

Query: 1   MNPF--SQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLK 58
           MNP   +QK  +    ++VS+L+  +K ++E  L  V V GEIS    I SSGH YF+LK
Sbjct: 1   MNPAQHTQKRRI----HTVSQLTAIIKSVLEEALPFVWVTGEISNLH-IPSSGHYYFTLK 55

Query: 59  DNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLT 118
           D+H++I ++++KG    ++F  E+G+  + +G++  +     YQ+++E + P+G G L  
Sbjct: 56  DDHAQIRSVMFKGHARNLKFDLEDGMSVVCLGRVAVYEPQGAYQVLVEHMEPAGMGALAL 115

Query: 119 ALEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIF 177
           A E+ K KL EEGLF + HK  +P++P+ IAV+TSPTGAVI DIL+ +S RFP + V ++
Sbjct: 116 AFEQLKAKLSEEGLFDEDHKKSLPYLPRTIAVVTSPTGAVIHDILRVLSYRFPKVHVQVW 175

Query: 178 PVKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIA 237
           PVKVQG + P +I  ++  +N   +       D++I+ARGGGS+EDL  FN E + RAI 
Sbjct: 176 PVKVQGADSPAQIVRSLEMINQQNQA------DVVIIARGGGSLEDLAPFNSEEVARAIF 229

Query: 238 NSSIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIII 297
            S+IP+ISA+GHETD+T+ADY AD RAPTP+ AAE+ +P  + L+  L    ARL     
Sbjct: 230 ASAIPVISAVGHETDYTIADYTADRRAPTPSAAAEIVLPEYQGLELLLKEYAARLKGAFT 289

Query: 298 RLIKYKINTLNSLLKALPNSDQTLSCSRYRLD 329
            ++K + + L +L K LP   + +   R R+D
Sbjct: 290 LMLKKERDNLLNLKKRLPPPRRQVDDWRLRMD 321


>gi|295399117|ref|ZP_06809099.1| exodeoxyribonuclease VII, large subunit [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|294978583|gb|EFG54179.1| exodeoxyribonuclease VII, large subunit [Geobacillus
           thermoglucosidasius C56-YS93]
          Length = 451

 Score =  267 bits (683), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 167/469 (35%), Positives = 252/469 (53%), Gaps = 53/469 (11%)

Query: 28  VESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNKIEFLPEEGIEFL 87
           V+ +L  + ++GEIS ++  HS GH YF+LKD  +RI A+++ G    + F PE+G++ L
Sbjct: 22  VDPHLRDLWIKGEISNFK-YHSRGHMYFTLKDEQARIQAVMFAGYNQYLSFRPEDGMKVL 80

Query: 88  VIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSDQHKNPIPFIPKI 147
           V G+I+ +  S  YQI ++ + P G G L  A E+ KK+L  EGLFS +HK PIP  P+ 
Sbjct: 81  VRGEISVYEPSGNYQIYVKEMQPEGIGNLYLAYEQLKKRLEAEGLFSAEHKKPIPAFPRY 140

Query: 148 IAVITSPTGAVIRDILQRISCRFPLR-VIIFPVKVQGDECPKEIANAILQLNTLKEGRTC 206
           I V+TSPTGA IRDIL  I  R+P+  VI+FP  VQG+E    I  +I + N L      
Sbjct: 141 IGVVTSPTGAAIRDILTTIRRRYPIATVILFPTLVQGEEAAGSIVRSIEKANELG----- 195

Query: 207 PRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWTLADYAADLRAPT 266
              D++I+ RGGGSIE+LW FN+E + RAI  S +PIISA+GHETD+T+AD+ ADLRAPT
Sbjct: 196 -YIDVLIVGRGGGSIEELWAFNEEAVARAIFASKVPIISAVGHETDFTIADFVADLRAPT 254

Query: 267 PTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKALPNSDQTLSCSRY 326
           PTGAAE+AVP    L   +   + RL    +R +K KI   +  L  L  S       RY
Sbjct: 255 PTGAAELAVPHVTELMERISQRKLRL----MRAMKEKIAAESERLLRLQKS----YAFRY 306

Query: 327 RLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHILEKQQHIEQIVKQ 386
             ++L  + E  L+ ++ R  RH   + ++                   K++ +EQ+  +
Sbjct: 307 P-EKLYEQKEQQLDALLERLQRHTERLFDK-------------------KREQLEQLRLK 346

Query: 387 HLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSHKIKSCHTSVSITT 446
            LR+   E+  ++   H    ++  +    H H ++L  R   ++SH             
Sbjct: 347 LLRHHPAEQLSRMKEKHESLVKSLEKEMRSHIHHQQL--RFTSLVSH------------- 391

Query: 447 RILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDGQAN 495
             L + +    ++RGY+ + +     +   R L     I +   DGQ +
Sbjct: 392 --LHALSPLKIMERGYSLVYNEKKELVKSIRQLQLGDTIQVRLQDGQVD 438


>gi|227513487|ref|ZP_03943536.1| exodeoxyribonuclease VII large subunit [Lactobacillus buchneri ATCC
           11577]
 gi|227083360|gb|EEI18672.1| exodeoxyribonuclease VII large subunit [Lactobacillus buchneri ATCC
           11577]
          Length = 452

 Score =  267 bits (683), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 181/496 (36%), Positives = 282/496 (56%), Gaps = 67/496 (13%)

Query: 14  EY-SVSELSYHLKH--IVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           EY SV+ L+ ++K    V+  L  V + GEIS +R +  + H YFSLKD+H++I AI++K
Sbjct: 4   EYLSVTALTKYIKRKFDVDPYLMKVYLTGEISNFR-LRPNAHQYFSLKDDHAKISAIMFK 62

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
              N+I+F+PEEG++ LV G I+ +  S  YQI ++S+ P G G L  A E+ KKKL +E
Sbjct: 63  SAFNRIKFVPEEGMKVLVTGHISVYEPSGSYQIYVDSMEPDGVGQLYQAYEQLKKKLDKE 122

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKE 189
           GLFS   +  + F PK IAV+TSP+GAV+RDI+  +  R+P+ ++++FP  VQGDE   +
Sbjct: 123 GLFSQPKRQLVQF-PKRIAVVTSPSGAVVRDIITTVRRRYPIAQIVLFPALVQGDEASTD 181

Query: 190 IANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGH 249
           I   I+++N L         D +I+ RGGGSIEDLW FN+E + RAI+ S+IP+IS++GH
Sbjct: 182 IVRQIVKVNQLGHF------DTLIIGRGGGSIEDLWPFNEENVARAISASTIPVISSVGH 235

Query: 250 ETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNS 309
           ETD T+AD  AD+RA TPT AAE+AVP              RL+ +++ L      T N 
Sbjct: 236 ETDTTIADLVADVRAATPTAAAELAVP--------------RLDQVLVELK----TTQNR 277

Query: 310 LLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIF----RKYRHFNHIINRIKSDFLIHN 365
           ++ A     Q +  ++ RL RL +         +F    R Y  F+      K D L   
Sbjct: 278 IINA---EYQLIEQAKLRLKRLQQS-------TVFTSPQRIYETFSQ-----KLDLLRQR 322

Query: 366 IQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLIT 425
           ++     +   +++   + + H+R         +A  +M++EQ K R+  L   +K+  +
Sbjct: 323 LENQADKVTASRKN--NLSQLHMRLRL------VAPTYMIKEQ-KQRLNVLQLRLKQ--S 371

Query: 426 RIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRI 485
           +++ +  +K+K  +  +  +   L   +    L RGYT   D N++FI++  +L  KT I
Sbjct: 372 QLQNL--NKVKQQYLMLVGS---LDHLSPLKILGRGYTYTTDENDHFISKMADLKAKT-I 425

Query: 486 LINFFDGQANAIVINK 501
            ++F DG  NA  INK
Sbjct: 426 NVHFSDGVINA-SINK 440


>gi|239827669|ref|YP_002950293.1| exodeoxyribonuclease VII large subunit [Geobacillus sp. WCH70]
 gi|239807962|gb|ACS25027.1| exodeoxyribonuclease VII, large subunit [Geobacillus sp. WCH70]
          Length = 453

 Score =  267 bits (682), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 167/476 (35%), Positives = 255/476 (53%), Gaps = 61/476 (12%)

Query: 28  VESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNKIEFLPEEGIEFL 87
           V+ +L  + ++GEIS ++  HS GH YF+LKD  +RI A+++ G    + F PE+G++ L
Sbjct: 22  VDPHLRDLWIKGEISNFK-YHSRGHMYFTLKDEQARIQAVMFAGYNQYLSFRPEDGMKVL 80

Query: 88  VIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSDQHKNPIPFIPKI 147
           V G+I+ +  S  YQI ++ + P G G L  A E+ KK+L  EGLFS +HK PIP  P+ 
Sbjct: 81  VRGEISVYEPSGNYQIYVKEMQPEGIGNLYLAYEQLKKRLEAEGLFSPEHKKPIPAFPRY 140

Query: 148 IAVITSPTGAVIRDILQRISCRFPLR-VIIFPVKVQGDECPKEIANAILQLNTLKEGRTC 206
           I V+TSPTGA IRDI+  I  R+P+  VI+FP  VQG++  + I  +I + N L      
Sbjct: 141 IGVVTSPTGAAIRDIMTTIRRRYPIATVILFPTLVQGEQAAESIVRSIEKANELG----- 195

Query: 207 PRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWTLADYAADLRAPT 266
              D++I+ RGGGSIE+LW FN+E++ RAI  S +PIISA+GHETD+T+AD+ ADLRAPT
Sbjct: 196 -YIDVLIVGRGGGSIEELWAFNEEIVARAIFASEVPIISAVGHETDFTIADFVADLRAPT 254

Query: 267 PTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKALPNSDQTLSCSRY 326
           PTGAAE+AVP    L   +   + RL    +R +K KI T          SD+ L   + 
Sbjct: 255 PTGAAELAVPHIAELMERISQRKLRL----MRAMKEKIAT---------ESDRLLRLQKS 301

Query: 327 RLDRLPREL----EHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHILEKQQHIEQ 382
              R P +L    E  L+ ++ R  RH   + ++                   K++ +EQ
Sbjct: 302 YAFRYPEKLYEQKEQQLDSLLERLERHTERLFDK-------------------KRERLEQ 342

Query: 383 IVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSHKIKSCHTSV 442
           +  + LR+   E+  ++   H    ++  +    H H ++L  R   ++SH         
Sbjct: 343 LRLKLLRHHPNEQLSRMKEKHESLTKSLEKEMRSHIHHQQL--RFTSLVSH--------- 391

Query: 443 SITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDGQANAIV 498
                 L + +    ++RGY+ + +     +   R L     I +   DGQ +  V
Sbjct: 392 ------LHALSPLKIMERGYSLVYNEKKELVKSIRQLQLGDTIQVRLQDGQIDCHV 441


>gi|171913357|ref|ZP_02928827.1| exodeoxyribonuclease VII, large subunit [Verrucomicrobium spinosum
           DSM 4136]
          Length = 445

 Score =  267 bits (682), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 156/484 (32%), Positives = 252/484 (52%), Gaps = 49/484 (10%)

Query: 16  SVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNK 75
           SVS+L+  ++ ++E  +  V V GEIS +R + SSGH YF+LKD  ++I  ++++G   +
Sbjct: 6   SVSQLTRQIRSLLEGQIGDVSVEGEISNHR-LQSSGHQYFTLKDEGAQISCVLFRGASAR 64

Query: 76  IEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSD 135
           ++    +G++  + G++T +     YQII+ S+ P G G+L    E  K+KL  EGLF +
Sbjct: 65  MQTPLRDGMQVQLFGELTVYEQRGNYQIIVRSVQPKGQGSLQARFEALKQKLAGEGLFEN 124

Query: 136 QHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANAI 194
             K PIP  P+++A++TSPTGA IRD+L  ++ R P LRV++FPV+VQG    +EIA AI
Sbjct: 125 HWKKPIPKFPRVVALVTSPTGAAIRDMLNILTRRAPWLRVLVFPVRVQGQGAEQEIARAI 184

Query: 195 LQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWT 254
             LN  +E    PRPD I++ RGGGS+EDLW+FN+E++ RAI  S+IP+ISA+GHE D+T
Sbjct: 185 DLLN--QEVAGLPRPDTIVVGRGGGSLEDLWNFNEEVVARAIFASTIPVISAVGHEIDFT 242

Query: 255 LADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKAL 314
           +AD+ AD+RAPTP+ AAE+  P    LQ     +E  + + +   +++    L    K  
Sbjct: 243 IADFVADMRAPTPSAAAELLAPDTAELQRHFDAMEKSMTHRMRTTLEHHERVLELTGKG- 301

Query: 315 PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHIL 374
                     R   +RL R+   +++  +   Y     +  R   D L+           
Sbjct: 302 --------ALRREPERLLRDAVQSVD-EVESSYHRAQELYWRSLDDRLV----------- 341

Query: 375 EKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSHK 434
              QH   + K H + +  E   ++A++                H+   I         +
Sbjct: 342 ---QHHRALEKYHPQRVLTEAAHRVALIQQ--------------HLGAFI-------RQR 377

Query: 435 IKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDGQA 494
           I+     V    ++L+S    + L RG++   D     I     L T   ++     G+ 
Sbjct: 378 IEQNAQKVMAMRKLLKSMGPDSVLSRGFSMTTDATGKVIEDASKLRTGDMMITRLAKGKV 437

Query: 495 NAIV 498
            ++V
Sbjct: 438 ASVV 441


>gi|288553329|ref|YP_003425264.1| exodeoxyribonuclease VII large subunit [Bacillus pseudofirmus OF4]
 gi|288544489|gb|ADC48372.1| exodeoxyribonuclease VII large subunit [Bacillus pseudofirmus OF4]
          Length = 450

 Score =  266 bits (681), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 148/337 (43%), Positives = 211/337 (62%), Gaps = 21/337 (6%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           SVS+L+ ++K I+E +  L+ V +RGEIS ++ +HS GH YF++KD +SRI A+++ G  
Sbjct: 8   SVSQLTRYIKGIMEHDHILTDVWIRGEISNFK-LHSRGHMYFTIKDQNSRIQAVMFAGHN 66

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             + F PE G++ L+ G++  +    +YQ+  + + P G G+L  A EK K+ L EEGLF
Sbjct: 67  RYLAFKPENGMKVLIRGEVNVYEPYGQYQLYAKEMQPDGVGSLFLAYEKLKETLQEEGLF 126

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
            +  K PIP  PK IA++TSPTGA I+D+L  +  R+PL ++ + PV VQG E P  I  
Sbjct: 127 DESRKRPIPRFPKKIAIVTSPTGAAIKDMLATLKRRYPLAQITLLPVLVQGQEAPASIVR 186

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           A+ Q N   +       D +I+ RGGGSIE+LW FNDE + R I  S++P+ISA+GHETD
Sbjct: 187 AVNQANAANQF------DTLIVGRGGGSIEELWAFNDEGVARCIVASTVPVISAVGHETD 240

Query: 253 WTLADYAADLRAPTPTGAAEMAVP-VKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLL 311
           +T++D+ ADLRAPTPTGAAE+AVP V E L S  +     L+N + R +K KI      L
Sbjct: 241 FTISDFVADLRAPTPTGAAELAVPDVAELLHSRQV-----LHNRLKRQMKLKIEEHQEQL 295

Query: 312 KALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYR 348
           K L  S       RY L +L R+ E  L+  + R  R
Sbjct: 296 KRLKRS----YAFRYPL-QLIRQKEQELDTQLERLQR 327


>gi|152976584|ref|YP_001376101.1| exodeoxyribonuclease VII large subunit [Bacillus cereus subsp.
           cytotoxis NVH 391-98]
 gi|189037856|sp|A7GSJ8|EX7L_BACCN RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|152025336|gb|ABS23106.1| exodeoxyribonuclease VII, large subunit [Bacillus cytotoxicus NVH
           391-98]
          Length = 451

 Score =  266 bits (681), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 145/346 (41%), Positives = 211/346 (60%), Gaps = 15/346 (4%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ ++K  +E +  L  V ++GEIS ++  HS GH YF+LKD ++RI A+++ G  
Sbjct: 7   TVTALTRYIKTKIEYDPHLQSVWLKGEISNFK-YHSRGHMYFTLKDENARIAAVMFAGHN 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             I+F PE+G++ LV GKI+ +  S  YQI +  + P G G L  A E+ K +L EEGLF
Sbjct: 66  RNIKFRPEDGMKVLVKGKISVYEASGSYQIYVHDMQPDGVGNLHLAYEQLKVRLEEEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
           S  +K PIP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+     I  
Sbjct: 126 SRVYKQPIPAYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGEFAAPSIVQ 185

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N + +       D++I+ RGGGSIE+LW FN+E++ RAI  S IPIISA+GHETD
Sbjct: 186 AIQTANEMND------IDVLIVGRGGGSIEELWAFNEEIVARAIFASKIPIISAVGHETD 239

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ ADLRAPTPT AAE+AVP    +Q  ++    RL   +  ++  +   L +L K
Sbjct: 240 FTIADFVADLRAPTPTAAAELAVPNILEMQEKVLQRTLRLQRAMREIVHKRQERLQTLQK 299

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIK 358
           +           R   ++   +L+  LE ++  K R+    +N++K
Sbjct: 300 SY-----AFRYPRQIYEQKEEQLDRALEQLVLAKERYMEKKVNQLK 340


>gi|326941961|gb|AEA17857.1| exodeoxyribonuclease VII large subunit [Bacillus thuringiensis
           serovar chinensis CT-43]
          Length = 453

 Score =  266 bits (680), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 158/388 (40%), Positives = 226/388 (58%), Gaps = 18/388 (4%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ ++K  +E +  L  V ++GEIS ++  HS GH YF+LKD ++RI A+++ G  
Sbjct: 7   TVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAVMFAGHN 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE-GL 132
             I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L EE GL
Sbjct: 66  RNIKFKPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGVGNLHLAYEQLKVRLEEEEGL 125

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIA 191
           FS  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+     I 
Sbjct: 126 FSQVYKKAIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESAAPSIV 185

Query: 192 NAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHET 251
            AI   N ++E       D++I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA+GHET
Sbjct: 186 QAIRTANEMRE------IDVLIVGRGGGSIEELWAFNEEMVARAIFKSEIPIISAVGHET 239

Query: 252 DWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLL 311
           D+T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   L  L 
Sbjct: 240 DFTIADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMKELVHKKEEKLQVLQ 299

Query: 312 KALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQ 371
           K+           R   ++   +L+  LE ++  K R+ +  +N++K            Q
Sbjct: 300 KSY-----AFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQ 354

Query: 372 HILEKQQHIEQIVKQHLRYI--FLEKKE 397
            I++ +  +E + KQ  R +   L+ KE
Sbjct: 355 KIIQTKVAVETLQKQLQREMQTLLQTKE 382


>gi|227524629|ref|ZP_03954678.1| exodeoxyribonuclease VII large subunit [Lactobacillus hilgardii
           ATCC 8290]
 gi|227088113|gb|EEI23425.1| exodeoxyribonuclease VII large subunit [Lactobacillus hilgardii
           ATCC 8290]
          Length = 452

 Score =  266 bits (680), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 180/496 (36%), Positives = 282/496 (56%), Gaps = 67/496 (13%)

Query: 14  EY-SVSELSYHLKH--IVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           EY SV+ L+ ++K    V+  L  V + GEIS +R +  + H YFSLKD+H++I AI++K
Sbjct: 4   EYLSVTALTKYIKRKFDVDPYLMKVYLTGEISNFR-LRPNAHQYFSLKDDHAKISAIMFK 62

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
              N+I+F+PEEG++ LV G I+ +  S  YQI ++S+ P G G L  A E+ KK+L +E
Sbjct: 63  SAFNRIKFVPEEGMKVLVTGHISVYEPSGSYQIYVDSMEPDGVGQLYQAYEQLKKRLDKE 122

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKE 189
           GLFS   +  + F PK IAV+TSP+GAV+RDI+  +  R+P+ ++++FP  VQGDE   +
Sbjct: 123 GLFSQPKRQLVQF-PKRIAVVTSPSGAVVRDIITTVRRRYPIAQIVLFPALVQGDEASTD 181

Query: 190 IANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGH 249
           I   I+++N L         D +I+ RGGGSIEDLW FN+E + RAI+ S+IP+IS++GH
Sbjct: 182 IVRQIVKVNQLGHF------DTLIIGRGGGSIEDLWPFNEENVARAISASTIPVISSVGH 235

Query: 250 ETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNS 309
           ETD T+AD  AD+RA TPT AAE+AVP              RL+ +++ L      T N 
Sbjct: 236 ETDTTIADLVADVRAATPTAAAELAVP--------------RLDQVLVELK----TTQNR 277

Query: 310 LLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIF----RKYRHFNHIINRIKSDFLIHN 365
           ++ A     Q +  ++ RL RL +         +F    R Y  F+      K D L   
Sbjct: 278 IINA---EYQLIEQAKLRLKRLQQS-------TVFTSPQRIYETFSQ-----KLDLLRQR 322

Query: 366 IQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLIT 425
           ++     +   +++   + + H+R         +A  +M++EQ K R+  L   +K+  +
Sbjct: 323 LENQADKVTASRKN--NLSQLHMRLRL------VAPTYMIKEQ-KQRLNVLQLRLKQ--S 371

Query: 426 RIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRI 485
           +++ +  +K+K  +  +  +   L   +    L RGYT   D N++FI++  +L  KT I
Sbjct: 372 QLQNL--NKVKQQYLMLVGS---LDHLSPLKILGRGYTYTTDENDHFISKMADLKAKT-I 425

Query: 486 LINFFDGQANAIVINK 501
            ++F DG  NA  INK
Sbjct: 426 NVHFSDGVINA-SINK 440


>gi|158320643|ref|YP_001513150.1| exodeoxyribonuclease VII, large subunit [Alkaliphilus oremlandii
           OhILAs]
 gi|166919630|sp|A8MFJ1|EX7L_ALKOO RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|158140842|gb|ABW19154.1| exodeoxyribonuclease VII, large subunit [Alkaliphilus oremlandii
           OhILAs]
          Length = 408

 Score =  266 bits (680), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 152/360 (42%), Positives = 223/360 (61%), Gaps = 33/360 (9%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           SVSE++ ++K I+ S+  LSH+ V+GEIS YR +HSSGH YF+LKD +S+I  +++KG  
Sbjct: 7   SVSEVNQYMKRILGSDPILSHIYVKGEISNYR-LHSSGHMYFTLKDKNSKISCVMFKGNC 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            K++F PEEG+  +  G ++ +    + Q+ +  + PSG G L  A ++ K +L +EGLF
Sbjct: 66  EKLKFFPEEGMSLVCKGYVSIYEKDGQVQLYVNDMEPSGIGALHLAFQQLKDRLNKEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIAN 192
             ++K  IP IP+ IA+ITSPTGA IRD++  I  RFP + + IFPV VQG+   + I  
Sbjct: 126 DTKYKQEIPLIPRRIALITSPTGAAIRDMVSIILRRFPQVELCIFPVLVQGEGAVETIVK 185

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N        P  D+ I+ RGGGSIE+LW FN+E + RAI NS +PIISA+GHETD
Sbjct: 186 AIELCNRY------PGIDLAIVGRGGGSIEELWAFNEEKVARAIFNSRVPIISAVGHETD 239

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T++D+ ADLRA TP+ AAE+AVP +  L+  + ++E R+    I L+K K+NT    L 
Sbjct: 240 FTISDFVADLRAATPSSAAELAVPNRVELREYIDSMEKRM----IHLMKTKLNTSYQKLS 295

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
            + NS       RY L+             I+ K ++ N ++ +IKS     N++K   H
Sbjct: 296 FIENS----YFFRYPLNP------------IYDKQQYINDLLQKIKSAI---NVKKQFNH 336


>gi|163941938|ref|YP_001646822.1| exodeoxyribonuclease VII large subunit [Bacillus weihenstephanensis
           KBAB4]
 gi|229013398|ref|ZP_04170535.1| Exodeoxyribonuclease 7 large subunit [Bacillus mycoides DSM 2048]
 gi|229061870|ref|ZP_04199200.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus AH603]
 gi|229135002|ref|ZP_04263808.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus BDRD-ST196]
 gi|229168924|ref|ZP_04296641.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus AH621]
 gi|226694638|sp|A9VGD4|EX7L_BACWK RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|163864135|gb|ABY45194.1| exodeoxyribonuclease VII, large subunit [Bacillus
           weihenstephanensis KBAB4]
 gi|228614516|gb|EEK71624.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus AH621]
 gi|228648504|gb|EEL04533.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus BDRD-ST196]
 gi|228717431|gb|EEL69099.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus AH603]
 gi|228747810|gb|EEL97676.1| Exodeoxyribonuclease 7 large subunit [Bacillus mycoides DSM 2048]
          Length = 452

 Score =  266 bits (680), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 157/404 (38%), Positives = 233/404 (57%), Gaps = 25/404 (6%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ ++K  +E +  L  V ++GEIS ++  HS GH YF+LKD ++RI A+++ G  
Sbjct: 7   TVTALTRYIKTKIEYDPHLQSVWLKGEISNFK-YHSRGHMYFTLKDENARIAAVMFAGHN 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L EEGLF
Sbjct: 66  RNIKFRPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGIGNLHLAYEQLKVRLEEEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
           S  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+     I  
Sbjct: 126 SQVYKKIIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESAAPSIVQ 185

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N + +       D++I+ RGGGSIE+LW FN+E++ R I  S IPIISA+GHETD
Sbjct: 186 AIRTANEMGD------IDVLIVGRGGGSIEELWAFNEEVVAREIFTSEIPIISAVGHETD 239

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ ADLRAPTPT AAE+AVP    LQ  ++    RL     R ++ +++     L+
Sbjct: 240 FTIADFVADLRAPTPTAAAELAVPNTIELQEKVLQRTLRLQ----RAMRERVHKKEEKLQ 295

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
            L  S       R   ++   +L+  LE ++  K R+ +  +N++K            Q 
Sbjct: 296 VLQKS-YAFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQK 354

Query: 373 ILEKQQHIEQIVKQHLR----------YIFLEKKEKIAILHMLR 406
           I++ +  IE + KQ  R          ++F+   +K+ +L  L+
Sbjct: 355 IIQTKTAIETLQKQLQREMQTLLQTKEFVFVRAAQKLEVLSPLK 398


>gi|254995462|ref|ZP_05277652.1| exodeoxyribonuclease large subunit [Anaplasma marginale str.
           Mississippi]
          Length = 388

 Score =  266 bits (680), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 151/363 (41%), Positives = 227/363 (62%), Gaps = 20/363 (5%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           PE++V+E++  ++ ++      + +RGEISG     SSGH Y SLKD++S I A+ W GT
Sbjct: 3   PEFTVTEITDLVRQVMHDTFYCIKIRGEISGLSR-PSSGHVYLSLKDDNSVISAVCWNGT 61

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
              ++F  E G+E +  G I+T+   S+YQ++IE ++ +G G L   LE+R+KKL +EGL
Sbjct: 62  RLDVQF--ENGLEVICTGHISTY--QSRYQLVIEGMVLAGQGKLAAMLEERRKKLEKEGL 117

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F    K P+P +P  I VITSPTGAVIRDIL R+  RFP  +I++PV+VQG +    +  
Sbjct: 118 FDQTRKKPLPLLPLKIGVITSPTGAVIRDILNRVKHRFPSHIIVWPVQVQGSQASAMVVQ 177

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AIL  N L+E      PD+II+ARGGGSIEDLW FNDE + R  A S IPI+SAIGHETD
Sbjct: 178 AILGFNNLEE-----PPDVIIVARGGGSIEDLWPFNDEELARTAAASKIPIVSAIGHETD 232

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+ DYAAD+RAPTPT A E+ +P ++ L S + +  +++ + +  ++  K + L  L  
Sbjct: 233 FTIIDYAADVRAPTPTAAVEIVLPERQQLVSDIAHKLSKIRSAVRNVLGAKEHRLLQLYG 292

Query: 313 ALPNSDQTLS-CSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQ 371
            L  +   +S   R  L     ++E   ++ + +K ++ +++I RI         + N++
Sbjct: 293 VLTETKHKISEVGRSALAH-QEKIEFLFKVALLKKQQYLDNLIGRID--------RYNKE 343

Query: 372 HIL 374
           HIL
Sbjct: 344 HIL 346


>gi|229025643|ref|ZP_04182049.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus AH1272]
 gi|228735641|gb|EEL86230.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus AH1272]
          Length = 362

 Score =  265 bits (678), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 153/361 (42%), Positives = 219/361 (60%), Gaps = 19/361 (5%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ ++K  +E +  L  V ++GEIS ++  HS GH YF+LKD ++RI A+++ G  
Sbjct: 7   TVTALTRYIKTKIEYDPHLQSVWLKGEISNFK-YHSRGHMYFTLKDENARIAAVMFAGHN 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L EEGLF
Sbjct: 66  RNIKFKPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGIGNLHLAYEQLKVRLEEEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
           S  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+     I  
Sbjct: 126 SQVYKKTIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESAAPSIVQ 185

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N ++E       D++I+ RGGGSIE+LW FN+E++ RAI  S IPIISA+GHETD
Sbjct: 186 AIRTANEMEE------IDVLIVGRGGGSIEELWAFNEEVVARAIFTSEIPIISAVGHETD 239

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ ADLRAPTPT AAE+AVP    LQ  ++    RL     R ++ +++     L+
Sbjct: 240 FTIADFVADLRAPTPTAAAELAVPNVLELQEKVLQRTLRLQ----RAMRERVHKKEEKLQ 295

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS-DFLI---HNIQK 368
            L  S       R   ++   +L+  LE ++  K R+ +  +N++K   F +   H  QK
Sbjct: 296 VLQKS-YAFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQK 354

Query: 369 N 369
           N
Sbjct: 355 N 355


>gi|229075888|ref|ZP_04208864.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus Rock4-18]
 gi|229104808|ref|ZP_04235469.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus Rock3-28]
 gi|228678681|gb|EEL32897.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus Rock3-28]
 gi|228707203|gb|EEL59400.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus Rock4-18]
          Length = 452

 Score =  265 bits (678), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 157/387 (40%), Positives = 225/387 (58%), Gaps = 17/387 (4%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ ++K  +E +  L  V ++GEIS ++  HS GH YF+LKD ++RI A+++ G  
Sbjct: 7   TVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAVMFAGHN 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L EEGLF
Sbjct: 66  RNIKFRPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGVGNLHLAYEQLKVRLEEEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
           S  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+     I  
Sbjct: 126 SQVYKKIIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESAAPSIVQ 185

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N + +       D++I+ RGGGSIE+LW FN+E++ RAI  S IPIISA+GHETD
Sbjct: 186 AIRTANEMGD------IDVLIVGRGGGSIEELWAFNEEVVARAIFKSEIPIISAVGHETD 239

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   L  L K
Sbjct: 240 FTIADFVADLRAPTPTAAAELAAPNVIELQEKVLQRTLRLQRAMRELVHKKEEKLQVLQK 299

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
           +           R   ++   +L+  LE ++  K R+ +  +N++K            Q 
Sbjct: 300 SY-----AFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQK 354

Query: 373 ILEKQQHIEQIVKQHLRYI--FLEKKE 397
           I++ +  IE + KQ  R +   L+ KE
Sbjct: 355 IIQTKVAIETLQKQLQREMQTLLQTKE 381


>gi|229098652|ref|ZP_04229592.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus Rock3-29]
 gi|229117677|ref|ZP_04247047.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus Rock1-3]
 gi|228665769|gb|EEL21241.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus Rock1-3]
 gi|228684731|gb|EEL38669.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus Rock3-29]
          Length = 452

 Score =  265 bits (678), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 157/387 (40%), Positives = 225/387 (58%), Gaps = 17/387 (4%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ ++K  +E +  L  V ++GEIS ++  HS GH YF+LKD ++RI A+++ G  
Sbjct: 7   TVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAVMFAGHN 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L EEGLF
Sbjct: 66  RNIKFRPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGVGNLHLAYEQLKVRLEEEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
           S  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+     I  
Sbjct: 126 SQVYKKIIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESAAPSIVQ 185

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N + +       D++I+ RGGGSIE+LW FN+E++ RAI  S IPIISA+GHETD
Sbjct: 186 AIRTANEMGD------IDVLIVGRGGGSIEELWAFNEEVVARAIFKSEIPIISAVGHETD 239

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   L  L K
Sbjct: 240 FTIADFVADLRAPTPTAAAELAAPNVIELQEKVLQRTLRLQRAMRELVHKKEEKLQVLQK 299

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
           +           R   ++   +L+  LE ++  K R+ +  +N++K            Q 
Sbjct: 300 SY-----AFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQK 354

Query: 373 ILEKQQHIEQIVKQHLRYI--FLEKKE 397
           I++ +  IE + KQ  R +   L+ KE
Sbjct: 355 IIQTKVAIETLQKQLQREMQTLLQTKE 381


>gi|189424974|ref|YP_001952151.1| exodeoxyribonuclease VII large subunit [Geobacter lovleyi SZ]
 gi|189421233|gb|ACD95631.1| exodeoxyribonuclease VII, large subunit [Geobacter lovleyi SZ]
          Length = 454

 Score =  265 bits (678), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 150/406 (36%), Positives = 227/406 (55%), Gaps = 13/406 (3%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           MN F+++  L     +VS L+  LK ++E N S V   GE S      +SGH Y +LKD+
Sbjct: 1   MNLFAEQTIL-----TVSRLTSLLKDLIEDNFSQVWAEGEASNLT-YAASGHVYCTLKDS 54

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            + +  ++++ ++  ++F  EEG+  +V G+++ +    +YQ+I E   P G G L  A 
Sbjct: 55  GAMLRCVMFRSSVKALKFKLEEGMALVVRGRLSVYDQRGEYQLIAEYAEPKGLGALQAAF 114

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCR-FPLRVIIFPV 179
            + K++L  EGLFS+ HK P+PF+P+ + ++TS +GA I DIL  +  R   L +I++PV
Sbjct: 115 VQLKERLAGEGLFSESHKQPLPFMPQKVGIVTSASGAAIHDILNVLGRRNAGLHLIVYPV 174

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
           +VQG     EIA AI  LN L         D++I+ RGGGS+EDLW FN+E++ RA+  S
Sbjct: 175 RVQGVGSAAEIAAAIDNLNRLNAA------DVLIVGRGGGSLEDLWAFNEELVARAVYRS 228

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
            IP+ISA+GHETDWT+ D+ ADLRAPTP+ AAE+    +E L + + NL  RL+  I   
Sbjct: 229 RIPVISAVGHETDWTICDFVADLRAPTPSAAAELVCTAREELLNQIQNLVLRLDQAISSQ 288

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
           +K +I+ L  L +AL +  + L     R+D L   L+  L  +  R           +  
Sbjct: 289 LKLRIHNLAGLRRALHDPSRMLGHQLQRVDDLSERLDMALRNLFGRHREQLARQEQHLAG 348

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHML 405
                 I K RQ +L   +H E+ V   L  +  E+ E  A L  L
Sbjct: 349 LHPAIQISKLRQKLLLLTEHAERRVTSQLEQLGRERGEATARLEAL 394


>gi|154498047|ref|ZP_02036425.1| hypothetical protein BACCAP_02028 [Bacteroides capillosus ATCC
           29799]
 gi|150273037|gb|EDN00194.1| hypothetical protein BACCAP_02028 [Bacteroides capillosus ATCC
           29799]
          Length = 399

 Score =  265 bits (677), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 139/344 (40%), Positives = 208/344 (60%), Gaps = 12/344 (3%)

Query: 15  YSVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           YSVS+++ ++K +++ +  LS + +RGEIS Y+ ++ SGH YFS+KD    I  ++++  
Sbjct: 7   YSVSQVNQYIKDLLDGDGALSGIYIRGEISNYK-MYPSGHHYFSMKDEGGAIRCVMFRRE 65

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
            + + F PE G++ +  G++T FP   +YQ+ + +L P G G L  A E+ K KL  EGL
Sbjct: 66  ASALRFRPENGMKVVAFGRVTVFPRDGQYQLYVSALTPDGVGDLYVAFEQLKAKLYAEGL 125

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIA 191
           F   HK PIP  P+ IA++TS  GA +RD+L+ +  R+P+ +V + PV+VQG E P EIA
Sbjct: 126 FDPAHKKPIPRFPRRIALVTSAAGAAVRDMLRILGARWPMAQVAVVPVRVQGAEAPGEIA 185

Query: 192 NAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHET 251
            A+  +N L         D+II  RGGGS+EDLW FN+E++ RAI  S +P+ISA+GHE 
Sbjct: 186 AALGWVNRLGWA------DLIITGRGGGSMEDLWAFNEEIVARAIYASQVPVISAVGHEP 239

Query: 252 DWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSL- 310
           D T+AD+ ADLRA TP+ AAE+AVP +  +   L  L AR+   + R +    + L  L 
Sbjct: 240 DVTIADFVADLRAATPSNAAELAVPDQNDVAGRLNQLSARMEQAMSRRLGEFSSKLERLS 299

Query: 311 -LKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHI 353
             +AL N    +   R  LD     L H L   + R+ +HF  +
Sbjct: 300 GSRALQNPMNYIEDRRVLLDYQRTRLAHGLSGTLNRERQHFARL 343


>gi|222475661|ref|YP_002564078.1| exodeoxyribonuclease large subunit (xseA) [Anaplasma marginale str.
           Florida]
 gi|255003653|ref|ZP_05278617.1| exodeoxyribonuclease large subunit (xseA) [Anaplasma marginale str.
           Puerto Rico]
 gi|254783686|sp|B9KHB8|EX7L_ANAMF RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|222419799|gb|ACM49822.1| exodeoxyribonuclease large subunit (xseA) [Anaplasma marginale str.
           Florida]
          Length = 397

 Score =  265 bits (676), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 150/363 (41%), Positives = 227/363 (62%), Gaps = 20/363 (5%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           PE++V+E++  ++ ++      + +RGEISG     SSGH Y SLKD++S I A+ W GT
Sbjct: 12  PEFTVTEITDLVRQVMHDTFYCIKIRGEISGLSR-PSSGHVYLSLKDDNSVISAVCWHGT 70

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
              ++F  E G+E +  G I+T+   S+YQ++IE ++ +G G L   LE+R+KKL +EGL
Sbjct: 71  RLDVQF--ENGLEVICTGHISTY--QSRYQLVIEGMVLAGQGKLAAMLEERRKKLEKEGL 126

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F    K P+P +P  I VITSPTGAVIRDIL R+  RFP  +I++PV+VQG +    +  
Sbjct: 127 FDQARKKPLPLLPLKIGVITSPTGAVIRDILNRVKHRFPSHIIVWPVQVQGSQASAMVVQ 186

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AIL  N L+E      PD+II+ARGGGSIEDLW FNDE + R  A S IPI+SAIGHETD
Sbjct: 187 AILGFNNLEE-----PPDVIIVARGGGSIEDLWPFNDEELARTAAASKIPIVSAIGHETD 241

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+ DYAAD+RAPTPT A E+ +P ++ L S + +  +++ + +  ++  K + L  L  
Sbjct: 242 FTIIDYAADVRAPTPTAAVEIVLPERQQLVSDIAHKLSKIRSAVRNVLGAKEHRLLQLYG 301

Query: 313 ALPNSDQTLS-CSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQ 371
            L  +   +S   R  L     ++E   ++ + +K ++ +++I RI         + N++
Sbjct: 302 VLTETKHKISEVGRSALAH-QEKIEFLFKVALLKKQQYLDNLIGRID--------RYNKE 352

Query: 372 HIL 374
           HI+
Sbjct: 353 HII 355


>gi|118580820|ref|YP_902070.1| exodeoxyribonuclease VII large subunit [Pelobacter propionicus DSM
           2379]
 gi|118503530|gb|ABL00013.1| Exodeoxyribonuclease VII large subunit [Pelobacter propionicus DSM
           2379]
          Length = 475

 Score =  264 bits (674), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 140/354 (39%), Positives = 213/354 (60%), Gaps = 13/354 (3%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M+ FS+K  L     +VS L+  L+ ++E N   V V+GE+S +    SSGH YFSLKD+
Sbjct: 1   MDLFSEKIIL-----TVSRLTSLLRDVLEENFQQVWVQGEVSNFSS-PSSGHFYFSLKDS 54

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            +++  +++KG    ++F P +G+  +  G+I+ +     YQ+I E L P+G G L  A 
Sbjct: 55  GAQLRCVMFKGAARNLKFRPGDGMALIARGRISVYDQRGDYQLICEYLEPAGVGALQAAF 114

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPV 179
           ++ K++L  EGLF   HK  +PF P+ + VITS TGA I DIL  +  RF  L ++++PV
Sbjct: 115 QQLKERLAREGLFDQAHKRHLPFFPRRLGVITSATGAAIHDILNVLRRRFASLEILLYPV 174

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
           +VQG+    EIA A+ ++N L+        D++I+ RGGGS+EDLW FN+E++ RA+  S
Sbjct: 175 RVQGEGAGLEIARAVEEMNRLQ------MADVLIVGRGGGSLEDLWAFNEEVLARALYRS 228

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
           +IP+ISA+GHETDWT+AD+ ADLRAPTP+ AAE+ V   + L+  +  LE RL   +   
Sbjct: 229 AIPVISAVGHETDWTIADFVADLRAPTPSAAAELVVASADELRGRVEGLEHRLGLAMESR 288

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHI 353
           +    + + SL + L +   TL     R+D L   LE  L   + R    F+ +
Sbjct: 289 LSTLESRVASLRRLLADPSATLGHLAQRVDDLTERLELGLHNGVMRLKERFDRL 342


>gi|56417297|ref|YP_154371.1| exodeoxyribonuclease large subunit [Anaplasma marginale str. St.
           Maries]
 gi|81821242|sp|Q5P9B4|EX7L_ANAMM RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|56388529|gb|AAV87116.1| exodeoxyribonuclease large subunit [Anaplasma marginale str. St.
           Maries]
          Length = 397

 Score =  264 bits (674), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 149/363 (41%), Positives = 227/363 (62%), Gaps = 20/363 (5%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           PE++V+E++  ++ ++      + +RGEISG     SSGH Y SLKD++S I A+ W GT
Sbjct: 12  PEFTVTEITDLVRQVMHDTFYCIKIRGEISGLSR-PSSGHVYLSLKDDNSVISAVCWNGT 70

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
              ++F  E G+E +  G ++T+   S+YQ++IE ++ +G G L   LE+R+KKL +EGL
Sbjct: 71  RLDVQF--ENGLEVICTGHLSTY--QSRYQLVIEGMVLAGQGKLAAMLEERRKKLEKEGL 126

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F    K P+P +P  I VITSPTGAVIRDIL R+  RFP  +I++PV+VQG +    +  
Sbjct: 127 FDQARKKPLPLLPLKIGVITSPTGAVIRDILNRVKHRFPSHIIVWPVQVQGSQASAMVVQ 186

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AIL  N L+E      PD+II+ARGGGSIEDLW FNDE + R  A S IPI+SAIGHETD
Sbjct: 187 AILGFNNLEE-----PPDVIIVARGGGSIEDLWPFNDEELARTTAASKIPIVSAIGHETD 241

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+ DYAAD+RAPTPT A E+ +P ++ L S + +  +++ + +  ++  K + L  L  
Sbjct: 242 FTIIDYAADVRAPTPTAAVEIVLPERQQLVSDIAHKLSKIRSAVRNVLGAKEHRLLQLYG 301

Query: 313 ALPNSDQTLS-CSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQ 371
            L  +   +S   R  L     ++E   ++ + +K ++ +++I RI         + N++
Sbjct: 302 VLTETKHKISEVGRSALAH-QEKIEFLFKVALLKKQQYLDNLIGRID--------RYNKE 352

Query: 372 HIL 374
           HI+
Sbjct: 353 HII 355


>gi|88607196|ref|YP_505831.1| exodeoxyribonuclease VII, large subunit [Anaplasma phagocytophilum
           HZ]
 gi|123494204|sp|Q2GIH0|EX7L_ANAPZ RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|88598259|gb|ABD43729.1| exodeoxyribonuclease VII, large subunit [Anaplasma phagocytophilum
           HZ]
          Length = 398

 Score =  263 bits (672), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 147/351 (41%), Positives = 218/351 (62%), Gaps = 18/351 (5%)

Query: 11  DHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           D PE++V+E++  L+  ++     + VRGEISG     +SGH YF+LKD++S I+A+ W 
Sbjct: 12  DIPEFTVTEITGVLQRFMQETFYSIKVRGEISGLSR-PNSGHVYFTLKDSNSVINAVCWN 70

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           GT  K++F   +G+E +  G ++ +   SKYQ+I+  +  +G G L   L + KKKL  E
Sbjct: 71  GTRLKVQFC--DGLEVVCTGYLSVY--QSKYQLIVTDMTLAGYGKLAAMLAELKKKLELE 126

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEI 190
           GLFS   K  +PF+P  I VITSPTGAVI DI+ R+  RFP  V+++PV+VQGD     +
Sbjct: 127 GLFSPARKKKLPFLPTKIGVITSPTGAVISDIISRVKQRFPSNVVVWPVQVQGDRASAMV 186

Query: 191 ANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHE 250
             AI   N+  +      P +II+ARGGGS EDLW FNDE + R +A S IPI+SAIGHE
Sbjct: 187 IEAIKGFNSFADP-----PHVIIVARGGGSFEDLWPFNDEELARTVAASKIPIVSAIGHE 241

Query: 251 TDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNI----IIRLIKYKINT 306
           TD+T+ DYAADLRA TPT A E+ +P K  L +S IN +     I    I+++ +Y++  
Sbjct: 242 TDFTIIDYAADLRASTPTAAVELVLPEKSKLVAS-INEKFVRTKISFERIVKMQEYRLLR 300

Query: 307 LNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRI 357
           L+ +L    NS   L  SR  L+   +++ + L++ + RK ++   ++ R+
Sbjct: 301 LHGILTEKKNS--LLQKSRVALE-YQQKIRYLLQVSLLRKRQYLESLMQRL 348


>gi|28378301|ref|NP_785193.1| exodeoxyribonuclease VII large subunit [Lactobacillus plantarum
           WCFS1]
 gi|254556508|ref|YP_003062925.1| exodeoxyribonuclease VII large subunit [Lactobacillus plantarum
           JDM1]
 gi|31563098|sp|Q88WM7|EX7L_LACPL RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|28271136|emb|CAD64041.1| exodeoxyribonuclease VII, large subunit [Lactobacillus plantarum
           WCFS1]
 gi|254045435|gb|ACT62228.1| exodeoxyribonuclease VII large subunit [Lactobacillus plantarum
           JDM1]
          Length = 447

 Score =  263 bits (672), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 154/411 (37%), Positives = 235/411 (57%), Gaps = 24/411 (5%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ +LK   E +  L  V + GE+S YR    + H YFSLKD+H++I AI++K   
Sbjct: 9   TVTALTQYLKRKFEVDPYLGKVYLTGEVSNYRP-RPNTHQYFSLKDDHAKISAIMFKSAF 67

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            K++F PEEG++ LV+G+I  +  S  YQI +E + P G G L  A E+ KKKL  EGLF
Sbjct: 68  AKVKFQPEEGMKVLVVGRIGLYEPSGSYQIYVERMEPDGVGALYQAYEQLKKKLAAEGLF 127

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
           S   K P+P  PK IAV+TS +GAVIRDI+     RFP+ ++++FP +VQGD    EI+ 
Sbjct: 128 SA-PKKPLPRFPKRIAVVTSRSGAVIRDIITTTRRRFPIAQIVLFPSQVQGDAAAAEISR 186

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
            I + N   +       D +I+ RGGGSIEDLW FN+E++ RAIA S +P+IS++GHETD
Sbjct: 187 QIERANAQGDF------DTLIIGRGGGSIEDLWPFNEEVVARAIAQSQLPVISSVGHETD 240

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            T+AD  AD+RA TPT AAE+AVPV   +   L   + R+ N     ++     LN L  
Sbjct: 241 TTIADLVADVRAATPTAAAELAVPVYNDVLLQLKQDQTRVFNAFQNFVQRDRQRLNKLQT 300

Query: 313 AL----PNS--DQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNI 366
           +     PN   +  L    +  +RL +  ++N  +      +H+  +  +++    IH +
Sbjct: 301 SYVFTQPNRLYEGYLQKLDFLNERLKQAGQNNFNL----ASQHYQRVFQQLRQQTPIHQV 356

Query: 367 QKNRQHILEKQQHIE---QIVKQHLRYIFLEKKEKIAILHMLREQTKNRIF 414
           ++ +  +L  QQ +    Q+V +  R    +  + + +L  L+  T+   F
Sbjct: 357 RQAQTQLLNLQQRLNRGTQLVVRQKRQQLTQTVQSLDLLSPLKIMTRGYAF 407


>gi|85859628|ref|YP_461830.1| exodeoxyribonuclease VII large subunit [Syntrophus aciditrophicus
           SB]
 gi|85722719|gb|ABC77662.1| exodeoxyribonuclease VII large subunit [Syntrophus aciditrophicus
           SB]
          Length = 466

 Score =  263 bits (671), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 143/323 (44%), Positives = 210/323 (65%), Gaps = 16/323 (4%)

Query: 16  SVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK---GT 72
           +VSEL+  ++ ++E+    + V GE+S  R   SSGH YF+LKD  S+I A+I++   G+
Sbjct: 22  TVSELNEKIRDLLEARFDLLWVEGEVSNLRR-PSSGHIYFTLKDEKSQIRAVIFRFLPGS 80

Query: 73  L----NKIEFLP-EEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
                N++ F   EEG++     ++  +    +YQ+I++SL P G+G L  A E+ K +L
Sbjct: 81  RPFRNNRLPFFDLEEGMQITCRARLAVYAPRGEYQLILDSLEPRGTGALQKAYEQLKARL 140

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF    K PIP++P+ I VITSPTGAVIRDIL   + RFP + ++I PV+VQG E 
Sbjct: 141 QAEGLFDASRKKPIPYLPRRIGVITSPTGAVIRDILNITARRFPSVSLVIAPVRVQGPEA 200

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P+EI  AI  L++L+E       D++ILARGGGS+EDL  FNDE + RAIA+SS+P+ISA
Sbjct: 201 PREIVQAIQDLHSLEE------VDVLILARGGGSLEDLSAFNDESVARAIASSSLPVISA 254

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD+T+AD+AAD+RAPTP+ AAE+AVP +  L + L    +RL  ++IR +  +   
Sbjct: 255 VGHETDFTIADFAADVRAPTPSTAAELAVPNRNDLTAWLAGTRSRLYTLLIRSMTQRREQ 314

Query: 307 LNSLLKALPNSDQTLSCSRYRLD 329
           L    + L +  + ++  R  LD
Sbjct: 315 LVRCRERLKDPQRVITGLRLALD 337


>gi|89099253|ref|ZP_01172131.1| exodeoxyribonuclease VII large subunit [Bacillus sp. NRRL B-14911]
 gi|89086099|gb|EAR65222.1| exodeoxyribonuclease VII large subunit [Bacillus sp. NRRL B-14911]
          Length = 446

 Score =  263 bits (671), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 129/280 (46%), Positives = 187/280 (66%), Gaps = 10/280 (3%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V  L+ ++K   + +  L  + V+GEIS ++  HSSGH YF+LKD  SRI A+++  + 
Sbjct: 8   TVGALTLYIKRKFDHDPHLQEIFVKGEISNFK-RHSSGHMYFTLKDEKSRILAVMFSRSA 66

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             ++F PE G++ L+ G+I+ +  S +YQI ++ + P G G L  A E+ K++L +EGLF
Sbjct: 67  RSVKFEPENGMKVLISGEISVYEPSGQYQIYVKQMQPDGVGDLFLAFEQLKERLQKEGLF 126

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
           + + K PIP  PK + VITSPTGA +RDI+  I  RFP+  ++I+P  VQG +    +A 
Sbjct: 127 ASERKRPIPKFPKTVGVITSPTGAAVRDIITTIKRRFPIANILIYPALVQGAQAAPSVAG 186

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N   E       D++I+ RGGGSIE+LW FN+E + RAI  S IP+ISA+GHETD
Sbjct: 187 AIELANLQAEA------DVLIVGRGGGSIEELWAFNEEQVARAIVGSDIPVISAVGHETD 240

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARL 292
           +T+AD+AAD RAPTPTGAAEMAVP  + L   ++N ++RL
Sbjct: 241 FTIADFAADHRAPTPTGAAEMAVPHIDELAERILNRQSRL 280


>gi|300767237|ref|ZP_07077149.1| exodeoxyribonuclease VII large subunit [Lactobacillus plantarum
           subsp. plantarum ATCC 14917]
 gi|308180451|ref|YP_003924579.1| exodeoxyribonuclease VII large subunit [Lactobacillus plantarum
           subsp. plantarum ST-III]
 gi|300495056|gb|EFK30212.1| exodeoxyribonuclease VII large subunit [Lactobacillus plantarum
           subsp. plantarum ATCC 14917]
 gi|308045942|gb|ADN98485.1| exodeoxyribonuclease VII large subunit [Lactobacillus plantarum
           subsp. plantarum ST-III]
          Length = 447

 Score =  262 bits (669), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 153/411 (37%), Positives = 235/411 (57%), Gaps = 24/411 (5%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ +LK   E +  L  V + GE+S YR    + H YFSLKD+H++I AI++K   
Sbjct: 9   TVTALTQYLKRKFEVDPYLGKVYLTGEVSNYRP-RPNTHQYFSLKDDHAKISAIMFKSAF 67

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            K++F PEEG++ LV+G+I  +  S  YQI +E + P G G L  A E+ KKKL  EGLF
Sbjct: 68  AKVKFQPEEGMKVLVVGRIGLYEPSGSYQIYVERMEPDGVGALYQAYEQLKKKLAAEGLF 127

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
           S   K P+P  P+ IAV+TS +GAVIRDI+     RFP+ ++++FP +VQGD    EI+ 
Sbjct: 128 SA-PKKPLPRFPRRIAVVTSRSGAVIRDIITTTRRRFPIAQIVLFPSQVQGDAAAAEISR 186

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
            I + N   +       D +I+ RGGGSIEDLW FN+E++ RAIA S +P+IS++GHETD
Sbjct: 187 QIERANAQGDF------DTLIIGRGGGSIEDLWPFNEEVVARAIAQSQLPVISSVGHETD 240

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            T+AD  AD+RA TPT AAE+AVPV   +   L   + R+ N     ++     LN L  
Sbjct: 241 TTIADLVADVRAATPTAAAELAVPVYNDVLLQLKQDQTRVFNAFQNFVQRDRQRLNKLQT 300

Query: 313 AL----PNS--DQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNI 366
           +     PN   +  L    +  +RL +  ++N  +      +H+  +  +++    IH +
Sbjct: 301 SYVFTQPNRLYEGYLQKLDFLNERLKQAGQNNFNL----ASQHYQRVFQQLRQQTPIHQV 356

Query: 367 QKNRQHILEKQQHIE---QIVKQHLRYIFLEKKEKIAILHMLREQTKNRIF 414
           ++ +  +L  QQ +    Q+V +  R    +  + + +L  L+  T+   F
Sbjct: 357 RQAQTQLLNLQQRLNRGTQLVVRQKRQQLTQTVQSLDLLSPLKIMTRGYAF 407


>gi|269958313|ref|YP_003328100.1| exodeoxyribonuclease VII, large subunit [Anaplasma centrale str.
           Israel]
 gi|269848142|gb|ACZ48786.1| exodeoxyribonuclease VII, large subunit [Anaplasma centrale str.
           Israel]
          Length = 388

 Score =  262 bits (669), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 152/363 (41%), Positives = 223/363 (61%), Gaps = 20/363 (5%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           PE++V+E++  ++ ++      + +RGEISG     SSGH Y SLKD++S I A+ W GT
Sbjct: 3   PEFTVTEVTDLVQRVMHDTFYCIKIRGEISGLSR-PSSGHVYLSLKDDNSVISAVCWNGT 61

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
              ++F  E G+E +  G ++T+   S+YQ++IE ++ +G G L   LE+R+KKL +EGL
Sbjct: 62  RLDVQF--ENGLEVICTGHLSTY--QSRYQLVIEGMVLAGQGKLAAMLEERRKKLEKEGL 117

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F    K P+P +P  I VITSPTGAVIRDIL R+  RFP  +I++PV+VQG +    +  
Sbjct: 118 FDQARKKPLPLLPLKIGVITSPTGAVIRDILNRVKHRFPSHIIVWPVQVQGSQASAMVVQ 177

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AIL  N L+E      PD+II+ARGGGSIEDLW FNDE + R  A S IPI+SAIGHETD
Sbjct: 178 AILGFNNLEE-----PPDVIIVARGGGSIEDLWPFNDEELARTTAASKIPIVSAIGHETD 232

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+ DYAAD+RAPTPT A E+ +P ++ L S + +   ++ + +   +  K + L  L  
Sbjct: 233 FTIIDYAADVRAPTPTAAVEIVLPERQQLVSDITHRFLKIRSAVRNALSAKEHRLLQLYG 292

Query: 313 ALPNSDQTLS-CSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQ 371
            L  +   +S   R  L +  R     L   + +K +H +++I RI         + N++
Sbjct: 293 VLTEARHRISEVGRSALAQRART-GLLLRTALLKKQQHLDNLIGRIG--------RYNKK 343

Query: 372 HIL 374
           HIL
Sbjct: 344 HIL 346


>gi|163790198|ref|ZP_02184631.1| exodeoxyribonuclease VII large subunit [Carnobacterium sp. AT7]
 gi|159874473|gb|EDP68544.1| exodeoxyribonuclease VII large subunit [Carnobacterium sp. AT7]
          Length = 446

 Score =  261 bits (668), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 177/497 (35%), Positives = 267/497 (53%), Gaps = 73/497 (14%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ ++K   E +  L  + + GEIS +R    + H YFSLKD+H++I AI++K   
Sbjct: 7   TVTALTRYIKRKFERDPYLDRIYLTGEISNFRN-RPNAHQYFSLKDDHAKISAIMFKPAF 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            K++F PEEG++ LVIG+IT +  S  YQI IE + P G G L  ALE+ KKKL  EGLF
Sbjct: 66  QKLKFTPEEGMKVLVIGRITLYEASGNYQITIEHMEPDGVGALYQALEEMKKKLRHEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
            D  K  IP  PK IAVITSP+GAV+RDI+  I  RFP+ +++I+P  VQG +  + I +
Sbjct: 126 -DAPKQLIPTFPKRIAVITSPSGAVVRDIMTTIKRRFPIVQLVIYPTLVQGTKAAEAIVS 184

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           +I  +    +       D +I+ARGGGSIEDLW FN+E++ RAI  +  PIIS++GHETD
Sbjct: 185 SIRMVEEKGDF------DTMIIARGGGSIEDLWPFNEEIVARAIFEAQTPIISSVGHETD 238

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            T+AD  AD+RA TPT AAE++VP+              L++ +I++ + K+  + S  +
Sbjct: 239 TTIADLVADVRAATPTAAAELSVPL--------------LSDELIKIDQLKLRLVQSYAR 284

Query: 313 ALPNSDQTLS--CSRYRLD---RLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQ 367
            + N +Q L+   S Y  +   RL       L+++  R  R       ++K++  +H +Q
Sbjct: 285 KVENLNQRLAGHLSSYIFNQPQRLYEGYAQKLDLLTERLIRSMEEKNQQLKNELNVHTLQ 344

Query: 368 KNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRI 427
            N        Q+  Q+VKQ           K + L ++  Q              L T++
Sbjct: 345 LN-------AQNPAQLVKQ-----------KYSDLTVMDRQ--------------LTTQM 372

Query: 428 EFILSHKIKSCHTSVSITTRILQSFAYKNTLK---RGYTSIQDTNNNFITQKRNLATKTR 484
           E+ + ++ K  H +V       QS  Y + LK   RGY S    +   I   + +    +
Sbjct: 373 EWYMENQTKRFHYAV-------QSLDYLSPLKILNRGY-SYATKDGKVIKDSKQVDVDDK 424

Query: 485 ILINFFDGQANAIVINK 501
           I I+   G   A VI K
Sbjct: 425 IHIHLHKGNFEAKVIKK 441


>gi|328956984|ref|YP_004374370.1| exodeoxyribonuclease VII large subunit [Carnobacterium sp. 17-4]
 gi|328673308|gb|AEB29354.1| exodeoxyribonuclease VII large subunit [Carnobacterium sp. 17-4]
          Length = 454

 Score =  261 bits (668), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 181/503 (35%), Positives = 268/503 (53%), Gaps = 69/503 (13%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRID 65
           N L +   +V+ L+ ++K   E +  L  + + GEIS +R   ++ H YFSLKD+H++I 
Sbjct: 7   NKLSNDYLTVTALTKYIKRKFERDPYLERIYLTGEISNFRN-RANAHQYFSLKDDHAKIS 65

Query: 66  AIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKK 125
           AI++K    K++F PEEG++ LVIG+I+ +  S  YQI IE + P G G L  ALE+ KK
Sbjct: 66  AIMFKAAFQKLKFTPEEGMKVLVIGRISLYEASGNYQITIEHMEPDGVGALYQALEEMKK 125

Query: 126 KLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGD 184
           KL  EGLF D  K  IP  PK IAV+TSP+GAVIRDI+  I  RFP+ +++I+P  VQG+
Sbjct: 126 KLKNEGLF-DAPKQLIPTFPKRIAVVTSPSGAVIRDIMTTIKRRFPIVQLVIYPTLVQGN 184

Query: 185 ECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPII 244
           +    I  +I  +    +       D +ILARGGGSIEDLW FN+E + RAI  +  PII
Sbjct: 185 KAADAIVASIRMVEEKGDF------DTMILARGGGSIEDLWPFNEEKVARAIFEAQTPII 238

Query: 245 SAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKI 304
           S++GHETD T+AD  AD+RA TPT AAE++VP+   L   LI +E +L   +++    K+
Sbjct: 239 SSVGHETDTTIADLVADVRAATPTAAAEISVPL---LSEELIKIE-QLKLRLVQSYARKV 294

Query: 305 NTLNSLLKALPNSDQTLSCSRYRLD---RLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
             LN  L +  NS        Y  +   RL       L+++  R  R       ++K+D 
Sbjct: 295 EILNQRLTSQLNS--------YIFNQPQRLYEGYAQKLDLLTERLVRAMEEKNQQLKNDL 346

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIK 421
            +H +Q N        Q+  Q+VKQ        K   + +++                 K
Sbjct: 347 NVHMLQLN-------AQNPTQLVKQ--------KHSDLNVMN-----------------K 374

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLK---RGYTSIQDTNNNFITQKRN 478
           +L T++E+ + ++ K    +V       QS  Y + LK   RGY S    +   I   + 
Sbjct: 375 QLTTQMEWYMENQTKRFQYAV-------QSLDYLSPLKIMNRGY-SYATKDGKVIKDSKQ 426

Query: 479 LATKTRILINFFDGQANAIVINK 501
           +  + +I I+   G   A VI K
Sbjct: 427 VEVEDKIHIHLHKGTFEAKVIKK 449


>gi|56964230|ref|YP_175961.1| exodeoxyribonuclease VII large subunit [Bacillus clausii KSM-K16]
 gi|81822079|sp|Q5WF60|EX7L_BACSK RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|56910473|dbj|BAD65000.1| exodeoxyribonuclease VII large subunit [Bacillus clausii KSM-K16]
          Length = 458

 Score =  261 bits (666), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 142/366 (38%), Positives = 220/366 (60%), Gaps = 15/366 (4%)

Query: 15  YSVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           ++VSE + ++K ++E +  L  + +RGE+S ++  H+ GH YF++KD  SR+ A+++ G 
Sbjct: 11  WTVSEATRYIKQLLEDDPHLPEIWIRGELSNFKQ-HTRGHMYFTIKDEGSRMQAVMFAGY 69

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
              + F PE G+  L+ G+I  +    +YQ   + + P G G+L    E+ KK L  EGL
Sbjct: 70  NRFLRFKPENGMNVLIRGEINVYEPYGQYQFYAKEMQPDGIGSLFAEYERLKKALEAEGL 129

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIA 191
           F+++ K PIP  P  IA+ITSPTGAVIRD++  +  R+P +RV +FPV VQG+  P  I+
Sbjct: 130 FAEERKRPIPRFPTHIAIITSPTGAVIRDMMTTLKRRYPQIRVTLFPVLVQGEGAPLSIS 189

Query: 192 NAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHET 251
            A      L++       D++I+ARGGGSIE+LW FN+EM+ RAIA +++P+ISA+GHET
Sbjct: 190 RA------LEQASMANIFDVVIVARGGGSIEELWAFNEEMVARAIAEAAVPVISAVGHET 243

Query: 252 DWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLL 311
           D+T++D+AAD RAPTPT AAE AVP    L   + +L+ RL   ++  +K +   L  L 
Sbjct: 244 DFTISDFAADRRAPTPTAAAEFAVPDARELMEHIGHLKKRLERSLVEQVKTRRRELERLK 303

Query: 312 K--ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRK---YRHFNHIINRIKSDFLIHNI 366
           +  A     Q +     +LD L   L   ++I + +K   ++H N  I R      +  +
Sbjct: 304 RSYAFRYPVQLVHQKEQQLDGLMERLNRAMQIKLEQKTLAFKHMNQAILRQHPATRVSQL 363

Query: 367 QKNRQH 372
           QK R+ 
Sbjct: 364 QKERRQ 369


>gi|303239903|ref|ZP_07326426.1| exodeoxyribonuclease VII, large subunit [Acetivibrio cellulolyticus
           CD2]
 gi|302592613|gb|EFL62338.1| exodeoxyribonuclease VII, large subunit [Acetivibrio cellulolyticus
           CD2]
          Length = 409

 Score =  259 bits (663), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 136/301 (45%), Positives = 201/301 (66%), Gaps = 10/301 (3%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           SVS ++ ++K I+  +  LS++ VRGE+S ++  HSSGH YF+LKD +S I  ++++   
Sbjct: 14  SVSLVNRYIKEIISRDMILSNLWVRGEVSNFKN-HSSGHMYFTLKDENSLIKCVMFRTQN 72

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
           + ++F+PE G++ ++ G ++ F    +YQ+  E +I  G G L  A E+ KK+L EEGLF
Sbjct: 73  SYLKFMPENGMKVIIRGYVSLFERDGQYQLYAEEMISDGVGNLHIAFEQLKKRLSEEGLF 132

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRF-PLRVIIFPVKVQGDECPKEIAN 192
            +  K  IPF+P  I V+TS TGAVIRDI+  +  RF    + IFPVKVQG    KEI+ 
Sbjct: 133 DNSFKKRIPFMPGSIGVVTSSTGAVIRDIINVLDRRFYNANIKIFPVKVQGAGAAKEISR 192

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI +LN LK    C   D+II+ARGGGS+E+LW FN+E++ R+I NS IP+ISA+GH+TD
Sbjct: 193 AINKLNELK----CV--DVIIVARGGGSLEELWPFNEEIVARSIFNSKIPVISAVGHDTD 246

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+ D+ AD+RAPTP+ AAE+ +P K  L + +  LE R  + ++R +K K   L+ L  
Sbjct: 247 YTICDFVADVRAPTPSAAAEIVMPEKHMLVNRISELEIRFRSALLRNVKIKRKRLDELKN 306

Query: 313 A 313
           A
Sbjct: 307 A 307


>gi|196248857|ref|ZP_03147557.1| exodeoxyribonuclease VII, large subunit [Geobacillus sp. G11MC16]
 gi|196211733|gb|EDY06492.1| exodeoxyribonuclease VII, large subunit [Geobacillus sp. G11MC16]
          Length = 448

 Score =  259 bits (662), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 160/477 (33%), Positives = 253/477 (53%), Gaps = 53/477 (11%)

Query: 25  KHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNKIEFLPEEGI 84
           K  V+ +L  + ++GEIS ++  HS GH YF+LKD+ +RI A+++ G    + F PE+G+
Sbjct: 18  KFDVDPHLRDLWIKGEISNFKQ-HSRGHMYFTLKDSEARIAAVMFAGYNQHLPFRPEDGM 76

Query: 85  EFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSDQHKNPIPFI 144
             LV G+I+ +  +  YQ+ ++ + P G G L  A E+ K++L  EGLFS  HK P+P  
Sbjct: 77  NVLVRGEISVYEPNGNYQLYVKEMQPEGIGRLYLAYEQLKQRLEAEGLFSSAHKKPLPAF 136

Query: 145 PKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIANAILQLNTLKEG 203
           P+ + V+TSPTGA +RDI+  I  R+PL +VI+FP  VQG+     I  AI + N   E 
Sbjct: 137 PRCVGVVTSPTGAAVRDIMTTIRRRYPLAKVILFPALVQGEGAAPSIVRAIERANDFSE- 195

Query: 204 RTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWTLADYAADLR 263
                 D++I+ RGGGSIE+LW FN+E++ RAI  S +P+ISA+GHETD+T+AD+ ADLR
Sbjct: 196 -----VDVLIVGRGGGSIEELWAFNEEIVARAIFASRVPVISAVGHETDFTIADFVADLR 250

Query: 264 APTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKALPNSDQTLSC 323
           APTPT AAE+AVP    L   +   + RL    IR +K ++      L  L    Q    
Sbjct: 251 APTPTAAAELAVPHIGELAERIAERKWRL----IRAMKERLAANQERLARL----QASYA 302

Query: 324 SRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHILEKQQHIEQI 383
            RY   RL  + E  L                    D L+  + + R+ +++K++  +++
Sbjct: 303 FRY-PKRLYEQKEQQL--------------------DALLERLARQRERLVDKKR--QRL 339

Query: 384 VKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSHKIKSCHTSVS 443
            + HLR   L +    A L  ++E+ K     L   ++  + R  F     +        
Sbjct: 340 RELHLR---LWRHHPEAELERMKERQKATAVALEKAMRTALERHAFRFRSHVAR------ 390

Query: 444 ITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDGQANAIVIN 500
                L++ +    ++RGY+ + +  +  + +   L    R+ I   DGQ +  V+ 
Sbjct: 391 -----LEALSPLRIMERGYSLVYNERHELVKRIGQLQVGERLSIRVQDGQVDCQVMG 442


>gi|331701509|ref|YP_004398468.1| exodeoxyribonuclease 7 large subunit [Lactobacillus buchneri NRRL
           B-30929]
 gi|329128852|gb|AEB73405.1| Exodeoxyribonuclease 7 large subunit [Lactobacillus buchneri NRRL
           B-30929]
          Length = 447

 Score =  259 bits (661), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 174/492 (35%), Positives = 258/492 (52%), Gaps = 69/492 (14%)

Query: 16  SVSELSYHLKH--IVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +VS L+ ++K    V+  L+ V + GEIS +R +  + H YFSLKD+H++I AI++K   
Sbjct: 7   TVSALTKYIKRKFDVDPYLTKVYLTGEISNFR-LRPNAHQYFSLKDDHAKISAIMFKSAF 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
           N+++F+PEEG++ LV+G I+ +  S  YQI +E + P G G L  A E+ K+KL  EGLF
Sbjct: 66  NRLKFIPEEGMKVLVVGHISVYEPSGSYQIYVEQMEPDGVGQLYQAYEQLKQKLSTEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
            +  K P+   PK IAV+TSP+GAVIRDI+  +  R+P+ ++++FP  VQG E   +I  
Sbjct: 126 -NLPKQPLAKFPKRIAVVTSPSGAVIRDIITTVRRRYPIAQIVLFPALVQGTEASADIVR 184

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
            I ++N +         D +I+ RGGGSIEDLW FN+E + RAI  S IP+IS++GHETD
Sbjct: 185 QIERVNQIGNF------DTLIVGRGGGSIEDLWPFNEENVARAIVASKIPVISSVGHETD 238

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            T+AD  AD+RA TPT AAE+AVP    L   L++L    N II           N+  +
Sbjct: 239 TTIADLVADVRAATPTAAAELAVP---RLDQVLVDLRTTQNRII-----------NATYQ 284

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
            +    Q          RL R  +  +     R Y  F       + D L   +      
Sbjct: 285 VVQQDKQ----------RLKRLRQSTVFTTPQRIYETFAQ-----RLDLLTQRLYNQSDK 329

Query: 373 ILEKQQHIEQIVKQHLR-----YIFLEKKEKIAILH-MLREQTKNRIFYLHTHIKKLITR 426
           I  K++     +K  LR     Y   E+++K+A L   L   T   +  +  H + L+  
Sbjct: 330 ITGKRKDRFSDLKLRLRLVAPTYTIREEQQKLATLKGRLNRATTQNLKNVSQHYQMLVGS 389

Query: 427 IEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRIL 486
           ++ +   KI                      L RGYT   D   +FI +  +L++KT I 
Sbjct: 390 LDHLSPLKI----------------------LSRGYTYTTDEQGHFIKRVADLSSKT-ID 426

Query: 487 INFFDGQANAIV 498
           ++F DG  NA V
Sbjct: 427 VHFSDGIVNASV 438


>gi|313124104|ref|YP_004034363.1| exodeoxyribonuclease 7 large subunit [Lactobacillus delbrueckii
           subsp. bulgaricus ND02]
 gi|312280667|gb|ADQ61386.1| Exodeoxyribonuclease 7 large subunit [Lactobacillus delbrueckii
           subsp. bulgaricus ND02]
          Length = 456

 Score =  258 bits (660), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 155/491 (31%), Positives = 257/491 (52%), Gaps = 62/491 (12%)

Query: 11  DHPEYSVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAII 68
           D    +VSEL++++K   + +  L  + ++GE+S +R     GH YFSLKD+ S+I+ ++
Sbjct: 8   DEKYLTVSELNWYVKQKFDRDPYLRQIFLQGELSNFR-FRRGGHQYFSLKDDKSKINVVM 66

Query: 69  WKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLL 128
           ++G  +K++F PEEG++  V G+++T+     YQ   +S+ P+G G L     + ++KL 
Sbjct: 67  FRGDFDKVKFEPEEGMKVYVTGRLSTYEAQGSYQFYAKSMEPAGLGALYERFRQLQEKLA 126

Query: 129 EEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECP 187
           +EGLF+ +HK P+P  P  IAV+TS +GAVI DI+   + RFP   + +FP +VQG+   
Sbjct: 127 KEGLFAQEHKRPLPLFPDKIAVVTSASGAVIHDIMVTANRRFPHAEIDLFPAQVQGESAA 186

Query: 188 KEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAI 247
             + +A+ Q+            D++I+ RGGGS+EDLW FN+E +VR +    +P+IS++
Sbjct: 187 GSLVSAMQQIQA-----RADEYDVLIIGRGGGSLEDLWPFNEEEVVRQVYAMKMPVISSV 241

Query: 248 GHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTL 307
           GHETD TL D AAD RA TPT AAEMA P    + + +  L+ RL   I  +I+ +   L
Sbjct: 242 GHETDTTLCDLAADCRAATPTAAAEMATPALTLVLAEIGQLQTRLLTDIRAVIQVRAQAL 301

Query: 308 ----NSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLI 363
               NS +   P   +       ++D+L ++L   +E+I+  + +  + +  R++     
Sbjct: 302 AQLENSFIMKEPQ--RLYEQKMQQVDQLSQQLSQMMEVIVKDQGQKLSLLTQRLQ----- 354

Query: 364 HNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKL 423
           H     R         I+Q+ KQ   Y+                             K L
Sbjct: 355 HQAPDRR---------IKQL-KQENSYL----------------------------AKSL 376

Query: 424 ITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKT 483
              I+ IL  K  +C  +V    + L  ++   TL RGY+   D ++N +   + LA   
Sbjct: 377 EMGIKRILEQKQAACRQAV----QQLDDYSPLKTLARGYSYTTDASDNVVKSVQQLAPGD 432

Query: 484 RILINFFDGQA 494
           ++ ++  DGQA
Sbjct: 433 QVHLHLKDGQA 443


>gi|218289632|ref|ZP_03493852.1| exodeoxyribonuclease VII, large subunit [Alicyclobacillus
           acidocaldarius LAA1]
 gi|218240282|gb|EED07465.1| exodeoxyribonuclease VII, large subunit [Alicyclobacillus
           acidocaldarius LAA1]
          Length = 469

 Score =  258 bits (659), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 166/508 (32%), Positives = 253/508 (49%), Gaps = 59/508 (11%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLK 58
           MN  ++  +      +V+EL+  +K  +ES+  L    V GEIS ++  H SGH YF+LK
Sbjct: 1   MNALTRAAAEAEAVLTVTELNRRIKERLESDPRLIQCRVVGEISNFKH-HPSGHMYFTLK 59

Query: 59  DNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLT 118
           D  SRI A+++     +++F PE+G+  +  G +  F    +YQ+ +E L P G G L  
Sbjct: 60  DETSRIRAVMFSSRNRRLQFQPEDGMRVIAFGSVGVFERDGQYQLYVEDLEPDGLGALFV 119

Query: 119 ALEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIF 177
             E+ + KL EEGLF+ + K P+P  P  + V+TSPTGAVIRDI   I  R+PL RVI+ 
Sbjct: 120 RFEQLRHKLAEEGLFAQERKRPLPRFPLRVGVVTSPTGAVIRDICTTIERRYPLARVILA 179

Query: 178 PVKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIA 237
           P +VQG +    I  A+  L  L+     PR D+II+ RGGGS+E+LW FN+EM+VRA+A
Sbjct: 180 PAQVQGPDAAPTIVRALEVLYALE-----PRVDVIIVGRGGGSLEELWPFNEEMVVRAVA 234

Query: 238 NSSIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIII 297
            S +P++SA+GHETD TL D+AAD+RA TPT AAE+  P +  L++ L    AR     +
Sbjct: 235 RSPVPVVSAVGHETDVTLCDFAADVRAATPTAAAELVCPHQAELRAYLEQASARARKAAL 294

Query: 298 RLIKYKINTLNSLLK--ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIIN 355
             + +    L  L     L +  + ++  R  +D +   +       I  + R    +  
Sbjct: 295 VKVAWGRERLLDLAGRPVLRDPTRIIAVRRQLVDYIETRVREAQRRPIGLRRRALADLER 354

Query: 356 RIKSDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFY 415
           R++   L   IQ  R+ ++  +                         H LR  T+ ++  
Sbjct: 355 RLQRVQLGGAIQGRRRDLMRLE-------------------------HQLRSLTERQLLV 389

Query: 416 LHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNN-NFIT 474
               ++ +I ++E                    L   A    L+RGY  I D +  + IT
Sbjct: 390 QSRKLEGVIGKLE-------------------ALNPLA---VLRRGYGVILDEDGRSVIT 427

Query: 475 QKRNLATKTRILINFFDGQANAIVINKA 502
             ++LA   RI I   DG   A V  + 
Sbjct: 428 SAQSLAPGKRIGIRMHDGTVEAEVKGRG 455


>gi|325685898|gb|EGD27964.1| exodeoxyribonuclease VII large subunit [Lactobacillus delbrueckii
           subsp. lactis DSM 20072]
          Length = 456

 Score =  258 bits (659), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 154/493 (31%), Positives = 256/493 (51%), Gaps = 62/493 (12%)

Query: 9   SLDHPEYSVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDA 66
            +D    +VSEL++++K   + +  L  + ++GE+S +R     GH YFSLKD+ S+I+ 
Sbjct: 6   GMDEKYLTVSELNWYVKQKFDQDPYLRQIFLQGELSNFR-FRRGGHQYFSLKDDKSKINV 64

Query: 67  IIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKK 126
           ++++G  +K++F PEEG++  V G+++T+     YQ   +S+ P+G G L     + ++K
Sbjct: 65  VMFRGDFDKVKFEPEEGMKVYVTGRLSTYEAQGSYQFYAKSMEPAGLGALYERFRQLQEK 124

Query: 127 LLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDE 185
           L +EGLF+ +HK P+P  P  IAV+TS +GAVI DI+   + RFP   + +FP +VQG+ 
Sbjct: 125 LAKEGLFAQEHKRPLPLFPDKIAVVTSASGAVIHDIMVTANRRFPHAEIDLFPAQVQGES 184

Query: 186 CPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIIS 245
               + +A+ Q+            D++I+ RGGGS+EDLW FN+E +VR +    +P+IS
Sbjct: 185 AAGSLVSAMQQIQA-----RADEYDVLIIGRGGGSLEDLWPFNEEEVVRQVYAMKMPVIS 239

Query: 246 AIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKIN 305
           ++GHETD TL D  AD RA TPT AAEMA P    + + +  L+ RL   I  +I+ +  
Sbjct: 240 SVGHETDTTLCDLVADCRAATPTAAAEMATPALTLVLAEIGQLQTRLLTDIRAVIQVRAQ 299

Query: 306 TL----NSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            L    NS +   P   +       ++D+L ++L   +E+I+  + +  + +  R++   
Sbjct: 300 ALAQLENSFIMKEPQ--RLYEQKMQQVDQLSQQLSQMMEVIVKDQGQKLSLLTQRLQ--- 354

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIK 421
             H     R         I+Q+ KQ   Y+                             K
Sbjct: 355 --HQAPDRR---------IKQL-KQENSYL----------------------------AK 374

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLAT 481
            L   I+ IL  K  +C  +V    + L  ++   TL RGY+   D + N +   + LA 
Sbjct: 375 SLEMGIKRILEQKQAACRQAV----QQLDDYSPLKTLARGYSYTTDASGNVVKSVQQLAP 430

Query: 482 KTRILINFFDGQA 494
             ++ ++  DGQA
Sbjct: 431 GDQVRLHLKDGQA 443


>gi|15615346|ref|NP_243649.1| exodeoxyribonuclease VII large subunit [Bacillus halodurans C-125]
 gi|14194728|sp|Q9K967|EX7L_BACHD RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|10175404|dbj|BAB06502.1| exodeoxyribonuclease VII (large subunit) [Bacillus halodurans
           C-125]
          Length = 458

 Score =  258 bits (659), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 134/305 (43%), Positives = 195/305 (63%), Gaps = 10/305 (3%)

Query: 12  HPEYSVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIW 69
            P  +VSE++ HLK  +E +  L  V +RGEIS ++  HS GH YF+LKD H+++ A+++
Sbjct: 5   QPILTVSEVTRHLKRTIEDDPLLQDVWMRGEISNFKH-HSRGHMYFTLKDEHAKMSAVMF 63

Query: 70  KGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLE 129
            G    + F PE G++ +V G++  +    +YQ+    + P G G L  A E+ K++L +
Sbjct: 64  AGNNRFLNFKPENGMKVIVRGEVNVYEPFGQYQLYALEMQPDGIGNLYLAYEQLKERLEQ 123

Query: 130 EGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPK 188
           EGLF +++K P+P + + IA++TSPTGA IRDI   I  RFP+ ++ + PV VQG+E P 
Sbjct: 124 EGLFKEENKKPLPPVARQIAIVTSPTGAAIRDIASTIKRRFPVAQLTLLPVLVQGEEAPH 183

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
            IA AI Q N +         D++I+ RGGGSIE+LW FN+E++ RAI  S IPIISA+G
Sbjct: 184 SIAKAIRQANEVGGF------DLLIVGRGGGSIEELWAFNEELVARAIYQSVIPIISAVG 237

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HETD+T+AD+ AD+RA TPTGAAE+AVP  + L S +     RL      L+K +   L 
Sbjct: 238 HETDYTIADFVADVRAATPTGAAELAVPDLKELISRVNQYTERLKRAQHELLKRQKEHLQ 297

Query: 309 SLLKA 313
            L K+
Sbjct: 298 RLQKS 302


>gi|78223055|ref|YP_384802.1| exodeoxyribonuclease VII large subunit [Geobacter metallireducens
           GS-15]
 gi|123571798|sp|Q39UJ7|EX7L_GEOMG RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|78194310|gb|ABB32077.1| Exodeoxyribonuclease VII large subunit [Geobacter metallireducens
           GS-15]
          Length = 453

 Score =  258 bits (659), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 170/496 (34%), Positives = 261/496 (52%), Gaps = 61/496 (12%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M  F +K  L     +VS+L+  ++ ++E N  HV V GE+S    + +SGH YF+LKD 
Sbjct: 1   MELFPEKRIL-----TVSQLTSLIRGVLEENFEHVWVEGEVSNL-AMPASGHLYFTLKDA 54

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            ++I  ++++ +   ++F P +G+  +V G+IT +     YQ ++E L P G G L  A 
Sbjct: 55  GAQIRCVMFRASARALKFRPRDGMGLIVRGRITVYEQRGDYQFLVEYLEPRGVGALQLAF 114

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPV 179
            + K+KL +EGLF+++HK PIP +P+ I V+TS TGA I DIL  ++ RF  + V+I PV
Sbjct: 115 IQLKEKLAKEGLFAEEHKRPIPSLPQRIGVVTSATGAAIHDILNVLNRRFANVEVLIRPV 174

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
           KVQG+    EIA AI+  N  + G      D++I+ RGGGS+EDLW FN+E + RA+  S
Sbjct: 175 KVQGEGAADEIAEAIIDFN--RYGAV----DVMIVGRGGGSLEDLWAFNEEKVARAVHRS 228

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
            IPIISA+GHE D+T+AD+ ADLRAPTP+ AAE+ V  KE L S +  L  RL   + R+
Sbjct: 229 RIPIISAVGHEIDFTIADFVADLRAPTPSAAAELVVKSKEELASKVEFLRHRLIQTLRRI 288

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
           +      L SL +AL +    L     RLD +                  F  +   I  
Sbjct: 289 LADAGGELESLSRALRDPTVLLGHLSQRLDDI------------------FVRLERAIAG 330

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH 419
           D       K+R  +LE        +K HLR     +   + +     E+ + R+  L   
Sbjct: 331 DL------KDRGRMLEA-------LKNHLRL----RNPALKV-----ERARERVIALS-- 366

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYT-SIQDTNNNFITQKRN 478
                 + E  L   +     + ++ +  L++ +   TL RGY+ +++      +   R 
Sbjct: 367 -----DKSEIALLRHVDRYREAAAVHSARLETLSPLGTLARGYSVALKLPERVPVKTFRQ 421

Query: 479 LATKTRILINFFDGQA 494
           LA K R+ + F  G+A
Sbjct: 422 LALKDRLELLFHHGRA 437


>gi|300811682|ref|ZP_07092158.1| exodeoxyribonuclease VII, large subunit [Lactobacillus delbrueckii
           subsp. bulgaricus PB2003/044-T3-4]
 gi|300497383|gb|EFK32429.1| exodeoxyribonuclease VII, large subunit [Lactobacillus delbrueckii
           subsp. bulgaricus PB2003/044-T3-4]
          Length = 456

 Score =  258 bits (658), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 156/493 (31%), Positives = 258/493 (52%), Gaps = 66/493 (13%)

Query: 11  DHPEYSVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAII 68
           D    +VSEL++++K   + +  L  + ++GE+S +R     GH YFSLKD+ S+I+ ++
Sbjct: 8   DEKYLTVSELNWYVKQKFDRDPYLRQIFLQGELSNFR-FRRGGHQYFSLKDDKSKINVVM 66

Query: 69  WKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLL 128
           ++G  +K++F PEEG++  V G+++T+     YQ   +S+ P+G G L     + ++KL 
Sbjct: 67  FRGDFDKVKFEPEEGMKVYVTGRLSTYEAQGSYQFYAKSMEPAGLGALYERFRQLQEKLA 126

Query: 129 EEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECP 187
           +EGLF+ +HK P+P  P  IAV+TS +GAVI DI+   + RFP   + +FP +VQG+   
Sbjct: 127 KEGLFAQEHKRPLPLFPDKIAVVTSASGAVIHDIMVTANRRFPHAEIDLFPAQVQGESAA 186

Query: 188 KEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAI 247
             + +A+ Q+            D++I+ RGGGS+EDLW FN+E +VR +    +P+IS++
Sbjct: 187 GSLVSAMQQIQA-----RADEYDVLIIGRGGGSLEDLWPFNEEEVVRQVYAMKMPVISSV 241

Query: 248 GHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTL 307
           GHETD TL D AAD RA TPT AAEMA P    + + +  L+ RL   I  +I+ +   L
Sbjct: 242 GHETDTTLCDLAADCRAATPTAAAEMATPALTLVLAEIGQLQTRLLTDIRAVIQVRAQAL 301

Query: 308 ----NSLLKALPNS--DQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
               NS +   P    +Q +     ++D+L ++L   +E+I+  + +  + +  R++   
Sbjct: 302 AQLENSFIMKEPQRLYEQKMQ----QVDQLSQQLSRMMEVIVKDQGQKLSILTQRLQ--- 354

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIK 421
             H     R         I+Q+ KQ   Y+                             K
Sbjct: 355 --HQAPDRR---------IKQL-KQENSYL----------------------------AK 374

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLAT 481
            L   I+ IL  K  +C  +V    + L  ++   TL RGY+   D + N +   + LA 
Sbjct: 375 SLEMGIKRILEQKQAACRQAV----QQLDDYSPLKTLARGYSYTTDASGNVVKSVQQLAP 430

Query: 482 KTRILINFFDGQA 494
             ++ ++  DGQA
Sbjct: 431 GDQVRLHLKDGQA 443


>gi|46446255|ref|YP_007620.1| putative exodeoxyribonuclease VII, large chain [Candidatus
           Protochlamydia amoebophila UWE25]
 gi|46399896|emb|CAF23345.1| putative exodeoxyribonuclease VII, large chain [Candidatus
           Protochlamydia amoebophila UWE25]
          Length = 482

 Score =  258 bits (658), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 183/511 (35%), Positives = 272/511 (53%), Gaps = 69/511 (13%)

Query: 28  VESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNKIEFLPEEGIEFL 87
           +ES    + ++GEIS ++   SSGH YFSLKD  ++I A+++K   + ++  P+ G   +
Sbjct: 9   LESMFPFIYLQGEISNFKE-QSSGHFYFSLKDATAQISAVMFKAEASLLKTPPKGGDHVM 67

Query: 88  VIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSDQHKNPIPFIPKI 147
           + G+I+ +P    YQ+II  L   G G LL  LE+ K KL ++G F   HK PIP  PK 
Sbjct: 68  IKGEISVYPPKGNYQLIIRELSYVGIGELLQKLEQLKIKLHQKGWFKAIHKKPIPRFPKK 127

Query: 148 IAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANAILQLNTLKEGRTC 206
           I VITSPTGAVI+DILQ ++ RF    +I+ PVKVQG+   KEIA AI Q N  +     
Sbjct: 128 IGVITSPTGAVIQDILQILTRRFSGFHLILNPVKVQGEGAAKEIARAIEQFNRYQ----- 182

Query: 207 PRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWTLADYAADLRAPT 266
              D++I+ RGGGS+EDLW FN+E++  AI NS IPIISA+GHETD  +ADY AD+RAPT
Sbjct: 183 -LVDVLIVGRGGGSLEDLWPFNEEIVAEAIYNSQIPIISAVGHETDHCIADYVADIRAPT 241

Query: 267 PTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK-----------------------YK 303
           P+ AAE+ +  K      L  L  R+   I  LI+                       ++
Sbjct: 242 PSAAAEIVISEKNQQLEHLKTLRRRIQQAIQNLIQSGHYRLKGFSKHLFITHPHVITEWR 301

Query: 304 INTLNSLLKALPNS-DQTLSCSRYRLDRLPRE---LEHNLEIIIFRKY-RHFNHIINRIK 358
           +  L+ L + L N   Q ++  +++L+   R+   L+ + +II  RK+ R +N I +R  
Sbjct: 302 MQKLDDLKEDLSNQLKQIITFKKHQLESFARQTQLLKPSNQIIHLRKHLRDWNGIFSRKM 361

Query: 359 SDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHT 418
            D L+ N +K  Q     +Q    ++ Q  +Y+F  K  +I    ++R++          
Sbjct: 362 QDLLLQNKKKIEQIEYRLKQQWTYLIGQK-KYLFKGKDYRIKNNQLIRDR---------- 410

Query: 419 HIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQ--- 475
                      ILS K K  H      T IL++   KN LK+GY+ +      F+     
Sbjct: 411 -----------ILSSKQKILH-----ITNILKAVDPKNLLKQGYSILFAEKEVFVINSIC 454

Query: 476 KRNLATKTRILINFFDGQANAIVINKAPPKE 506
           K     K ++L++  DG+A  I IN+  P+E
Sbjct: 455 KLKKGQKAKLLLS--DGEA-LITINEVNPRE 482


>gi|299537765|ref|ZP_07051054.1| exodeoxyribonuclease 7 large subunit [Lysinibacillus fusiformis
           ZC1]
 gi|298726744|gb|EFI67330.1| exodeoxyribonuclease 7 large subunit [Lysinibacillus fusiformis
           ZC1]
          Length = 452

 Score =  258 bits (658), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 167/498 (33%), Positives = 262/498 (52%), Gaps = 64/498 (12%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V  L+ ++K   +++  L  V V+GE+S  + IH SGH YF+LKD+ +RI A ++K   
Sbjct: 8   TVKALTKYIKRKFDADPHLREVYVKGELSNVK-IHQSGHIYFTLKDDGARIAATMFKTAA 66

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            K+ F P+EG++  + G +  + G   YQ+ ++ + P G G+L  A  + K++L +EGLF
Sbjct: 67  TKLAFEPKEGMQVFIRGDVNVYEGYGTYQLYVQEMQPDGIGSLFVAFNQLKEQLQKEGLF 126

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
             + K PIP  P+ I V+TS TGA IRDI   +  R+PL  ++I+P  VQG +    I  
Sbjct: 127 KPEWKQPIPKFPEKIGVLTSTTGAAIRDICTTLKRRYPLAEILIYPTLVQGAQAAPNIVQ 186

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
            I + N  +EG +C   D++I+ RGGGSIEDLW FN+E++ RAI  S IPIISA+GHETD
Sbjct: 187 NIQRAN--QEG-SC---DVLIVGRGGGSIEDLWAFNEEIVARAIFESRIPIISAVGHETD 240

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            T+ADY ADLRAPTPT AAEMAVP +  L   ++  +++L+ ++   +  +   LN L +
Sbjct: 241 TTIADYVADLRAPTPTAAAEMAVPDQADLYQRVLTQKSQLHQMVRSQLMAERQRLNKLQQ 300

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
           + P S             +P  L           YR F   + +++S      +Q   Q 
Sbjct: 301 SYPLS-------------MPERL-----------YRPFTERLAQLES-----GLQAAMQM 331

Query: 373 ILEKQ----QHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIE 428
            L K+    Q +   V+QH          K A+    RE        L   I++L     
Sbjct: 332 SLMKKATQLQQLHSTVEQH--------SPKKALAFHQRE--------LEARIQQLSRATT 375

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
           + ++ + +   ++V    R L++    + L RG+T +   +   I     +  + ++ + 
Sbjct: 376 YYVAKQQQQFESTV----RTLEALNPLSILTRGFT-VAYKDQQMIKSSTEVQKQDQLTLT 430

Query: 489 FFDGQANAIVINKAPPKE 506
           F DG+  A V N  P  E
Sbjct: 431 FHDGKVVAKVTNILPKNE 448


>gi|149181860|ref|ZP_01860349.1| exodeoxyribonuclease VII large subunit [Bacillus sp. SG-1]
 gi|148850399|gb|EDL64560.1| exodeoxyribonuclease VII large subunit [Bacillus sp. SG-1]
          Length = 449

 Score =  258 bits (658), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 163/492 (33%), Positives = 272/492 (55%), Gaps = 64/492 (13%)

Query: 10  LDHPEY-SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDA 66
           ++ P+Y ++  L+ ++K   + +  LS + ++GEIS ++  HSSGH YF+LKD  +RI A
Sbjct: 1   METPQYLTIQALTKYIKRKFDKDPHLSGIYLKGEISNFKR-HSSGHMYFTLKDEKARILA 59

Query: 67  IIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKK 126
           +++      ++F PE G++ LV G I+ +    +YQI ++ + P G G L  A ++ K+K
Sbjct: 60  VMFSSANASMKFNPENGMKVLVRGDISVYEAGGQYQIYVKEMQPDGIGDLFLAYQQLKEK 119

Query: 127 LLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDE 185
           L ++GLF+D  K P+P  P+ I VITSPTGA +RDI+  I  R+P+  ++++P  VQG+ 
Sbjct: 120 LEKQGLFNDGRKRPLPKFPRKIGVITSPTGAAVRDIITTIERRYPIAEILVYPALVQGER 179

Query: 186 CPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIIS 245
             K +A+ I + N  K        D++I+ RGGGSIE+LW FN+E +  AI+ SSIP+IS
Sbjct: 180 ASKSVADCIKKANDNKG------IDVLIVGRGGGSIEELWAFNEERVALAISESSIPVIS 233

Query: 246 AIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKIN 305
           A+GHETD+T+AD+AAD+RAPTPT AAE+AVP   H+   L  + +R   ++IR +K ++N
Sbjct: 234 AVGHETDFTIADFAADMRAPTPTAAAELAVP---HIDDLLERVLSR-KVMLIRGMKARLN 289

Query: 306 TLNSLLKALPNSDQTLSCSRYRLDRLPREL-EHNLEII--IFRKYRHFNHIINRIKSDFL 362
           T  S LK++ +S          + R PR L E  +E +  +  K     H+  + + D L
Sbjct: 290 TEKSRLKSVSSSI---------VFRNPRRLYEQKIEAVDRLTEKLNRTQHLRMQTQRDKL 340

Query: 363 IH-NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIK 421
            H N    R H     +  EQ  +++LR   +EK  ++  L++L+++             
Sbjct: 341 AHLNSSLRRVH---PGRLWEQKNEEYLR---MEKHLQVQFLNILKQK------------- 381

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLAT 481
                             +  S T   L++ +    + RGY+ +   +   +  K  +  
Sbjct: 382 -----------------QSDFSKTISTLEALSPLKVMDRGYSLVYSQDEKLVKTKEVVKE 424

Query: 482 KTRILINFFDGQ 493
             ++ ++  DG+
Sbjct: 425 GEKVTVHLQDGK 436


>gi|29840072|ref|NP_829178.1| exodeoxyribonuclease VII large subunit [Chlamydophila caviae GPIC]
 gi|33301063|sp|Q823U8|EX7L_CHLCV RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|29834420|gb|AAP05056.1| exodeoxyribonuclease, large subunit [Chlamydophila caviae GPIC]
          Length = 555

 Score =  257 bits (657), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 181/553 (32%), Positives = 280/553 (50%), Gaps = 77/553 (13%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           P  +V+ L+  +K+++ESN  H+ V+GE+S    +  SGH YF +KDN S ++   +   
Sbjct: 6   PPQAVTTLTESIKNLLESNFCHIVVKGELSNV-SLQPSGHLYFGIKDNRSFLNGAFFHFK 64

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
               +  P++G   ++ GK+T +    +YQII  +L+ +G G LL   E+ KK+L  EG 
Sbjct: 65  SKYFDRRPKDGDSVVIHGKLTVYAPRGQYQIIAHALVYAGEGDLLQKFEETKKRLAAEGY 124

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCR-FPLRVIIFPVKVQGDECPKEIA 191
           F+ + K  +P IPK I VITSPTGAVI+DIL+ +S R +  +++I+PV VQG    KEI+
Sbjct: 125 FAIEKKQALPTIPKSIGVITSPTGAVIQDILRVLSRRCYQYKLLIYPVTVQGATAAKEIS 184

Query: 192 NAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHET 251
            AI ++N  KE       D++ILARGGGSIEDLW FN+E+IV+AIA SSIPIISA+GHET
Sbjct: 185 RAIEEMN--KENLA----DVLILARGGGSIEDLWAFNEEIIVKAIAASSIPIISAVGHET 238

Query: 252 DWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLL 311
           D+TL D+AAD+RAPTP+ AAE+     E     L +    LN    +L+  K   +    
Sbjct: 239 DYTLCDFAADVRAPTPSAAAEIVCQSSEQQIQVLKSYLRYLNAHAQQLLSGKTKQIQQWK 298

Query: 312 KALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFL------IHN 365
           + L + D     +   LD L   +E +++I + +  + +      ++SD L      +++
Sbjct: 299 RYLDHVD-FFRPAHQSLDYLCLSIERSIKIKLSQYKQRYMQYARWLQSDVLQRMTYRLYD 357

Query: 366 IQKNRQHILEKQQHIEQIVKQHL------RYIFLEKKEKIAILHMLREQT----KNRIFY 415
           + K    ++ +  H   I  +HL         FL  ++ I  L + ++QT    + R+ Y
Sbjct: 358 LWK----MIVQAFHNRLIAAKHLCIHQKKNLTFLNTQQFIQKLDLWKQQTRRALRQRLGY 413

Query: 416 L-------HTHIKKLITRIE---------------------------------------- 428
                    T +K  IT++                                         
Sbjct: 414 CSQSLTHQQTSLKHFITKLNQQFTKENHALSLLQKRLTRTFANRVDEHRESYMRSRENLI 473

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNF-ITQKRNLATKTRILI 487
           F L H +K      S  ++ L     KN  KRGY  + D N NF I   ++L   + + +
Sbjct: 474 FSLHHLVKRNREKYSQVSKQLTLLNPKNVFKRGYAMLFDFNENFAIISAKSLHKHSCVRV 533

Query: 488 NFFDGQANAIVIN 500
              DG+A   V +
Sbjct: 534 RLQDGEATLTVTD 546


>gi|270290383|ref|ZP_06196608.1| exodeoxyribonuclease VII, large subunit [Pediococcus acidilactici
           7_4]
 gi|304384738|ref|ZP_07367084.1| exodeoxyribonuclease VII large subunit [Pediococcus acidilactici
           DSM 20284]
 gi|270281164|gb|EFA26997.1| exodeoxyribonuclease VII, large subunit [Pediococcus acidilactici
           7_4]
 gi|304328932|gb|EFL96152.1| exodeoxyribonuclease VII large subunit [Pediococcus acidilactici
           DSM 20284]
          Length = 447

 Score =  257 bits (656), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 169/490 (34%), Positives = 259/490 (52%), Gaps = 65/490 (13%)

Query: 16  SVSELSYHLKH--IVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +VS L+ ++K    V+  L  V V GEIS +R +  +GH YFS+KD  ++I+ I++K   
Sbjct: 8   TVSALTQYIKRKFDVDPYLHRVYVVGEISNFR-LRVNGHQYFSIKDEQAKINVIMFKSAF 66

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            K++F PEEG+  +V G+I+ +PG+  YQ+ ++S+ P G G L  A E+ K KL +EGLF
Sbjct: 67  AKVKFQPEEGMRVIVSGRISVYPGNGSYQLYVDSMQPDGVGALYQAYEQLKAKLDKEGLF 126

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
               K  IP  PK IAV+TS +GAVIRDI+  +  R+P+ ++++FPV VQG+E    IA 
Sbjct: 127 K-APKQAIPRFPKKIAVVTSRSGAVIRDIITTVKRRYPIVQLVLFPVAVQGNEAAPNIAA 185

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
            I  +NTL      P  D IIL RGGGSIEDLW FN+E++ RAI  S IP IS++GHETD
Sbjct: 186 QIKFINTL------PDFDTIILGRGGGSIEDLWPFNEEVVARAIFESRIPTISSVGHETD 239

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            T+AD  AD+RA TPT AAE+A PV   + + L   E R+ N    ++K K         
Sbjct: 240 TTIADLVADVRAATPTAAAELATPVLTDVLTDLQKTELRVINAFKNILKIK--------- 290

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIF----RKYRHFNHIINRIKSDFLIHNIQK 368
                            +  R+LE++    IF    R Y  +   ++++     + N QK
Sbjct: 291 ----------------QQQARQLENSY---IFQEPQRLYEGYVQNVDQLTER--LRNAQK 329

Query: 369 NRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIE 428
             Q++ ++     ++VK   R +    + ++ +          ++ YL   +  +ITR  
Sbjct: 330 --QYLADRS---AELVKLQHRLLVNNPQNQVDL-------ATQKVGYLREQLLSVITR-- 375

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
                +     T +      L + +    + RGYT +   +   +     L+    I +N
Sbjct: 376 -----RFTQSQTQMQKLVAALDNLSPLRIMSRGYTYVT-KDEQVVNSVEKLSVNDAIKLN 429

Query: 489 FFDGQANAIV 498
           F DG A+AI+
Sbjct: 430 FSDGSADAII 439


>gi|116514373|ref|YP_813279.1| exodeoxyribonuclease VII large subunit [Lactobacillus delbrueckii
           subsp. bulgaricus ATCC BAA-365]
 gi|122274895|sp|Q049N1|EX7L_LACDB RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|116093688|gb|ABJ58841.1| Exodeoxyribonuclease VII large subunit [Lactobacillus delbrueckii
           subsp. bulgaricus ATCC BAA-365]
          Length = 456

 Score =  257 bits (656), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 156/493 (31%), Positives = 257/493 (52%), Gaps = 66/493 (13%)

Query: 11  DHPEYSVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAII 68
           D    +VSEL++++K   + +  L  + ++GE+S +R     GH YFSLKD+ S+I+ ++
Sbjct: 8   DEKYLTVSELNWYVKQKFDRDPYLRQIFLQGELSNFR-FRRGGHQYFSLKDDKSKINVVM 66

Query: 69  WKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLL 128
           ++G  +K++F PEEG++  V G+++T+     YQ   +S+ PSG G L     + ++KL 
Sbjct: 67  FRGDFDKVKFEPEEGMKVYVTGRLSTYEAQGSYQFYAKSMEPSGLGALYERFRQLQEKLA 126

Query: 129 EEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECP 187
           +EGLF+ +HK P+P  P  IAV+TS +GAVI DI+   + RFP   + +FP +VQG+   
Sbjct: 127 KEGLFAQEHKRPLPLFPDKIAVVTSASGAVIHDIMVTANRRFPHAEIDLFPAQVQGESAA 186

Query: 188 KEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAI 247
             + +A+ Q+            D++I+ RGGGS+EDLW FN+E +VR +    +P+IS++
Sbjct: 187 GSLVSAMQQIQA-----RADEYDVLIIGRGGGSLEDLWPFNEEEVVRQVYAMKMPVISSV 241

Query: 248 GHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTL 307
           GHETD TL D AAD RA TPT AAEMA P    + + +  L+ RL   I  +I+ +   L
Sbjct: 242 GHETDTTLCDLAADCRAATPTAAAEMATPALPLVLAEIGQLQTRLLTDIRAVIQVRAQAL 301

Query: 308 ----NSLLKALPNS--DQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
               NS +   P    +Q +     ++D+L ++L   +E+I+  + +  + +  R++   
Sbjct: 302 AQLENSFIMKEPQRLYEQKMQ----QVDQLSQQLSRMMEVIVKDQGQKLSLLTQRLQ--- 354

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIK 421
             H     R         I+Q+ KQ   Y+                             K
Sbjct: 355 --HQAPDRR---------IKQL-KQENSYL----------------------------AK 374

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLAT 481
            L   I+ IL  K  +C  +V    + L  ++   TL RGY+   D + N +   + L  
Sbjct: 375 SLEMGIKRILEQKQAACRQAV----QQLDDYSPLKTLARGYSYTTDASGNVVKSVQQLVP 430

Query: 482 KTRILINFFDGQA 494
             ++ ++  DGQA
Sbjct: 431 GDQVRLHLKDGQA 443


>gi|116333614|ref|YP_795141.1| exodeoxyribonuclease VII large subunit [Lactobacillus brevis ATCC
           367]
 gi|116098961|gb|ABJ64110.1| Exodeoxyribonuclease VII large subunit [Lactobacillus brevis ATCC
           367]
          Length = 451

 Score =  257 bits (656), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 150/392 (38%), Positives = 225/392 (57%), Gaps = 34/392 (8%)

Query: 16  SVSELSYHLKH--IVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ +LK    V+  L  V + GEIS +R +    H YFSLKD+H++I AI++K   
Sbjct: 8   TVTALTQYLKRKFDVDPYLGKVYLTGEISNFR-LRPHAHQYFSLKDDHAKISAIMFKSAF 66

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            K++F PE G++ LV G+I+ +  S  YQI +E + P G G L  A E+ K+KL  EGLF
Sbjct: 67  EKLKFTPETGMKVLVTGRISLYEPSGSYQIYVERMEPDGVGQLYQAYEQLKRKLAAEGLF 126

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
           +   K P+   PK IAV+TSP+GAVIRDI+     RFP+ +++++P  VQGD    +I  
Sbjct: 127 T-APKRPLSRFPKRIAVVTSPSGAVIRDIITTTRRRFPIAQIVLYPAVVQGDAAADDIVR 185

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
            I + N  +        D +I+ RGGGSIEDLW FN+E + RAIA S +P+IS++GHETD
Sbjct: 186 QIQRANAAQSF------DTLIIGRGGGSIEDLWPFNEERVARAIAASQLPVISSVGHETD 239

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLE---ARLNNIIIRLIKYKINTLNS 309
            T+AD  AD+RA TPT AAE+AVPV   L   L+ L+    RL N +   I ++   LN 
Sbjct: 240 TTIADLVADVRAATPTAAAELAVPV---LSDELLKLQQQRTRLLNAMANRINFQQERLNK 296

Query: 310 LLKA--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQ 367
           L+ A       +       RLDR  + L  N++ ++ ++ + F      + S   +  +Q
Sbjct: 297 LMTAYVFRQPQRLYETYVQRLDRAQQALGRNMQDLVTQRQQQFQLAQQALASRSPLARVQ 356

Query: 368 KN---------------RQHILEKQQHIEQIV 384
           +N               R+++  KQ+H+ Q++
Sbjct: 357 RNQLVVQQTATRLATEARRYVTAKQEHVGQLI 388


>gi|89895099|ref|YP_518586.1| hypothetical protein DSY2353 [Desulfitobacterium hafniense Y51]
 gi|122482497|sp|Q24V00|EX7L_DESHY RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|89334547|dbj|BAE84142.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 406

 Score =  256 bits (655), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 139/330 (42%), Positives = 201/330 (60%), Gaps = 11/330 (3%)

Query: 15  YSVSELSYHLKHIVESNLSHV--CVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           ++V+EL+  +   +  N   V   V GEIS Y+    SGH YF+LKD  S +  ++++  
Sbjct: 8   WTVAELTREIGQTLNDNPDFVNCWVSGEISNYKNHRPSGHWYFTLKDEQSSMKGVMFRSR 67

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
             ++ F P++G++ LV G I  +      Q+  E + PSG G L  A E+ K++L +EGL
Sbjct: 68  AERVRFTPQDGMKVLVRGSIRIYERDGTIQLYAEEMQPSGVGALYLAFEQLKERLGQEGL 127

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIA 191
           F+ + K  IP  P+ I ++TSPTGA I+DIL+ +  R P +  I+ P  VQG+  PKE+A
Sbjct: 128 FAPERKKAIPRYPRRIGIVTSPTGAAIKDILKVMFRRNPQISWILAPAAVQGELAPKEVA 187

Query: 192 NAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHET 251
            AI +LN   +       D+II+ RGGGS+E+LW FN E + RAIA S IP+ISA+GHET
Sbjct: 188 QAIARLNRHSQ------VDVIIVGRGGGSLEELWAFNTEEVARAIAASGIPVISAVGHET 241

Query: 252 DWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSL- 310
           D T+AD  ADLRAPTP+ AAE+AVPV   L+S L  LEARL++ +   ++ K   L+SL 
Sbjct: 242 DVTIADMVADLRAPTPSAAAELAVPVWRELKSDLEQLEARLHSTMSSQLQRKRQRLDSLK 301

Query: 311 -LKALPNSDQTLSCSRYRLDRLPRELEHNL 339
            +  L N    +  +R RLD L   +E  +
Sbjct: 302 TIGPLSNPFWRIDQNRQRLDSLSERVEQGM 331


>gi|83647623|ref|YP_436058.1| exodeoxyribonuclease VII large subunit [Hahella chejuensis KCTC
           2396]
 gi|123531576|sp|Q2SCJ1|EX7L_HAHCH RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|83635666|gb|ABC31633.1| exodeoxyribonuclease VII, large subunit [Hahella chejuensis KCTC
           2396]
          Length = 444

 Score =  256 bits (654), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 161/489 (32%), Positives = 251/489 (51%), Gaps = 55/489 (11%)

Query: 12  HPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKG 71
           H  +SV+EL+  ++ ++E +   V V GEIS +    SSGH YFSLKD+ +++   +++ 
Sbjct: 7   HSPFSVTELNRQVRRLLEVSFMQVWVTGEISNF-SCPSSGHWYFSLKDDKAQVRCAMFRN 65

Query: 72  TLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEG 131
               ++  P +G    +  K++ + G  ++Q+I ES+  +G G L  A E+ K KL  EG
Sbjct: 66  RNMFVKQRPRDGEAVTLRAKVSLYEGRGEFQLIAESMELAGEGELRRAFEELKLKLSREG 125

Query: 132 LFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEI 190
           LF +  K P+P +PK + VITSPTGA +RDIL  +  RFP + V++FPV VQG E    I
Sbjct: 126 LFEESRKRPLPAMPKQVGVITSPTGAAVRDILTVLERRFPAIPVLLFPVPVQGKEAGPAI 185

Query: 191 ANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHE 250
             AI   N L     C   D++I+ RGGGS+EDLW FN+E + RAIA S+IP++SA+GHE
Sbjct: 186 VAAIASANRLN---CC---DVLIVGRGGGSLEDLWAFNEEPVARAIAASAIPVVSAVGHE 239

Query: 251 TDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSL 310
           TD T+AD  ADLRAPTP+ AAE   P +   +   +  E RL+    RL++ +   LN L
Sbjct: 240 TDITIADLVADLRAPTPSAAAEKVSPDQAEWKHRFLIYEQRLDAAAQRLLRQEGLRLNQL 299

Query: 311 LKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNR 370
              L +  + L  S  RLD L   L    + ++  +     H+ +R+ +     ++ KNR
Sbjct: 300 RGRLKHPGRRLQESAQRLDDLEVRLHRQAQNLLSVRRNQLTHLRDRLLASSPRQSL-KNR 358

Query: 371 QHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFI 430
              ++   H                + + A+L +LR +++        H  KL   +E +
Sbjct: 359 YATVDALNH----------------RLQTAVLSVLRHKSQ--------HFAKLCGHMEAV 394

Query: 431 LSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFF 490
                                 +   TL RGY  + D N   I  ++ + T  ++     
Sbjct: 395 ----------------------SPIATLARGYAIVSDENGQIIRSEKEVRTGQKVKARLS 432

Query: 491 DGQANAIVI 499
           DG+ +  V+
Sbjct: 433 DGEIHCEVV 441


>gi|219669512|ref|YP_002459947.1| exodeoxyribonuclease VII large subunit [Desulfitobacterium
           hafniense DCB-2]
 gi|219539772|gb|ACL21511.1| exodeoxyribonuclease VII, large subunit [Desulfitobacterium
           hafniense DCB-2]
          Length = 403

 Score =  256 bits (654), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 139/330 (42%), Positives = 201/330 (60%), Gaps = 11/330 (3%)

Query: 15  YSVSELSYHLKHIVESNLSHV--CVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           ++V+EL+  +   +  N   V   V GEIS Y+    SGH YF+LKD  S +  ++++  
Sbjct: 5   WTVAELTREIGQTLNDNPDFVNCWVSGEISNYKNHRPSGHWYFTLKDEQSSMKGVMFRSR 64

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
             ++ F P++G++ LV G I  +      Q+  E + PSG G L  A E+ K++L +EGL
Sbjct: 65  AERVRFTPQDGMKVLVRGSIRIYERDGTIQLYAEEMQPSGVGALYLAFEQLKERLGQEGL 124

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIA 191
           F+ + K  IP  P+ I ++TSPTGA I+DIL+ +  R P +  I+ P  VQG+  PKE+A
Sbjct: 125 FAPERKKAIPRYPRRIGIVTSPTGAAIKDILKVMFRRNPQISWILAPAAVQGELAPKEVA 184

Query: 192 NAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHET 251
            AI +LN   +       D+II+ RGGGS+E+LW FN E + RAIA S IP+ISA+GHET
Sbjct: 185 QAIARLNRHSQ------VDVIIVGRGGGSLEELWAFNTEEVARAIAASGIPVISAVGHET 238

Query: 252 DWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSL- 310
           D T+AD  ADLRAPTP+ AAE+AVPV   L+S L  LEARL++ +   ++ K   L+SL 
Sbjct: 239 DVTIADMVADLRAPTPSAAAELAVPVWRELKSDLEQLEARLHSTMSSQLQRKRQRLDSLK 298

Query: 311 -LKALPNSDQTLSCSRYRLDRLPRELEHNL 339
            +  L N    +  +R RLD L   +E  +
Sbjct: 299 TIGPLSNPFWRIDQNRQRLDSLSERVEQGM 328


>gi|325126075|gb|ADY85405.1| Exodeoxyribonuclease VII [Lactobacillus delbrueckii subsp.
           bulgaricus 2038]
          Length = 456

 Score =  255 bits (652), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 154/491 (31%), Positives = 255/491 (51%), Gaps = 62/491 (12%)

Query: 11  DHPEYSVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAII 68
           D    +VSEL++++K   + +  L  + ++GE+S +R     GH YFSLKD+ S+I+ ++
Sbjct: 8   DEKYLTVSELNWYVKQKFDRDPYLRQIFLQGELSNFR-FRRGGHQYFSLKDDKSKINVVM 66

Query: 69  WKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLL 128
           ++G  +K++F PEEG++  V G+++T+     YQ   +S+ P+G G L     + ++KL 
Sbjct: 67  FRGDFDKVKFEPEEGMKVYVTGRLSTYEAQGSYQFYAKSMEPAGLGALYERFRQLQEKLA 126

Query: 129 EEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECP 187
           +EGLF+ +HK P+P  P  IAV+TS +GAVI DI+   + RFP   + +FP +VQG+   
Sbjct: 127 KEGLFAQEHKRPLPLFPDKIAVVTSASGAVIHDIMVTANRRFPHAEIDLFPAQVQGESAA 186

Query: 188 KEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAI 247
             + +A+ Q+            D++I+ RGGGS+EDLW FN+E +VR +    +P+IS++
Sbjct: 187 GSLVSAMQQIQA-----RADEYDVLIIGRGGGSLEDLWPFNEEEVVRQVYAMKMPVISSV 241

Query: 248 GHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTL 307
           GHETD TL D AAD RA TPT AAEMA P    + + +  L+ RL   I  +I+ +   L
Sbjct: 242 GHETDTTLCDLAADCRAATPTAAAEMATPALPLVLAEIGQLQTRLLTDIRAVIQVRAQAL 301

Query: 308 ----NSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLI 363
               NS +   P   +       ++D+L ++L   +E+I+  + +  + +  R++     
Sbjct: 302 AQLENSFIMKEPQ--RLYEQKMQQVDQLSQQLSRMMEVIVKDQGQKLSLLTQRLQ----- 354

Query: 364 HNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKL 423
           H     R         I+Q+ KQ   Y+                             K L
Sbjct: 355 HQAPDRR---------IKQL-KQENSYL----------------------------AKSL 376

Query: 424 ITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKT 483
              I+ IL  K  +C  +V    + L  ++   TL RGY+   D + N +   + L    
Sbjct: 377 EMGIKRILEQKQAACRQAV----QQLDDYSPLKTLARGYSYTTDASGNVVKSVQQLVPGD 432

Query: 484 RILINFFDGQA 494
           ++ ++  DGQA
Sbjct: 433 QVRLHLKDGQA 443


>gi|47076768|dbj|BAD18311.1| exodeoxyribonuclease VII large subunit [Geobacillus
           stearothermophilus]
          Length = 448

 Score =  255 bits (652), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 164/489 (33%), Positives = 257/489 (52%), Gaps = 57/489 (11%)

Query: 16  SVSELSYHLKHI--VESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V  L+ ++K    V+ +L  + V+GEIS ++  HS GH YF+LKD+ +RI A+++ G  
Sbjct: 7   TVGALTKYIKRKFDVDPHLRDLWVKGEISNFKQ-HSRGHMYFTLKDSQARIAAVMFAGYN 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             + F PE+G+  LV G+I+ +  +  YQ+ ++ + P G G L  A E+ K++L  EGLF
Sbjct: 66  QHLPFRPEDGMNVLVRGEISVYEPNGNYQLYVKEMQPEGIGRLYLAYEQLKQRLEAEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
           S  HK P+P  P+ I V+TSPTGA +RDI+  I  R+PL ++I+FP  VQGD     I  
Sbjct: 126 SPVHKKPLPAFPRCIGVVTSPTGAAVRDIMTTIRRRYPLAKIILFPALVQGDGAALSIVR 185

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI + N           D++I+ RGGGSIE+LW FN+E++ RAI  S +P+ISA+GHETD
Sbjct: 186 AIERANEFGG------VDVLIVGRGGGSIEELWAFNEEIVARAIFASRVPVISAVGHETD 239

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ ADLRAPTPT AAE+A P    L   L   + R+    IR +K ++      L+
Sbjct: 240 FTIADFVADLRAPTPTAAAELAAPHVGELAERLAERKWRM----IRAMKEQLAASQERLR 295

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
            L    Q     RY     PR L    E  +                D L+  + + R+ 
Sbjct: 296 RL----QASYAFRY-----PRRLYEQKEQQL----------------DVLLDRLARQRER 330

Query: 373 ILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILS 432
           +L+K++  +Q  +  LR   L +    A L  ++E+ K     L   ++  + R      
Sbjct: 331 LLDKKR--QQWRELRLR---LWRHHPAAELERMKERQKAAAGALEKAMRTALER------ 379

Query: 433 HKIK-SCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFD 491
           H ++   H +       L++ +    ++RGY+ + +     + +   L    R+ I   D
Sbjct: 380 HALRFRSHVAR------LEALSPLRIMERGYSLVYNERRELVKRIGQLQVGERLSIRIQD 433

Query: 492 GQANAIVIN 500
           GQ +  V  
Sbjct: 434 GQVDCQVTG 442


>gi|42521827|ref|NP_967207.1| exodeoxyribonuclease VII, large subunit [Bdellovibrio bacteriovorus
           HD100]
 gi|39574357|emb|CAE77861.1| exodeoxyribonuclease VII, large subunit [Bdellovibrio bacteriovorus
           HD100]
          Length = 468

 Score =  255 bits (651), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 140/367 (38%), Positives = 215/367 (58%), Gaps = 17/367 (4%)

Query: 16  SVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNK 75
           SV +L+ ++K ++E  +  V V+GEIS ++  H+SGH YFSLKD+ S+I A++++G   +
Sbjct: 36  SVEQLNIYVKQLLEGQIGQVWVKGEISNFKA-HTSGHFYFSLKDSRSQITAVMFRGNNAR 94

Query: 76  IEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSD 135
           ++F P +G+E +V G+IT +     YQ++ E + P G+G L  A E+ K KL  EGLF  
Sbjct: 95  LKFKPTDGMEVIVRGRITVYEPRGNYQLMCEMMEPVGAGALQKAFEQLKMKLKAEGLFES 154

Query: 136 QHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRF-PLRVIIFPVKVQGDECPKEIANAI 194
             K PIP  P+ IA++TSPTGA IRDIL  +S R   ++V + P  VQG+    +I  A 
Sbjct: 155 ARKKPIPTFPRHIAIVTSPTGAAIRDILNVLSRRAKAIQVTVVPTIVQGEAAAPQICEA- 213

Query: 195 LQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWT 254
                 K+    P  D++I+ RGGGSIED+W FNDE + R IA S +P+ISA+GHE D+T
Sbjct: 214 -----FKKATALPGVDVVIVGRGGGSIEDMWCFNDERLARLIAASPVPVISAVGHEIDFT 268

Query: 255 LADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKAL 314
           +AD+ ADLRAPTP+ AAE+       L + +++LE  L+    + +K+    +  L K L
Sbjct: 269 IADFVADLRAPTPSAAAELVAKSSGELANKVVSLERMLHLTFEKKMKFLREKMLGLSKRL 328

Query: 315 PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHIL 374
            +  + L     R D    +L + LE  I R+     H     + + +   +   +  I 
Sbjct: 329 VDPKRRLQDLELRND----DLLNRLEFAINRRLAERRH-----RVELMSQKLGSPQDLID 379

Query: 375 EKQQHIE 381
           EK++ +E
Sbjct: 380 EKKKDLE 386


>gi|56420930|ref|YP_148248.1| exodeoxyribonuclease VII large subunit [Geobacillus kaustophilus
           HTA426]
 gi|81832353|sp|Q75TC0|EX7L_GEOKA RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|47076818|dbj|BAD18358.1| exodeoxyribonuclease VII large subunit [Geobacillus kaustophilus]
 gi|56380772|dbj|BAD76680.1| exodeoxyribonuclease VII large subunit [Geobacillus kaustophilus
           HTA426]
          Length = 448

 Score =  255 bits (651), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 161/477 (33%), Positives = 247/477 (51%), Gaps = 53/477 (11%)

Query: 25  KHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNKIEFLPEEGI 84
           K  V+ +L  + V+GEIS ++  HS GH YF+LKD+  RI A+++ G    + F PE+G+
Sbjct: 18  KFDVDPHLRDLWVKGEISNFKQ-HSRGHMYFTLKDSQGRIAAVMFAGYNQHLPFRPEDGM 76

Query: 85  EFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSDQHKNPIPFI 144
             L  G+I+ +  +  YQ+ ++ + P G G+L  A E+ K++L  EGLFS  HK P+P  
Sbjct: 77  NVLARGEISVYEPNGNYQLYVKEMQPEGVGSLYLAYEQLKQRLEAEGLFSPVHKKPLPAF 136

Query: 145 PKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIANAILQLNTLKEG 203
           P+ I V+TSPTGA +RDI+  I  R+PL +VI+FP  VQGD     I  AI + N+    
Sbjct: 137 PRCIGVVTSPTGAAVRDIMTTIRRRYPLAKVILFPALVQGDGAAPSIVRAIERANSFGG- 195

Query: 204 RTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWTLADYAADLR 263
                 D++I+ RGGGSIE+LW FN+E++ RAI  S IPIISA+GHETD+T+AD+ ADLR
Sbjct: 196 -----VDVLIVGRGGGSIEELWAFNEEIVARAIFASKIPIISAVGHETDFTIADFVADLR 250

Query: 264 APTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKALPNSDQTLSC 323
           APTPT AAEMA P    L   L   + RL    IR +K ++      L+ L  S      
Sbjct: 251 APTPTAAAEMAAPHVGELAERLAERKWRL----IRAMKEQLAADKEQLRRLQGS----YA 302

Query: 324 SRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHILEKQQHIEQI 383
            RY   RL  + E  L                    D L+  + + R+ +++K  H +++
Sbjct: 303 FRY-PKRLYEQKEQQL--------------------DALLERLSRQRERLVDK--HRQRL 339

Query: 384 VKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSHKIKSCHTSVS 443
            +  +R   L +    A L  ++E+ K     L   ++  + R  F     +        
Sbjct: 340 HELDMR---LWRHHPAAELERMKERQKAAANALEKAMRTAVERHRFRFRSNLAR------ 390

Query: 444 ITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDGQANAIVIN 500
                L++ +    ++RGY+ + +     + +   L     + I   DG+ +  V  
Sbjct: 391 -----LEALSPLRIMERGYSLVYNEQGELVKRTNQLRIGEHLSIQVQDGRVDCQVTG 442


>gi|329942663|ref|ZP_08291442.1| exodeoxyribonuclease VII, large subunit [Chlamydophila psittaci
           Cal10]
 gi|332287258|ref|YP_004422159.1| exodeoxyribonuclease VII large subunit [Chlamydophila psittaci 6BC]
 gi|313847844|emb|CBY16838.1| probable exodeoxyribonuclease VII large subunit [Chlamydophila
           psittaci RD1]
 gi|325506549|gb|ADZ18187.1| exodeoxyribonuclease VII large subunit [Chlamydophila psittaci 6BC]
 gi|328814923|gb|EGF84912.1| exodeoxyribonuclease VII, large subunit [Chlamydophila psittaci
           Cal10]
 gi|328914504|gb|AEB55337.1| exodeoxyribonuclease VII, large subunit [Chlamydophila psittaci
           6BC]
          Length = 555

 Score =  255 bits (651), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 179/549 (32%), Positives = 278/549 (50%), Gaps = 69/549 (12%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           P  +V+ L+  +K+++ESN  H+ V+GE+S    +  SGH YF +KD+ S ++   +   
Sbjct: 6   PPQAVTTLTESIKNLLESNFCHIVVKGELSNV-SLQPSGHLYFGIKDSKSFLNGAFFHFK 64

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
               +  P++G   ++ GK+T +    +YQI+  +L+ +G G LL   E+ KK+L  EG 
Sbjct: 65  SKYFDRRPKDGDSVIIHGKLTVYAPRGQYQIVAHALVYAGEGDLLQKFEETKKRLAAEGY 124

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCR-FPLRVIIFPVKVQGDECPKEIA 191
           FS + K P+P IPK I VITSPTGAVI+DIL+ +S R +  +V+I+PV VQG    KEI+
Sbjct: 125 FSIEKKQPLPRIPKCIGVITSPTGAVIQDILRILSRRCYQYKVLIYPVTVQGATAAKEIS 184

Query: 192 NAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHET 251
            AI  +N  K        D++++ARGGGSIEDLW FN+E+IV+AI  S+IPIISA+GHET
Sbjct: 185 QAIEVMNRDK------LVDVLVIARGGGSIEDLWAFNEEIIVKAIDASTIPIISAVGHET 238

Query: 252 DWTLADYAADLRAPTPTGAAEMAVPVKEH----LQSSLINLEARLNNII----------- 296
           D+TL D+AAD+RAPTP+ AAE+     +      +S L  L A    ++           
Sbjct: 239 DYTLCDFAADVRAPTPSAAAEIVCQSSQEQIQIFKSHLRYLNAHAQQLLAGKAKQIQQWK 298

Query: 297 -----IRLIKYKINTLNSLLKALPNSDQT-LSCSRYRLDRLPRELEHN-LEIIIFR---- 345
                +   +    +L+ L  ++  S QT LS S+ R  +  R L+ + L+ + +R    
Sbjct: 299 RYLDHVDFFRPPHQSLDYLRVSIERSIQTKLSQSKQRYMQYTRWLQSDILQRMTYRLQDL 358

Query: 346 ----------KYRHFNHIINRIKSDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEK 395
                     +     H    IK + +IHN Q+ RQ     +  I + + Q L Y     
Sbjct: 359 WKMINLAFQNRLLALKHHCVHIKKNLVIHNTQQYRQRFDPCRDQIHRALSQRLGYFQQSL 418

Query: 396 KEKIAILHMLREQTKNRIFYLHTHIKKLITR-----------------------IEFILS 432
             K  +L     +  N++F   T    L+ R                       +   L+
Sbjct: 419 AHKQTLLKHFTTKI-NQLFIKETSALNLLKRRLNKAFVYTVCERREHFLYAKENLFLSLN 477

Query: 433 HKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTN-NNFITQKRNLATKTRILINFFD 491
           H ++         ++ L S   KN LKRGY  + D N N+ I   ++L   + + +   D
Sbjct: 478 HLVERHRAKYHTVSKQLISLNPKNVLKRGYAMLFDFNENSAIISAKSLHKHSCVRVRLQD 537

Query: 492 GQANAIVIN 500
           G+A   V +
Sbjct: 538 GEATLTVTD 546


>gi|297568698|ref|YP_003690042.1| exodeoxyribonuclease VII, large subunit [Desulfurivibrio
           alkaliphilus AHT2]
 gi|296924613|gb|ADH85423.1| exodeoxyribonuclease VII, large subunit [Desulfurivibrio
           alkaliphilus AHT2]
          Length = 446

 Score =  255 bits (651), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 142/348 (40%), Positives = 210/348 (60%), Gaps = 8/348 (2%)

Query: 7   KNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDA 66
           +N  D+   +VSEL+  ++ ++E++ S V V GEIS  R   SSGH YF+LKD  +++ A
Sbjct: 2   ENPFDNRIQTVSELTRSIRGLLETSYSMVTVTGEISNLRR-PSSGHLYFTLKDADAQLRA 60

Query: 67  IIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKK 126
           ++++     +   P +G+E L  G+I+ +    +YQ+II+ +   G+G L  A ++ K K
Sbjct: 61  VLFRAQQRYLACTPADGLEVLCRGRISVYEPRGEYQLIIDFMDGKGAGLLRIAFDRLKAK 120

Query: 127 LLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVI-IFPVKVQGDE 185
           L  EGLF+ + K P+PF+PK IA++TSP GA +RD L + + R P   I I PV+VQGD 
Sbjct: 121 LEAEGLFAPERKRPLPFLPKSIALVTSPQGAAVRDFLTQAAKRCPATAISIMPVRVQGDG 180

Query: 186 CPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIIS 245
              EIA AI +LN L       R D+I+L RGGGS+EDLW FN+E + RA+A S IP++S
Sbjct: 181 AAAEIAQAIARLNQLA------RWDVIVLCRGGGSLEDLWAFNEEELARAVAASEIPVVS 234

Query: 246 AIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKIN 305
           A+GHE D+T+AD+ ADLRAPTPT AA+M +P +E L  ++     RL   + R ++    
Sbjct: 235 AVGHEVDFTIADFVADLRAPTPTAAAQMVLPDQEALAGAINEFNRRLAATLRRQLQEARQ 294

Query: 306 TLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHI 353
            L +  + L +  + L+    RLD L  EL H L   + R     N  
Sbjct: 295 KLLAGQRLLGDPSRLLAQHHLRLDHLQAELGHGLRYHLHRCQERLNRF 342


>gi|304407044|ref|ZP_07388698.1| exodeoxyribonuclease VII, large subunit [Paenibacillus
           curdlanolyticus YK9]
 gi|304344031|gb|EFM09871.1| exodeoxyribonuclease VII, large subunit [Paenibacillus
           curdlanolyticus YK9]
          Length = 458

 Score =  254 bits (650), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 166/502 (33%), Positives = 259/502 (51%), Gaps = 90/502 (17%)

Query: 15  YSVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           YS+ EL+ ++K  +E++  L  V +RGEIS +   HSSGH YF+LKD  SR+  I++   
Sbjct: 11  YSIKELNRYIKMKLEADQLLGDVWLRGEISNFTH-HSSGHMYFTLKDRDSRLKCIMFASH 69

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
              + F+P+EG + +  G I+ +     YQ  + ++ P G G+L  A E+ KKKL EEGL
Sbjct: 70  NRSLPFIPKEGTKVIARGNISVYERDGNYQYYVTAMQPDGIGSLYLAYEQLKKKLEEEGL 129

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIA 191
           F    K  +P  P+ I VITSPTGA +RD++  +  R P + +I+ PV VQG    + I 
Sbjct: 130 FDHSRKRQLPTFPRAIGVITSPTGAAVRDVIITLQRRHPSVPIIVCPVLVQGTGAAQSIV 189

Query: 192 NAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHET 251
            AI  +N + E       D++I+ RGGGS+E+LW FN+E + RAIA+S+IP+ISA+GHET
Sbjct: 190 QAIQFMNRMAE------TDVLIVGRGGGSLEELWAFNEEAVARAIASSTIPVISAVGHET 243

Query: 252 DWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLL 311
           D+T+AD+ ADLRA TPT AAE+AVP  E L+  L  L+ RL                   
Sbjct: 244 DFTIADFVADLRAATPTAAAELAVPHIEELKRELDRLKHRL------------------- 284

Query: 312 KALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQ 371
             L ++   +   R RL+R+ R                         S F +H     R+
Sbjct: 285 --LQSAQLAVRTRRERLERVKR-------------------------SPFFVH----PRR 313

Query: 372 HILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLR-EQTKNRIFYLHTHI---------- 420
           ++L++ Q ++++            +E++A+L   R E+ +NR+  L   +          
Sbjct: 314 YLLDQAQRLDRL------------EERLALLTQRRVERGRNRLMRLSQSLFANHPGQAVQ 361

Query: 421 ------KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFIT 474
                 + L TR+E  L+ ++K     +S T R L + +    + RGY+ + D     + 
Sbjct: 362 LAAEKQQALRTRMETALASQLKQHKIRLSGTIRQLDALSPLKVMSRGYSLVYDEQEQKLI 421

Query: 475 QKRN-LATKTRILINFFDGQAN 495
           +  N +     + I   DGQ +
Sbjct: 422 RSVNEVQPGDLVRIKLKDGQLD 443


>gi|150390266|ref|YP_001320315.1| exodeoxyribonuclease VII, large subunit [Alkaliphilus
           metalliredigens QYMF]
 gi|166919629|sp|A6TR38|EX7L_ALKMQ RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|149950128|gb|ABR48656.1| exodeoxyribonuclease VII, large subunit [Alkaliphilus
           metalliredigens QYMF]
          Length = 410

 Score =  254 bits (650), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 139/332 (41%), Positives = 210/332 (63%), Gaps = 14/332 (4%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           SVSE+++++K I+ ++  LS+V ++GEIS Y+ +HSSGH YF+LKD  SR+ ++++K   
Sbjct: 7   SVSEINHYIKRIMINDPILSNVYIKGEISNYK-LHSSGHIYFTLKDEKSRVSSVMFKTNT 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            +++FLPEEG++ L  G I+ +     YQ  ++ +  +G G L  A ++ K+KL ++G F
Sbjct: 66  EQLKFLPEEGMQVLCRGYISLYERGGLYQFYVDHMEAAGVGALYLAYQQLKEKLEKQGYF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIAN 192
             + K  IP IP+ IAV+TSPTGA +RDI+  I  RFP + + +FPV VQGD     IA 
Sbjct: 126 DGKFKKEIPLIPRKIAVVTSPTGAAVRDIISVIKRRFPHVEIYLFPVLVQGDRAAPSIAR 185

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           A+  LN           D+ I+ RGGGSIE+LW FN+E +  AI +S +PIISA+GHETD
Sbjct: 186 AVELLNLFGG------IDVAIIGRGGGSIEELWPFNEETVAEAIFSSQVPIISAVGHETD 239

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ ADLRAPTP+ AAE  VP  + +   L  L+ RLN  +++ I  K N L  ++K
Sbjct: 240 FTIADFVADLRAPTPSVAAERVVPDVKEVVERLNTLKDRLNKTLVKSIDAKRNQL-GIIK 298

Query: 313 A---LPNSDQTLSCSRYRLDRLPRELEHNLEI 341
           +     N    +   +  LD L ++L  N+ +
Sbjct: 299 SNYYFKNPLNMIYDRQQHLDILMKDLTRNINV 330


>gi|308174225|ref|YP_003920930.1| exodeoxyribonuclease VII large subunit [Bacillus amyloliquefaciens
           DSM 7]
 gi|307607089|emb|CBI43460.1| exodeoxyribonuclease VII (large subunit) [Bacillus
           amyloliquefaciens DSM 7]
          Length = 453

 Score =  254 bits (650), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 145/419 (34%), Positives = 238/419 (56%), Gaps = 13/419 (3%)

Query: 16  SVSELSYHLKH--IVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +VS L+ ++K    V+ +L  + ++GE+S  + IH+ GH YF+LKD H+R+ A++++   
Sbjct: 14  TVSALTKYIKRKFDVDPHLEDIWIKGELSNVK-IHTRGHIYFTLKDEHARMQAVMFQRQS 72

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
           +++ F PE+G++ +V G I+ +  S  YQ+  + + P G G L  A E+ KKKL  EGLF
Sbjct: 73  SRLAFKPEDGMKVIVRGGISVYEPSGSYQLYAKEMQPDGVGALYLAYEELKKKLAGEGLF 132

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
            D+HK  IP  P  I V+TSPTGA +RD++  +  R+PL +VI+ P  VQG+   + I  
Sbjct: 133 DDRHKQAIPAFPATIGVVTSPTGAAVRDVITTLKRRYPLVKVIVLPALVQGENASRSIVK 192

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
            I + N  K    C   D++I+ RGGGSIE+LW FN+E++ RAI  S+IP+ISA+GHETD
Sbjct: 193 RIEEANAQK---MC---DVLIVGRGGGSIEELWAFNEEIVARAIFASAIPVISAVGHETD 246

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T++D+ AD+RA TPTGAAE+AVP    L       E RL   + + I  K   + +L  
Sbjct: 247 FTISDFVADIRAATPTGAAEIAVPHTTDLMERTKTAEVRLTRAMQQHISKKKERVQALQS 306

Query: 313 --ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNR 370
             A     +  +    + D L ++ +  L  +  RK R       R+ +    + +++ +
Sbjct: 307 SYAFRFPKRLYTQKEQQFDLLYQQFQSQLTGLTDRKQRQLERNTYRLTALHPENQLKQAK 366

Query: 371 QHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLRE-QTKNRIFYLHTHIKKLITRIE 428
           +   E+   +E+ +   L+ +  + +  +  L+ L   Q   R + L    K+LI  ++
Sbjct: 367 KRYEERSNQLERSMNVQLKQLHSQFQTVLGKLNALSPLQVMERGYSLAYKDKELIKSVD 425


>gi|261417746|ref|YP_003251428.1| exodeoxyribonuclease VII large subunit [Geobacillus sp. Y412MC61]
 gi|319767442|ref|YP_004132943.1| exodeoxyribonuclease VII large subunit [Geobacillus sp. Y412MC52]
 gi|261374203|gb|ACX76946.1| exodeoxyribonuclease VII, large subunit [Geobacillus sp. Y412MC61]
 gi|317112308|gb|ADU94800.1| exodeoxyribonuclease VII, large subunit [Geobacillus sp. Y412MC52]
          Length = 448

 Score =  254 bits (650), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 161/477 (33%), Positives = 246/477 (51%), Gaps = 53/477 (11%)

Query: 25  KHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNKIEFLPEEGI 84
           K  V+ +L  + V+GEIS ++  HS GH YF+LKD+  RI A+++ G    + F PE+G+
Sbjct: 18  KFDVDPHLRDLWVKGEISNFKQ-HSRGHMYFTLKDSQGRIAAVMFAGYNQYLPFRPEDGM 76

Query: 85  EFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSDQHKNPIPFI 144
             L  G+I+ +  +  YQ+ ++ + P G G+L  A E+ K++L  EGLFS  HK P+P  
Sbjct: 77  NVLARGEISVYEPNGNYQLYVKEMQPEGVGSLYLAYEQLKQRLEAEGLFSPVHKKPLPAF 136

Query: 145 PKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIANAILQLNTLKEG 203
           P+ I V+TSPTGA +RDI+  I  R+PL +VI+FP  VQGD     I  AI + N     
Sbjct: 137 PRCIGVVTSPTGAAVRDIMTTIRRRYPLAKVILFPALVQGDGAAPSIVRAIERANAFGG- 195

Query: 204 RTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWTLADYAADLR 263
                 D++I+ RGGGSIE+LW FN+E++ RAI  S IPIISA+GHETD+T+AD+ ADLR
Sbjct: 196 -----VDVLIVGRGGGSIEELWAFNEEIVARAIFASKIPIISAVGHETDFTIADFVADLR 250

Query: 264 APTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKALPNSDQTLSC 323
           APTPT AAEMA P    L   L   + RL    IR +K ++      L+ L  S      
Sbjct: 251 APTPTAAAEMAAPHVGELAERLAERKWRL----IRAMKERLAADKEQLRRLQGS----YA 302

Query: 324 SRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHILEKQQHIEQI 383
            RY   RL  + E  L                    D L+  + + R+ +++K  H +++
Sbjct: 303 FRY-PKRLYEQKEQQL--------------------DALLERLSRQRERLVDK--HRQRL 339

Query: 384 VKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSHKIKSCHTSVS 443
            +  +R   L +    A L  ++E+ K     L   ++  + R  F     +        
Sbjct: 340 HELDMR---LWRHHPAAELERMKERQKATANALEKAMRTAVERHRFRFRSNLAR------ 390

Query: 444 ITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDGQANAIVIN 500
                L++ +    ++RGY+ + +     + +   L     + I   DG+ +  V  
Sbjct: 391 -----LEALSPLRIMERGYSLVYNEQGELVKRTNQLRIGEHLSIQVQDGRVDCQVTG 442


>gi|315646329|ref|ZP_07899449.1| exodeoxyribonuclease VII, large subunit [Paenibacillus vortex V453]
 gi|315278528|gb|EFU41844.1| exodeoxyribonuclease VII, large subunit [Paenibacillus vortex V453]
          Length = 461

 Score =  254 bits (650), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 140/330 (42%), Positives = 200/330 (60%), Gaps = 12/330 (3%)

Query: 16  SVSELSYHLKHIVE--SNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           SV +L+ +++  +E  S LS V +RGEIS +   HSSGH YF+LKD  SRI AI++    
Sbjct: 16  SVKDLNRYIRMKMEGDSRLSDVWIRGEISNFTH-HSSGHMYFTLKDEGSRIRAIMFATHN 74

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            ++ F+P+EG   +  G ++ +    +YQ     + P G G+L  A E+ K KL EEGLF
Sbjct: 75  QRLPFIPKEGSRVIARGNVSVYERDGQYQFYAVQMQPDGIGSLYLAYEQLKAKLEEEGLF 134

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIAN 192
           +   K P+P  PK I VITSPTGA +RDI+  I  R+P  R I++PV VQG      I  
Sbjct: 135 AADRKRPLPLYPKTIGVITSPTGAAVRDIMITIRRRYPQARTILYPVLVQGKGAVPSIVK 194

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI  +N + E       D++I+ RGGGS+E+LW FN+E++ R I  S IP+ISA+GHETD
Sbjct: 195 AIRTMNDMAEA------DVLIVGRGGGSLEELWAFNEEIVARVIYQSDIPVISAVGHETD 248

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ ADLRA TPT AAE+AVP    L+  L+  + +LN  + + +K     L SL +
Sbjct: 249 FTIADFVADLRAATPTAAAELAVPSSAELKGQLVQRQRQLNQGLQQRLKRSRERLASLQR 308

Query: 313 A--LPNSDQTLSCSRYRLDRLPRELEHNLE 340
           +  L +  + +     RLD L + L  NL+
Sbjct: 309 SPVLVHPRRYMLQHAERLDMLSQRLHGNLK 338


>gi|154686694|ref|YP_001421855.1| exodeoxyribonuclease VII large subunit [Bacillus amyloliquefaciens
           FZB42]
 gi|154352545|gb|ABS74624.1| XseA [Bacillus amyloliquefaciens FZB42]
          Length = 453

 Score =  254 bits (649), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 136/349 (38%), Positives = 207/349 (59%), Gaps = 12/349 (3%)

Query: 16  SVSELSYHLKH--IVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +VS L+ ++K    V+ +L  + ++GE+S  + IH+ GH YF+LKD H+R+ A++++   
Sbjct: 14  TVSALTKYIKRKFDVDPHLEDIWIKGELSNVK-IHTRGHIYFTLKDEHARMQAVMFQRQS 72

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
           +++ F PE+G++ +V G I+ +  S  YQ+  + + P G G L  A E+ KKKL  EGLF
Sbjct: 73  SRLAFKPEDGMKVIVRGGISVYEPSGSYQLYAKEMQPDGVGALYLAYEELKKKLAGEGLF 132

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
            D+HK  IP  P  I V+TSPTGA +RD++  +  R+PL +VI+ P  VQG+   + I  
Sbjct: 133 DDRHKQAIPAFPATIGVVTSPTGAAVRDVITTLKRRYPLVKVIVLPALVQGENASRSIVK 192

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
            I + N  K    C   D++I+ RGGGSIE+LW FN+E++ RAI  S+IPIISA+GHETD
Sbjct: 193 RIEEANAQK---MC---DVLIVGRGGGSIEELWAFNEEIVARAIFASAIPIISAVGHETD 246

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T++D+ AD+RA TPTGAAE+AVP    L       E RL   + + I  K   + SL  
Sbjct: 247 FTISDFVADIRAATPTGAAEIAVPHTTDLMERTKTAEVRLTRAMQQHISKKKERVQSLQS 306

Query: 313 --ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
             A     +  +    + D L ++ +  L  +  RK R       R+ +
Sbjct: 307 SYAFRFPKRLYTQKEQQFDLLYQQFQSQLTGLTDRKQRQLERNTYRLTA 355


>gi|328554170|gb|AEB24662.1| exodeoxyribonuclease VII large subunit [Bacillus amyloliquefaciens
           TA208]
 gi|328912562|gb|AEB64158.1| exodeoxyribonuclease VII (large subunit) [Bacillus
           amyloliquefaciens LL3]
          Length = 447

 Score =  254 bits (649), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 145/419 (34%), Positives = 238/419 (56%), Gaps = 13/419 (3%)

Query: 16  SVSELSYHLKH--IVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +VS L+ ++K    V+ +L  + ++GE+S  + IH+ GH YF+LKD H+R+ A++++   
Sbjct: 8   TVSALTKYIKRKFDVDPHLEDIWIKGELSNVK-IHTRGHIYFTLKDEHARMQAVMFQRQS 66

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
           +++ F PE+G++ +V G I+ +  S  YQ+  + + P G G L  A E+ KKKL  EGLF
Sbjct: 67  SRLAFKPEDGMKVIVRGGISVYEPSGSYQLYAKEMQPDGVGALYLAYEELKKKLAGEGLF 126

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
            D+HK  IP  P  I V+TSPTGA +RD++  +  R+PL +VI+ P  VQG+   + I  
Sbjct: 127 DDRHKQAIPAFPATIGVVTSPTGAAVRDVITTLKRRYPLVKVIVLPALVQGENASRSIVK 186

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
            I + N  K    C   D++I+ RGGGSIE+LW FN+E++ RAI  S+IP+ISA+GHETD
Sbjct: 187 RIEEANAQK---MC---DVLIVGRGGGSIEELWAFNEEIVARAIFASAIPVISAVGHETD 240

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T++D+ AD+RA TPTGAAE+AVP    L       E RL   + + I  K   + +L  
Sbjct: 241 FTISDFVADIRAATPTGAAEIAVPHTTDLMERTKTAEVRLTRAMQQHISKKKERVQALQS 300

Query: 313 --ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNR 370
             A     +  +    + D L ++ +  L  +  RK R       R+ +    + +++ +
Sbjct: 301 SYAFRFPKRLYTQKEQQFDLLYQQFQSQLTGLTDRKQRQLERNTYRLTALHPENQLKQAK 360

Query: 371 QHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLRE-QTKNRIFYLHTHIKKLITRIE 428
           +   E+   +E+ +   L+ +  + +  +  L+ L   Q   R + L    K+LI  ++
Sbjct: 361 KRYEERSNQLERSMNVQLKQLHSQFQTVLGKLNALSPLQVMERGYSLAYKDKELIKSVD 419


>gi|52080963|ref|YP_079754.1| exodeoxyribonuclease VII large subunit [Bacillus licheniformis ATCC
           14580]
 gi|52786339|ref|YP_092168.1| exodeoxyribonuclease VII large subunit [Bacillus licheniformis ATCC
           14580]
 gi|319645079|ref|ZP_07999312.1| exodeoxyribonuclease 7 large subunit [Bacillus sp. BT1B_CT2]
 gi|81825261|sp|Q65HI9|EX7L_BACLD RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|52004174|gb|AAU24116.1| Exonuclease VII, large subunit [Bacillus licheniformis ATCC 14580]
 gi|52348841|gb|AAU41475.1| YqiB [Bacillus licheniformis ATCC 14580]
 gi|317392888|gb|EFV73682.1| exodeoxyribonuclease 7 large subunit [Bacillus sp. BT1B_CT2]
          Length = 449

 Score =  254 bits (648), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 162/489 (33%), Positives = 256/489 (52%), Gaps = 56/489 (11%)

Query: 16  SVSELSYHLKH--IVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ ++K    V+ +L  + ++GE+S  + IHS GH YF+LKD+++RI ++++    
Sbjct: 8   TVTALTKYIKRKFDVDPHLEDIWIKGELSNVK-IHSRGHIYFTLKDDNARIQSVMFARQN 66

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             + F PE G++ LV G I+ +  S  YQ+  + + P G G L  A E+ KKKL +EGLF
Sbjct: 67  RNLAFTPENGMKVLVRGGISVYEPSGSYQLYAKEIQPDGIGALHLAYEELKKKLSQEGLF 126

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
            +++K PIP  P ++ V+TSPTGA +RD++  I  R+PL +VI+ P  VQG    + I +
Sbjct: 127 DEKYKKPIPAFPSVVGVVTSPTGAAVRDVITTIKRRYPLVKVIVLPTLVQGVNAGESIVS 186

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           +I + N       C   D++I+ RGGGSIE+LW FN+E + RAI +S IPIISA+GHETD
Sbjct: 187 SIEEANRRD---LC---DVLIVGRGGGSIEELWAFNEEAVARAIFSSDIPIISAVGHETD 240

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T++D+ ADLRA TPTGAAE+AVP    L   L  LEAR+   + + +K +   + +L  
Sbjct: 241 FTISDFVADLRAATPTGAAELAVPNMLDLLERLKTLEARMTKSMQQDLKKRQERVKNL-- 298

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
                 Q+    RY   RL  + E   ++I  R  +     ++R K      N Q  +  
Sbjct: 299 ------QSSYAFRYP-KRLYAQKEQEFDLIFDRFQKQLAMTVDRKKQKL---NEQTYKLE 348

Query: 373 ILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILS 432
           +L  ++ ++Q  K+H                   EQT                R++  + 
Sbjct: 349 MLHPEEQLKQARKRH------------------EEQT---------------VRLKRNMK 375

Query: 433 HKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDG 492
            ++K  H+        L + +    ++RGY S+    N  I     +  K  I +   DG
Sbjct: 376 VQLKQIHSQFQTVLGKLNALSPLQVMERGY-SLTYKENELIKSIEQVHEKDEIRVTLNDG 434

Query: 493 QANAIVINK 501
                V+ K
Sbjct: 435 TLTCEVLQK 443


>gi|220931493|ref|YP_002508401.1| exodeoxyribonuclease VII, large subunit [Halothermothrix orenii H
           168]
 gi|254783702|sp|B8D2H9|EX7L_HALOH RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|219992803|gb|ACL69406.1| exodeoxyribonuclease VII, large subunit [Halothermothrix orenii H
           168]
          Length = 405

 Score =  253 bits (647), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 140/331 (42%), Positives = 210/331 (63%), Gaps = 12/331 (3%)

Query: 15  YSVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           Y+VSE++  +  ++ S+  L+ + + GEIS +   H+SGH YF++KD  S I +I+++G 
Sbjct: 6   YTVSEVTGRITELLTSDSVLNDLWITGEISNFHH-HNSGHMYFTIKDERSCIKSIMFRGY 64

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
             K++F PE+G++    G +  +     YQ  ++ L P+G G L  A E+ K+KL +EGL
Sbjct: 65  NRKLKFEPEDGLKVNAHGYVGVYKPRGDYQFYVDHLEPAGKGALYLAFEQLKEKLEKEGL 124

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIA 191
           F++ HK  IP +P+ I V+TSPTGA IRDIL  +  RF  + V+I P  VQG +  +EI 
Sbjct: 125 FNEDHKKEIPLLPRKIGVVTSPTGAAIRDILSVVKRRFKNVSVLIVPSLVQGKKAAREIV 184

Query: 192 NAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHET 251
             I  LN+  +       D+II++RGGGSIE+LW FN+E++ RAI NS IP+IS +GHET
Sbjct: 185 EGIEYLNSRDD------IDVIIVSRGGGSIEELWSFNEEVVARAIYNSRIPVISGVGHET 238

Query: 252 DWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSL- 310
           D+T+AD+ ADLRAPTP+ AAE+A+  +  L+  L+NL  RL N +   IK   + LNSL 
Sbjct: 239 DFTIADFVADLRAPTPSAAAELAISNRIELEKHLVNLYTRLYNSVSYQIKSYRDRLNSLS 298

Query: 311 LKALPNSDQTLSCSRYR-LDRLPRELEHNLE 340
           LK +    + L   + + +D L R L+  +E
Sbjct: 299 LKKVLTRPEELFIQKIQYVDELSRRLDWAME 329


>gi|62184936|ref|YP_219721.1| exodeoxyribonuclease VII large subunit [Chlamydophila abortus
           S26/3]
 gi|81312892|sp|Q5L6H1|EX7L_CHLAB RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|62148003|emb|CAH63754.1| probable exodeoxyribonuclease VII large subunit [Chlamydophila
           abortus S26/3]
          Length = 555

 Score =  253 bits (647), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 180/548 (32%), Positives = 281/548 (51%), Gaps = 67/548 (12%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           P  +V+ L+  +K+++ESN  H+ V+GE+S    +  SGH YF +KD+ S ++   +   
Sbjct: 6   PPQAVTTLTESIKNLLESNFCHIVVKGELSNV-SLQPSGHLYFGIKDSKSFLNGAFFHFK 64

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
               +  P++G   ++ GK+T +    +YQI+  +L+ +G G LL   E+ KK+L  EG 
Sbjct: 65  SKYFDRRPKDGDSVIIHGKLTVYAPRGQYQIVAHALVYAGEGDLLQKFEETKKRLAAEGY 124

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCR-FPLRVIIFPVKVQGDECPKEIA 191
           FS + K P+P IPK I VITSPTGAVI+DIL+ +S R +  +V+I+PV VQG    KEI+
Sbjct: 125 FSIEKKQPLPRIPKCIGVITSPTGAVIQDILRILSRRCYQYKVLIYPVTVQGATAAKEIS 184

Query: 192 NAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHET 251
            AI  +N  K        D++++ARGGGSIEDLW FN+E+IV+AI  S+IPIISA+GHET
Sbjct: 185 QAIEVMNRDK------LVDVLVIARGGGSIEDLWAFNEEIIVKAIDASTIPIISAVGHET 238

Query: 252 DWTLADYAADLRAPTPTGAAEMAV-PVKEHLQ---SSLINLEARLNNII----------- 296
           D+TL D+AAD+RAPTP+ A E+     +E +Q   S L  L A    ++           
Sbjct: 239 DYTLCDFAADVRAPTPSAAGEIVCQSSQEQIQIFKSHLRYLNAHAQQLLAGKAKQIQQWK 298

Query: 297 -----IRLIKYKINTLNSLLKALPNSDQT-LSCSRYRLDRLPRELEHN-LEIIIFR---- 345
                +   +    +L+ L  ++  S QT LS S+ R  +  R L+ + L+ + +R    
Sbjct: 299 RYLDHVDFFRPPHQSLDYLRVSIERSIQTTLSQSKQRYRQYTRWLQSDILQRMTYRLQDL 358

Query: 346 ----------KYRHFNHIINRIKSDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYI---- 391
                     +     H    IK + +IHN Q+ RQ     +  I + + Q L Y     
Sbjct: 359 WKMINLAFQNRLLALKHHCVHIKKNLVIHNTQQYRQRFDPCRDQIHRALSQRLGYFQQSL 418

Query: 392 ---------FLEKKEKIAI-----LHMLREQTKNRIFYL----HTHIKKLITRIEFILSH 433
                    F  K  ++ I     L++L+++      Y       H       +   L+H
Sbjct: 419 AHKQTLLKHFTTKINQLFIKETSALNLLKKRLNKAFVYTVCERREHFLYAKENLFLSLNH 478

Query: 434 KIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTN-NNFITQKRNLATKTRILINFFDG 492
            ++         ++ L S   KN LKRGY  + D N N+ I   ++L   + + +   DG
Sbjct: 479 LVERHRAKYHTVSQQLISLNPKNVLKRGYAMLFDFNENSAIISAKSLHKHSCVRVRLQDG 538

Query: 493 QANAIVIN 500
           +A   V +
Sbjct: 539 EATLTVTD 546


>gi|325569746|ref|ZP_08145770.1| exodeoxyribonuclease VII large subunit [Enterococcus casseliflavus
           ATCC 12755]
 gi|325157051|gb|EGC69217.1| exodeoxyribonuclease VII large subunit [Enterococcus casseliflavus
           ATCC 12755]
          Length = 450

 Score =  253 bits (647), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 141/396 (35%), Positives = 233/396 (58%), Gaps = 25/396 (6%)

Query: 14  EY-SVSELSYHLKH--IVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           EY +V+ L+ ++K    V+  L  V + GEIS +R      H YFSLKD+ ++I  +++K
Sbjct: 4   EYLTVTALTKYIKRKFDVDPYLERVYLTGEISNFR--RRPNHQYFSLKDDGAKISTVMFK 61

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           G  +K+ F PEEG++ + +G+IT +  S  YQ++I+ + P G G L  A E+ K+KL  E
Sbjct: 62  GAFDKLRFQPEEGMKVMAVGRITLYEASGNYQMVIDHMEPDGVGALYQAYEQLKQKLAAE 121

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKE 189
           GLFS   K  +P  PK IAV+TSP+GAVIRDI+     R+P+ +++++P  VQG++   +
Sbjct: 122 GLFS-APKQSLPKYPKRIAVLTSPSGAVIRDIITTTQRRYPIAQIVLYPTVVQGNKAADD 180

Query: 190 IANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGH 249
           +   I ++    +G      D +I+ RGGGSIEDLW FN+E + RAI ++  P+IS++GH
Sbjct: 181 VVKNIQRVEA--DGTF----DTMIIGRGGGSIEDLWPFNEERVARAIFDAKTPVISSVGH 234

Query: 250 ETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLE---ARLNNIIIRLIKYKINT 306
           ETD T+AD  AD+RA TPT AAE+AVPV   L   ++ +E   ARL    +  I+YK   
Sbjct: 235 ETDTTIADLVADVRAATPTAAAELAVPV---LSEEILRIEERQARLEQAFMHQIQYKQER 291

Query: 307 LNSLLKA--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              ++ +      ++       +LD+L + ++  L+ +++ K RH   +I+R+       
Sbjct: 292 YQRVIGSYVFRQPERLYEAQSIKLDQLQQRMQQGLQTLLYDKDRHAQQLISRLAQQQPKA 351

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIA 400
            +Q + Q +     ++ Q + + ++ I+  K+ + A
Sbjct: 352 RLQASNQEV----SYLSQRLMKAMKDIYAAKENQFA 383


>gi|293376578|ref|ZP_06622806.1| exodeoxyribonuclease VII, large subunit [Turicibacter sanguinis
           PC909]
 gi|292644804|gb|EFF62886.1| exodeoxyribonuclease VII, large subunit [Turicibacter sanguinis
           PC909]
          Length = 447

 Score =  253 bits (647), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 125/271 (46%), Positives = 174/271 (64%), Gaps = 8/271 (2%)

Query: 24  LKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNKIEFLPEEG 83
           LK   + NL H+ ++GEIS ++  HS GH YF+LKD+ ++I+A+++    +++ F+P+EG
Sbjct: 18  LKFDYDKNLQHLLLKGEISNFKR-HSRGHFYFTLKDDEAQINAVMFASAASQVSFMPKEG 76

Query: 84  IEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSDQHKNPIPF 143
           ++ +V G I  +     Y + ++ +   G G L  A  + K++L  EGLF  + K PIP 
Sbjct: 77  MQVVVKGHIAVYEAGGSYSLYVKEMTEDGIGNLYVAFTQMKERLGAEGLFDARFKQPIPP 136

Query: 144 IPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIANAILQLNTLKE 202
            P  I VITSPTGA IRD+L  I  RFPL +V ++P  VQG++    I   I Q N LK+
Sbjct: 137 FPHAIGVITSPTGAAIRDVLSTIKRRFPLVKVYVYPALVQGEQAAPSIVKCIQQANELKQ 196

Query: 203 GRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWTLADYAADL 262
                  D +I+ RGGGSIEDLW FN+E++ RAI  S IPIISA+GHETD+T+AD+ AD 
Sbjct: 197 ------VDTLIVGRGGGSIEDLWAFNEEIVARAIFESKIPIISAVGHETDFTIADFVADH 250

Query: 263 RAPTPTGAAEMAVPVKEHLQSSLINLEARLN 293
           RAPTPTGAAE+AVP    +   L  L  RLN
Sbjct: 251 RAPTPTGAAEIAVPNVVDVLKHLNQLNVRLN 281


>gi|167464894|ref|ZP_02329983.1| exodeoxyribonuclease VII large subunit [Paenibacillus larvae subsp.
           larvae BRL-230010]
 gi|322382775|ref|ZP_08056619.1| exodeoxyribonuclease VII large subunit-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
 gi|321153244|gb|EFX45690.1| exodeoxyribonuclease VII large subunit-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
          Length = 455

 Score =  253 bits (647), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 133/301 (44%), Positives = 192/301 (63%), Gaps = 10/301 (3%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           SV EL+ ++K  +ES+  L  V VRGEIS +   HSSGH YF+LKD  SR+ +I++    
Sbjct: 10  SVKELNRYMKMKLESDSVLQDVWVRGEISNFTH-HSSGHMYFTLKDKDSRLKSIMFASQN 68

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            ++ F P+EG   L  G I+ +    +YQ  ++ + P G G L  A E+ KKKL  EGLF
Sbjct: 69  QRLSFRPKEGTMVLARGNISVYERDGQYQFYVQQMQPDGMGNLYLAFEQLKKKLESEGLF 128

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIAN 192
           + + K PIP  PK I V+TSPTGA +RDI+  +  RFP + V ++PV VQG +    I  
Sbjct: 129 ALERKKPIPKYPKAIGVVTSPTGAAVRDIIITLQRRFPSVPVYLYPVLVQGAQAAPSITK 188

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI  +N  ++G      D++I+ RGGGS+E+LW FN+E++ R+I  S+IP+ISA+GHETD
Sbjct: 189 AIDAMN--RDGEV----DVLIVGRGGGSLEELWAFNEELVARSIFASAIPVISAVGHETD 242

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ ADLRA TPT AAE+AVP K  LQ  L     RL+  +++ ++   + L  L +
Sbjct: 243 FTIADFVADLRAATPTAAAELAVPHKLELQQQLDQYRQRLHQGLLKRLERGRDRLERLRR 302

Query: 313 A 313
           +
Sbjct: 303 S 303


>gi|325839360|ref|ZP_08166799.1| exodeoxyribonuclease VII, large subunit [Turicibacter sp. HGF1]
 gi|325490480|gb|EGC92796.1| exodeoxyribonuclease VII, large subunit [Turicibacter sp. HGF1]
          Length = 447

 Score =  253 bits (646), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 125/271 (46%), Positives = 174/271 (64%), Gaps = 8/271 (2%)

Query: 24  LKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNKIEFLPEEG 83
           LK   + NL H+ ++GEIS ++  HS GH YF+LKD+ ++I+A+++    +++ F+P+EG
Sbjct: 18  LKFDYDKNLQHLLLKGEISNFKR-HSRGHFYFTLKDDEAQINAVMFASAASQVSFMPKEG 76

Query: 84  IEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSDQHKNPIPF 143
           ++ +V G I  +     Y + ++ +   G G L  A  + K++L  EGLF  + K PIP 
Sbjct: 77  MQVVVKGHIAVYEAGGSYSLYVKEMTEDGIGNLYVAFTQMKERLGAEGLFDARFKQPIPP 136

Query: 144 IPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIANAILQLNTLKE 202
            P  I VITSPTGA IRD+L  I  RFPL +V ++P  VQG++    I   I Q N LK+
Sbjct: 137 FPHAIGVITSPTGAAIRDVLSTIKRRFPLVKVYVYPALVQGEQAAPSIVKCIQQANELKQ 196

Query: 203 GRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWTLADYAADL 262
                  D +I+ RGGGSIEDLW FN+E++ RAI  S IPIISA+GHETD+T+AD+ AD 
Sbjct: 197 ------VDTLIVGRGGGSIEDLWAFNEEIVARAIFESKIPIISAVGHETDFTIADFVADH 250

Query: 263 RAPTPTGAAEMAVPVKEHLQSSLINLEARLN 293
           RAPTPTGAAE+AVP    +   L  L  RLN
Sbjct: 251 RAPTPTGAAEIAVPNVVDVLKHLNQLNVRLN 281


>gi|193215381|ref|YP_001996580.1| exodeoxyribonuclease VII large subunit [Chloroherpeton thalassium
           ATCC 35110]
 gi|193088858|gb|ACF14133.1| exodeoxyribonuclease VII, large subunit [Chloroherpeton thalassium
           ATCC 35110]
          Length = 400

 Score =  253 bits (646), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 133/328 (40%), Positives = 206/328 (62%), Gaps = 7/328 (2%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
           Y+VS L+  ++  +E       +RGEIS ++  HSSGH YF+LKD+ ++I  IIW+    
Sbjct: 6   YTVSALTDAIRASLEQTFPDFSLRGEISNFKR-HSSGHIYFTLKDSGAQIPVIIWRSLAQ 64

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
           K+ F  ++G+E +V G++  +P S +YQ+I  ++ P G G L  A  +  + L ++GLF 
Sbjct: 65  KLRFEMQDGLEIVVEGRLEVYPPSGRYQVICTNVSPVGEGILQQAFARLMQTLAKDGLFD 124

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANA 193
           D HK  +P +P++I V+TSPTGAVI+DI   ++ R+P  ++ +FPV+VQG+E   EI  A
Sbjct: 125 DAHKKDLPRLPELIGVVTSPTGAVIQDIQTVLARRYPAAQLTLFPVRVQGEEAMAEIVAA 184

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N  + G+   RPD++I+ RGGGS+EDLW FN+E + RAI  S IPIISA+GHETD 
Sbjct: 185 ISYFNR-QTGKN--RPDVLIVGRGGGSLEDLWAFNEESVARAIFASGIPIISAVGHETDI 241

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK- 312
           T+AD  AD+RA TP+ AAE+A P  + +Q+S+     ++   I   I+     +NS+L  
Sbjct: 242 TIADLVADVRAATPSMAAELAAPSHDEIQASIDGALQQMAFSIASKIEGNYRQVNSILGS 301

Query: 313 -ALPNSDQTLSCSRYRLDRLPRELEHNL 339
            A     +T+   R +++   +++E  L
Sbjct: 302 YAFNRPVRTIENKRQQVENQIQQMERGL 329


>gi|224369659|ref|YP_002603823.1| XseA [Desulfobacterium autotrophicum HRM2]
 gi|223692376|gb|ACN15659.1| XseA [Desulfobacterium autotrophicum HRM2]
          Length = 452

 Score =  253 bits (646), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 139/323 (43%), Positives = 209/323 (64%), Gaps = 18/323 (5%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
           ++VS+L+  +K ++E   + V + GEIS    + +SGHAYFSLKD+++ I  +I++  L 
Sbjct: 11  FTVSKLTREIKTLIEERFTLVWITGEISNL-SLPASGHAYFSLKDSNAVISGVIFRNQLR 69

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
           ++ F PE G++ + +G+++ +     YQ+I E + PSG+G L  A E+ K KL  EGLF 
Sbjct: 70  RLGFKPENGMKIIGMGRLSLYEPRGSYQLIFEHMEPSGTGALQAAFEQLKHKLALEGLFD 129

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRF---PLRVIIFPVKVQGDECPKEIA 191
           +  K  +PF+P+ I+++TSPTGAVI+DI+     RF   PL ++  PVKVQG+    EIA
Sbjct: 130 EDRKQRLPFLPERISIVTSPTGAVIQDIINVSKRRFSNIPLEIV--PVKVQGEGADLEIA 187

Query: 192 NAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHET 251
            AI  +N     R     D+II+ARGGGS+EDL  FN E + RA+  S+IPIISA+GHET
Sbjct: 188 KAIALINQ----RAV--SDLIIVARGGGSLEDLVAFNSETVARAVFESAIPIISAVGHET 241

Query: 252 DWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIR---LIKYKINTLN 308
           D+T+ D+AAD+RAPTP+ AAE+A+P K  L S L +L A L   I++   LI+ +I  L 
Sbjct: 242 DFTITDFAADVRAPTPSAAAELALPEKSALFSRLTDLRAFLVRTIVQRQALIRERIMELT 301

Query: 309 SLLKALPNSDQTLSCSRYRLDRL 331
           + LK   +  + +   R++L+ L
Sbjct: 302 ARLK---DPKRAVDDLRFKLEDL 321


>gi|328948045|ref|YP_004365382.1| exodeoxyribonuclease 7 large subunit [Treponema succinifaciens DSM
           2489]
 gi|328448369|gb|AEB14085.1| Exodeoxyribonuclease 7 large subunit [Treponema succinifaciens DSM
           2489]
          Length = 402

 Score =  253 bits (645), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 132/307 (42%), Positives = 199/307 (64%), Gaps = 13/307 (4%)

Query: 16  SVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNK 75
           +VS+L+  +K ++ES+  ++ ++GEIS Y+   SSGH YFSLKD+ S+I A++++G  + 
Sbjct: 12  TVSQLTELIKTMLESSFQNIILKGEISNYKP-SSSGHLYFSLKDSDSQISAVMFRGAASA 70

Query: 76  IEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSD 135
           + F+P++G+   V GKIT +     YQI + S+I +G+G ++  +E RK+KL  EGLF  
Sbjct: 71  LNFIPKDGMLVQVRGKITVYGPRGNYQIQVSSMIEAGAGNIMEMIEMRKRKLAAEGLFDS 130

Query: 136 QHKNPIPFIPKIIAVITSPTGAVIRDILQ-RISCRFPLRVIIFPVKVQGDECPKEIANAI 194
             K  +PF PK + V+TSP GA +RDIL  R      + VI+FP  VQG+     I   I
Sbjct: 131 ARKRTVPFFPKTVGVVTSPNGAALRDILNIRRRRNDKVSVIVFPAIVQGENAADTIEYMI 190

Query: 195 LQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWT 254
              N   E   C   D++I+ RGGGS+EDL  F++E +VRAIA S IP+ISA+GHE DW 
Sbjct: 191 KVAN---EYNMC---DVLIVGRGGGSLEDLLPFSEEKVVRAIAKSKIPVISAVGHEIDWA 244

Query: 255 LADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKAL 314
           L+D+AAD+RAPTP+ AAE+A+P K  ++S++ N ++    I+   I+ K N+L  +L+  
Sbjct: 245 LSDFAADVRAPTPSAAAEIAIPRKSDIESNIENFKS----ILFSEIQNKTNSLRLMLRNF 300

Query: 315 -PNSDQT 320
            P + QT
Sbjct: 301 DPENMQT 307


>gi|317132178|ref|YP_004091492.1| exodeoxyribonuclease VII, large subunit [Ethanoligenens harbinense
           YUAN-3]
 gi|315470157|gb|ADU26761.1| exodeoxyribonuclease VII, large subunit [Ethanoligenens harbinense
           YUAN-3]
          Length = 419

 Score =  253 bits (645), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 126/323 (39%), Positives = 203/323 (62%), Gaps = 9/323 (2%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +VS+L++++  ++ES+  LS V +RGEIS ++  + SGH Y SLKD  + I A+++KG  
Sbjct: 9   TVSQLNFYVHTLLESDERLSGVFLRGEISNFKNHYRSGHYYLSLKDEDAVIHAVMFKGNA 68

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            ++ FLP++G++ +V G+ + +    +YQ  I+ + P G G L  A E+ K+KL +EGLF
Sbjct: 69  QRLRFLPQDGMKVIVSGRASLYERDGQYQFYIDDMQPDGIGALHVAFEQLKEKLRKEGLF 128

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
               K P+P  P+ I V+TS TGA ++DIL  +  R+P+  V++ PV VQG E P +I  
Sbjct: 129 DASRKRPLPLYPERIGVVTSATGAALQDILHVLGRRWPVAEVVLAPVLVQGVEAPGQICA 188

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI  +N  +        D++I+ RGGGSIEDLW FN+E + R IA S IP++SA+GHETD
Sbjct: 189 AIRAMNAARAA------DVLIVGRGGGSIEDLWAFNEEGVARCIAASDIPVVSAVGHETD 242

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ AD RAPTP+ AAE+  P +  + + L  ++AR+ +++ + +  +   + +  +
Sbjct: 243 FTIADFVADARAPTPSAAAELVSPERAAVTAGLYAMQARMRSLLAQKLADQRARMQAAAQ 302

Query: 313 ALPNSDQTLSCSRYRLDRLPREL 335
            L    + L+  R + D L   L
Sbjct: 303 RLYVPARLLNMHRMKTDMLDARL 325


>gi|104774288|ref|YP_619268.1| exodeoxyribonuclease VII large subunit [Lactobacillus delbrueckii
           subsp. bulgaricus ATCC 11842]
 gi|123077235|sp|Q1G9H2|EX7L_LACDA RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|103423369|emb|CAI98225.1| Exodeoxyribonuclease VII, large subunit [Lactobacillus delbrueckii
           subsp. bulgaricus ATCC 11842]
          Length = 456

 Score =  253 bits (645), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 154/493 (31%), Positives = 256/493 (51%), Gaps = 66/493 (13%)

Query: 11  DHPEYSVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAII 68
           D    +VSEL++++K   + +  L  + ++GE+S +R     GH YFSLKD+ S+I+ ++
Sbjct: 8   DEKYLTVSELNWYVKQKFDRDPYLRQIFLQGELSNFR-FRRGGHQYFSLKDDKSKINVVM 66

Query: 69  WKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLL 128
           ++G  +K++F PEEG++  V G+++T+     YQ   +S+ P+G G L     + ++KL 
Sbjct: 67  FRGDFDKVKFEPEEGMKVYVTGRLSTYEAQGSYQFYAKSMEPAGLGALYERFRQLQEKLA 126

Query: 129 EEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECP 187
           +EGLF+ +HK P+P  P  IAV+TS +GAVI DI+   + RF    + +FP +VQG+   
Sbjct: 127 KEGLFAQEHKRPLPLFPDKIAVVTSASGAVIHDIMVTANRRFSHAEIDLFPAQVQGESAA 186

Query: 188 KEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAI 247
             + +A+ Q+            D++I+ RGGGS+EDLW FN+E +VR +    +P+IS++
Sbjct: 187 GSLVSAMQQIQA-----RADEYDVLIIGRGGGSLEDLWPFNEEEVVRQVYAMKMPVISSV 241

Query: 248 GHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTL 307
           GHETD TL D AAD RA TPT AAEMA P    + + +  L+ RL   I  +I+ +   L
Sbjct: 242 GHETDTTLCDLAADCRAATPTAAAEMATPALPLVLAEIGQLQTRLLTDIRAVIQVRAQAL 301

Query: 308 ----NSLLKALPNS--DQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
               NS +   P    +Q +     ++D+L ++L   +E+I+  + +  + +  R++   
Sbjct: 302 AQLENSFIMKEPQRLYEQKMQ----QVDQLSQQLSRMMEVIVKDQGQKLSLLTQRLQ--- 354

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIK 421
             H     R         I+Q+ KQ   Y+                             K
Sbjct: 355 --HQAPDRR---------IKQL-KQENSYL----------------------------AK 374

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLAT 481
            L   I+ IL  K  +C  +V    + L  ++   TL RGY+   D + N +   + L  
Sbjct: 375 SLEMGIKRILEQKQAACRQAV----QQLDDYSPLKTLARGYSYTTDASGNVVKSVQQLVP 430

Query: 482 KTRILINFFDGQA 494
             ++ ++  DGQA
Sbjct: 431 GDQVRLHLKDGQA 443


>gi|288560069|ref|YP_003423555.1| exodeoxyribonuclease VII large subunit XseA [Methanobrevibacter
           ruminantium M1]
 gi|288542779|gb|ADC46663.1| exodeoxyribonuclease VII large subunit XseA [Methanobrevibacter
           ruminantium M1]
          Length = 508

 Score =  253 bits (645), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 130/287 (45%), Positives = 187/287 (65%), Gaps = 11/287 (3%)

Query: 14  EY-SVSELSYHLKHIV--ESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           EY +V++L+YH+K +V  +S+L +V VRGE+S ++  + SGH YF+LKD +S I  I++K
Sbjct: 4   EYLTVTKLNYHIKRLVNSDSSLKNVYVRGELSNFKR-YPSGHLYFTLKDQNSEIGGIMFK 62

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           G  ++++F P+ G++ L+ G +  +P    Y+I  + L   G G L  A E+ K+KL   
Sbjct: 63  GPASRLKFEPKNGMKVLINGYVDVYPKQGNYKIYAQKLTEDGIGDLYIAYEQLKRKLSAL 122

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKE 189
           G F D+HK  IP  PK + V+T+ TGA IRDI+  I  R+PL  +I+FP  VQG+  PK 
Sbjct: 123 GWFDDEHKQEIPKFPKRVGVVTASTGAAIRDIVITIKRRWPLCEIILFPSLVQGNMAPKN 182

Query: 190 IANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGH 249
           I   I+  +   +       D +I+ RGGGSIEDLW FNDE + + I  S  PIISA+GH
Sbjct: 183 IIKQIILADNEFD------LDTLIIGRGGGSIEDLWAFNDETLAKVIFFSKTPIISAVGH 236

Query: 250 ETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNII 296
           E DWT++DY ADLRA TPT AAE+AVP    ++S++ NL+ RLN +I
Sbjct: 237 EIDWTISDYVADLRAATPTAAAELAVPDINEIESNIKNLDDRLNKVI 283


>gi|229543901|ref|ZP_04432960.1| exodeoxyribonuclease VII, large subunit [Bacillus coagulans 36D1]
 gi|229325040|gb|EEN90716.1| exodeoxyribonuclease VII, large subunit [Bacillus coagulans 36D1]
          Length = 446

 Score =  253 bits (645), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 132/305 (43%), Positives = 200/305 (65%), Gaps = 16/305 (5%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           SV  L+ ++K   +++  L+ + V+GEIS ++  HSSGH YF+LKD  +R+ ++++    
Sbjct: 5   SVHTLTKYIKRKFDADPYLNDIHVKGEISNFKR-HSSGHMYFTLKDEKARLLSVMFASAN 63

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             ++F+PE G++ LV G ++ +     YQ+ ++S+ P G G L  A E+ K+KL +EGLF
Sbjct: 64  RTLKFMPENGMKVLVTGSVSVYEAGGSYQLYVKSMQPDGIGALYLAFEQLKEKLEKEGLF 123

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
             Q++ PIP  PK+I VITSPTGA +RDI+  I  R+P+  +I+ P  VQG+     I  
Sbjct: 124 --QNRRPIPAYPKVIGVITSPTGAAVRDIITTIRRRYPVAEIILHPALVQGENAAPSIVK 181

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI Q N +       + D++I+ RGGGSIE+LW FN+E+  RAI  S+IP+ISA+GHETD
Sbjct: 182 AIEQANRIG------KADVLIVGRGGGSIEELWAFNEEITARAIFASNIPVISAVGHETD 235

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+AADLRAPTPT AAE+AVP  + ++  +++L+ RL    IR ++ K+    S L 
Sbjct: 236 FTIADFAADLRAPTPTAAAELAVPHIDDVREKILHLKTRL----IRNMREKVRYEKSRLA 291

Query: 313 ALPNS 317
            L  S
Sbjct: 292 YLERS 296


>gi|295706549|ref|YP_003599624.1| exodeoxyribonuclease VII large subunit [Bacillus megaterium DSM
           319]
 gi|294804208|gb|ADF41274.1| exodeoxyribonuclease VII, large subunit [Bacillus megaterium DSM
           319]
          Length = 446

 Score =  252 bits (644), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 160/485 (32%), Positives = 251/485 (51%), Gaps = 64/485 (13%)

Query: 16  SVSELSYHLKHI--VESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ ++K    V+ ++  V ++GEIS ++  HS GH YF+LKD ++RI A+++ G  
Sbjct: 8   TVTALTRYIKRKFDVDPHMQDVWIKGEISNFKR-HSRGHMYFTLKDQNARIAAVMFAGHN 66

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            ++ F PEEG+  L+  +I+ +  S  YQ+ ++ + P G G L  A E+ KKKL +EGLF
Sbjct: 67  RQLNFQPEEGMNVLIRAEISVYEPSGNYQMYVKEMQPDGVGNLYLAYEQLKKKLEKEGLF 126

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
               K  +P  P  I VITSPTGA +RDI+  +  R+   +I+ P  VQG      I  A
Sbjct: 127 DPARKRKLPKYPTTIGVITSPTGAAVRDIITTLKRRYNANIIVMPALVQGVNAAPSIIKA 186

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I + N  KE       D++I+ RGGGSIE+LW FN+E + RAI  S+IP+ISA+GHETD+
Sbjct: 187 IEEANRRKEA------DVLIVGRGGGSIEELWAFNEESVARAIFTSTIPVISAVGHETDF 240

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           T+AD+ ADLRAPTPTGAAE+AVP               ++ I  RL +  I  L S+ + 
Sbjct: 241 TIADFVADLRAPTPTGAAELAVP--------------HISEITERLTQRNIRLLRSMKEM 286

Query: 314 LPNSDQTLSCSRYRLD-RLPREL----EHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQK 368
           L +S + L  S+     R P++L    E  L+ ++ R YR                   +
Sbjct: 287 LQSSSRRLERSQKSYAFRYPQKLVEQKEQQLDQLMERFYR-------------------E 327

Query: 369 NRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIE 428
            R++I  K+ + EQ+                A+L    E    +       + K++T+  
Sbjct: 328 GRRYIEHKRTNYEQLT--------------AALLRNHPEHQLTKAAERQQQLTKMLTK-- 371

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
             +   +K      +  T  L + +   T++RGY+ + D     I   + ++    + + 
Sbjct: 372 -EMQQLLKQKQLLFATATSKLHTLSPLKTMERGYSLVYDKEKELIKSTKQVSKGDVVNVR 430

Query: 489 FFDGQ 493
             DGQ
Sbjct: 431 LTDGQ 435


>gi|307824441|ref|ZP_07654666.1| exodeoxyribonuclease VII, large subunit [Methylobacter
           tundripaludum SV96]
 gi|307734425|gb|EFO05277.1| exodeoxyribonuclease VII, large subunit [Methylobacter
           tundripaludum SV96]
          Length = 452

 Score =  252 bits (644), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 149/371 (40%), Positives = 211/371 (56%), Gaps = 20/371 (5%)

Query: 16  SVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNK 75
           +V++L+     ++  +   V V GE+S      SSGH YFSLKD ++++   +++    +
Sbjct: 14  TVTQLNRETSQLLAEHFLSVLVEGELSNL-STPSSGHLYFSLKDANAQVRCAMFRTQQRR 72

Query: 76  IEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSD 135
           + F PE G + +V  +++ +     YQ+I+E +  +G G L  A +  K KL E+GLF  
Sbjct: 73  LAFKPENGKQVIVKAQVSLYEPRGDYQLIVEHIEEAGDGALRRAFDALKLKLSEQGLFDA 132

Query: 136 QHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANAI 194
            HK  +P +P+ I VITSP+GA IRDIL  +  RF  + VI++PV VQGD    EIA AI
Sbjct: 133 AHKQTLPTLPRAIGVITSPSGAAIRDILTVLQRRFAAIPVIVYPVAVQGDNAKHEIAKAI 192

Query: 195 LQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWT 254
              N  K+   C   D+IIL RGGGS+EDLW FN+E++ RAI +S IPIISA+GHETD+T
Sbjct: 193 ATANRHKQ---C---DVIILGRGGGSLEDLWAFNEELVARAIYDSEIPIISAVGHETDFT 246

Query: 255 LADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKAL 314
           +AD+ ADLRA TP+ AAE A P ++   S  + LE+RL   + R +  K  TL+ L + L
Sbjct: 247 IADFVADLRAATPSAAAEHASPDQQQWLSRFMYLESRLQQQLQRKLNQKQQTLDWLNQRL 306

Query: 315 PNS--DQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHN------I 366
                 Q L+ +  R+     ELE  L   I  K RH   II    +    HN       
Sbjct: 307 QQQHPGQKLAGNARRMA----ELEARLNQAIHAKLRHMTGIIEAKTAKLWQHNPAITIRS 362

Query: 367 QKNRQHILEKQ 377
            K RQ  L K+
Sbjct: 363 HKQRQDYLSKR 373


>gi|294501202|ref|YP_003564902.1| exodeoxyribonuclease VII, large subunit [Bacillus megaterium QM
           B1551]
 gi|294351139|gb|ADE71468.1| exodeoxyribonuclease VII, large subunit [Bacillus megaterium QM
           B1551]
          Length = 447

 Score =  252 bits (644), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 160/485 (32%), Positives = 251/485 (51%), Gaps = 64/485 (13%)

Query: 16  SVSELSYHLKHI--VESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ ++K    V+ ++  V ++GEIS ++  HS GH YF+LKD ++RI A+++ G  
Sbjct: 9   TVTALTRYIKRKFDVDPHMQDVWIKGEISNFKR-HSRGHMYFTLKDQNARIAAVMFAGHN 67

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            ++ F PEEG+  L+  +I+ +  S  YQ+ ++ + P G G L  A E+ KKKL +EGLF
Sbjct: 68  RQLNFQPEEGMNVLIRAEISVYEPSGNYQMYVKEMQPDGVGNLYLAYEQLKKKLEKEGLF 127

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANA 193
               K  +P  P  I VITSPTGA +RDI+  +  R+   +I+ P  VQG      I  A
Sbjct: 128 DPARKRKLPKYPTTIGVITSPTGAAVRDIITTLKRRYNANIIVMPALVQGVNAAPSIIKA 187

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I + N  KE       D++I+ RGGGSIE+LW FN+E + RAI  S+IP+ISA+GHETD+
Sbjct: 188 IEEANRRKEA------DVLIVGRGGGSIEELWAFNEESVARAIFTSNIPVISAVGHETDF 241

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           T+AD+ ADLRAPTPTGAAE+AVP               ++ I  RL +  I  L S+ + 
Sbjct: 242 TIADFVADLRAPTPTGAAELAVP--------------HISEITERLTQRNIRLLRSMKEM 287

Query: 314 LPNSDQTLSCSRYRLD-RLPREL----EHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQK 368
           L +S + L  S+     R P++L    E  L+ ++ R YR                   +
Sbjct: 288 LQSSSRRLERSQKSYAFRYPQKLVEQKEQQLDQLMERFYR-------------------E 328

Query: 369 NRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIE 428
            R++I  K+ + EQ+                A+L    E    +       + K++T+  
Sbjct: 329 GRRYIEHKRTNYEQLT--------------AALLRNHPEHQLTKAAERQQQLTKMLTK-- 372

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
             +   +K      +  T  L + +   T++RGY+ + D     I   + ++    + + 
Sbjct: 373 -EMQQLLKQKQLLFATATSKLHTLSPLKTMERGYSLVYDKEKELIKSTKQVSKGDVVNVR 431

Query: 489 FFDGQ 493
             DGQ
Sbjct: 432 LTDGQ 436


>gi|157692929|ref|YP_001487391.1| exodeoxyribonuclease VII large subunit [Bacillus pumilus SAFR-032]
 gi|166919631|sp|A8FF14|EX7L_BACP2 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|157681687|gb|ABV62831.1| exodeoxyribonuclease VII large subunit [Bacillus pumilus SAFR-032]
          Length = 448

 Score =  252 bits (643), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 163/489 (33%), Positives = 262/489 (53%), Gaps = 56/489 (11%)

Query: 16  SVSELSYHLKH--IVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ ++K    V+ +L  + ++GE+S  + IHS GH YF+LKD ++R+ A++++ + 
Sbjct: 8   TVTALTKYIKRKFDVDPHLEDIWIKGELSNVK-IHSRGHVYFTLKDENARMQAVMFQRSA 66

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            K+ F P+ G++  V G I  +  S  YQ+  + + P G G L  A E+ KKKL  EGLF
Sbjct: 67  AKLPFSPKSGMKVFVRGGIQVYEPSGNYQLYAKEMQPDGVGALHLAYEELKKKLASEGLF 126

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRF-PLRVIIFPVKVQGDECPKEIAN 192
             ++K PIP  P+++ VITSPTGA +RD++  I+ R+   ++I+ P  VQG+   + I  
Sbjct: 127 DARYKKPIPEYPEVVGVITSPTGAAVRDVITTINRRYQQAKIIVLPALVQGEHATRSIVE 186

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
            I + N   E + C   D++I+ RGGGSIE+LW FN+E + RAI  S IPIISA+GHETD
Sbjct: 187 RIKEAN---EKQLC---DVLIVGRGGGSIEELWAFNEEAVARAIFASDIPIISAVGHETD 240

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T++D+ AD+RAPTPTGAAE+AVP       S  +L  R+ +I IRL +   N  +    
Sbjct: 241 FTISDFTADMRAPTPTGAAELAVP-------STTDLIERIKSIDIRLTRAVKNQTSQ--- 290

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
                D+ L+       R P+ L+        +K + F+ + +R +   L   I++ R  
Sbjct: 291 ---AKDRLLALQSSYAFRFPKRLQE-------QKEQQFDLVFDRFQKQ-LTRQIEQKR-- 337

Query: 373 ILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILS 432
                    Q+ +Q  R   L  KE++        Q K R    H +  + + R    ++
Sbjct: 338 --------SQLDRQTYRLKPLHPKEQLL-------QAKKR----HANETEQLIR---SMN 375

Query: 433 HKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDG 492
            ++K+ H+        L +      ++RGY S+    +  I     + TK ++ I   DG
Sbjct: 376 VQMKTIHSQFQSVLGKLNALNPLQVMERGY-SLAYKEDELIKSVNQVETKDQLTITMKDG 434

Query: 493 QANAIVINK 501
           +    VI K
Sbjct: 435 RLICEVIEK 443


>gi|125973351|ref|YP_001037261.1| exodeoxyribonuclease VII large subunit [Clostridium thermocellum
           ATCC 27405]
 gi|256005457|ref|ZP_05430420.1| exodeoxyribonuclease VII, large subunit [Clostridium thermocellum
           DSM 2360]
 gi|281417551|ref|ZP_06248571.1| exodeoxyribonuclease VII, large subunit [Clostridium thermocellum
           JW20]
 gi|125713576|gb|ABN52068.1| Exodeoxyribonuclease VII large subunit [Clostridium thermocellum
           ATCC 27405]
 gi|255990597|gb|EEU00716.1| exodeoxyribonuclease VII, large subunit [Clostridium thermocellum
           DSM 2360]
 gi|281408953|gb|EFB39211.1| exodeoxyribonuclease VII, large subunit [Clostridium thermocellum
           JW20]
 gi|316940417|gb|ADU74451.1| exodeoxyribonuclease VII, large subunit [Clostridium thermocellum
           DSM 1313]
          Length = 411

 Score =  252 bits (643), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 139/349 (39%), Positives = 218/349 (62%), Gaps = 12/349 (3%)

Query: 16  SVSELSYHLKHIVESNL--SHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +VS ++ ++K I+  +L  S++ VRGEIS ++  HSSGH YF+LKD +  +  ++++   
Sbjct: 14  TVSAVNRYIKEIMSRDLILSNLWVRGEISNFK-YHSSGHMYFTLKDENCSLKCVMFRTYN 72

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             ++F+PE G++ +V G I+ F    +YQ+  E +   G G L  A E+ K++L  EGLF
Sbjct: 73  LHLKFMPENGMKVIVKGYISVFERDGQYQLYAEEMQNDGIGDLYIAFEQLKRRLASEGLF 132

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVI-IFPVKVQGDECPKEIAN 192
              HK  IPF+P+ I V+TS TG+VIRDI+  +  RF    I IFPV+VQG+    EI++
Sbjct: 133 DPAHKKKIPFMPRTIGVVTSATGSVIRDIMNILDRRFYNSYIKIFPVRVQGETAALEISH 192

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI +LN +         D+IILARGGGS+E+LW FN+E++ R+I NSSIP+ISA+GHETD
Sbjct: 193 AISKLNEIGG------VDVIILARGGGSLEELWPFNEEIVARSIFNSSIPVISAVGHETD 246

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ ADLRAPTP+ AAE+ +P K  + + +  L  R+ + + R +K K + L  L  
Sbjct: 247 YTIADFVADLRAPTPSAAAELVMPEKVTIINRIRELNVRMVDALQRNVKQKRDMLKKLAD 306

Query: 313 ALPNSD--QTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
           ++        +   R +LD L R+L+ ++   + R       +I ++ +
Sbjct: 307 SVVFRQPYDRIYQERMKLDILNRDLKKSMFASLERAGSKLGFLIGKLDA 355


>gi|23099334|ref|NP_692800.1| exodeoxyribonuclease VII large subunit [Oceanobacillus iheyensis
           HTE831]
 gi|31563140|sp|Q8EQ44|EX7L_OCEIH RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|22777563|dbj|BAC13835.1| exodeoxyribonuclease VII large subunit [Oceanobacillus iheyensis
           HTE831]
          Length = 455

 Score =  251 bits (642), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 140/353 (39%), Positives = 214/353 (60%), Gaps = 21/353 (5%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ ++K  ++S+  L  + +RGEIS ++  HS GH Y ++KD+ +RI A+++  + 
Sbjct: 7   TVTALTKYVKRKMDSDPHLRDIWLRGEISNFKH-HSRGHMYLTIKDDSARIQAVMFASSN 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            K+ F PE G+  L+ G+I+ F    +YQ+ I  + P G G+L  A E+ K++L ++G F
Sbjct: 66  RKLLFHPENGMNVLIRGEISVFEAYGQYQLYIHEMEPDGIGSLYQAFEQLKERLHKQGYF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIAN 192
           +D++K PIP  PK IAVITSPTGA IRDIL  +  R+P +++ +FPV VQG++    IA 
Sbjct: 126 ADEYKKPIPRYPKNIAVITSPTGAAIRDILTTMKRRYPSVKITVFPVLVQGNQAKASIAR 185

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           +I Q ++L         D+II+ RGGGSIE+LW FN+E + RAI  S  PIISA+GHETD
Sbjct: 186 SIQQADSLSY-------DVIIVGRGGGSIEELWSFNEEEVARAIFESKTPIISAVGHETD 238

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            T++D+ ADLRAPTPT A E+AVP +  L    I ++ R    + RL+K  I+   ++L 
Sbjct: 239 TTISDFVADLRAPTPTAAGELAVPSQVELLDK-IEIQKRQ---LARLLKQYISQHETILH 294

Query: 313 ALPNS------DQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
            L  +       Q +      LD     L+  ++  +       NH+I R+ S
Sbjct: 295 QLRQTYAFKYPHQLVKQKEQELDSTMDNLQRRMKSKVSDDKLTHNHLIKRLSS 347


>gi|257875396|ref|ZP_05655049.1| exonuclease VII [Enterococcus casseliflavus EC20]
 gi|257809562|gb|EEV38382.1| exonuclease VII [Enterococcus casseliflavus EC20]
          Length = 450

 Score =  251 bits (642), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 141/396 (35%), Positives = 232/396 (58%), Gaps = 25/396 (6%)

Query: 14  EY-SVSELSYHLKH--IVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           EY +V+ L+ ++K    V+  L  V + GEIS +R      H YFSLKD+ ++I  +++K
Sbjct: 4   EYLTVTALTKYIKRKFDVDPYLERVYLTGEISNFR--RRPNHQYFSLKDDGAKISTVMFK 61

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           G  +K+ F PEEG++ + +G+IT +  S  YQ++I+ + P G G L  A E+ K+KL  E
Sbjct: 62  GAFDKLRFQPEEGLKVMAVGRITLYEASGNYQMVIDHMEPDGVGALYQAYEQLKQKLAAE 121

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKE 189
           GLFS   K  +P  PK IAV+TSP+GAVIRDI+     R+P+ +++++P  VQG++   +
Sbjct: 122 GLFS-APKQSLPKYPKRIAVLTSPSGAVIRDIITTTQRRYPIAQIVLYPTVVQGNKAADD 180

Query: 190 IANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGH 249
           +   I ++    +G      D +I+ RGGGSIEDLW FN+E + RAI ++  PIIS++GH
Sbjct: 181 VVKNIQRVEA--DGTF----DTMIIGRGGGSIEDLWPFNEERVARAIFDAKTPIISSVGH 234

Query: 250 ETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLE---ARLNNIIIRLIKYKINT 306
           ETD T+AD  AD+RA TPT AAE+AVPV   L   ++ +E   ARL    +  I+YK   
Sbjct: 235 ETDTTIADLVADVRAATPTAAAELAVPV---LSEEILRIEERQARLEQAFMHQIQYKQER 291

Query: 307 LNSLLKA--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              ++ +      ++       +LD+L + ++  L+ +++ K R    +I+R+       
Sbjct: 292 YQRVIGSYVFRQPERLYEAQSIKLDQLQQRMQQGLQTLLYDKDRQAQQLISRLAQQQPKA 351

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIA 400
            +Q + Q +     ++ Q + + ++ I+  K+ + A
Sbjct: 352 RLQASNQEV----SYLSQRLTKAMKDIYAAKENQFA 383


>gi|317128427|ref|YP_004094709.1| exodeoxyribonuclease VII large subunit [Bacillus cellulosilyticus
           DSM 2522]
 gi|315473375|gb|ADU29978.1| exodeoxyribonuclease VII, large subunit [Bacillus cellulosilyticus
           DSM 2522]
          Length = 460

 Score =  251 bits (642), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 146/369 (39%), Positives = 213/369 (57%), Gaps = 12/369 (3%)

Query: 10  LDHPEYSVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           +D    SVS+++  +K +VE++  L +V +R EIS ++  HS GH YF+LKD+ SRI+++
Sbjct: 1   MDQEFLSVSDVTRRIKRLVETDAVLQNVWLRAEISNFKW-HSRGHMYFTLKDDKSRINSV 59

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           ++ G    ++F PE G+  LV G I+ +    +YQ+ ++ + P G G L  A E+ KKKL
Sbjct: 60  MFAGNNRYLKFTPENGMNVLVRGDISVYEPHGQYQLYVKEMQPDGIGNLYLAYEELKKKL 119

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDEC 186
              G FS + K  IP  PK IAV TSPTGA +RDIL  +  RFPL +VI+ PV VQG E 
Sbjct: 120 EMAGYFSRERKKAIPTFPKTIAVATSPTGAAVRDILTTVHRRFPLTKVILLPVLVQGPEA 179

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
              IA AI Q N           D++I+ RGGGS+E+LW FN++++  AI  S IPIISA
Sbjct: 180 APSIARAIKQAN------FAGIFDVMIIGRGGGSLEELWAFNEQIVAEAIYESKIPIISA 233

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T++D+ ADLRAPTPT AAE+AVP    L   + +  +RL   + RL   +   
Sbjct: 234 VGHETDVTISDFVADLRAPTPTAAAELAVPHIHELLKRVQDQRSRLIQTMDRLKSVQRER 293

Query: 307 LNSLLK--ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
           L  L K  A     + +      LDRL   +   + + + ++      +  RI+     H
Sbjct: 294 LGHLSKSYAFKYPKRLIEQKEQDLDRLVELMTKTMMLNVDKQKDKLQGLKGRIQRMHPTH 353

Query: 365 NIQKNRQHI 373
            + + R+ I
Sbjct: 354 KLLQERKRI 362


>gi|257865768|ref|ZP_05645421.1| exonuclease VII [Enterococcus casseliflavus EC30]
 gi|257872103|ref|ZP_05651756.1| exonuclease VII [Enterococcus casseliflavus EC10]
 gi|257799702|gb|EEV28754.1| exonuclease VII [Enterococcus casseliflavus EC30]
 gi|257806267|gb|EEV35089.1| exonuclease VII [Enterococcus casseliflavus EC10]
          Length = 450

 Score =  251 bits (642), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 141/396 (35%), Positives = 232/396 (58%), Gaps = 25/396 (6%)

Query: 14  EY-SVSELSYHLKH--IVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           EY +V+ L+ ++K    V+  L  V + GEIS +R      H YFSLKD+ ++I  +++K
Sbjct: 4   EYLTVTALTKYIKRKFDVDPYLERVYLTGEISNFR--RRPNHQYFSLKDDGAKISTVMFK 61

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           G  +K+ F PEEG++ + +G+IT +  S  YQ++I+ + P G G L  A E+ K+KL  E
Sbjct: 62  GAFDKLRFQPEEGMKVMAVGRITLYEASGNYQMVIDHMEPDGVGALYQAYEQLKQKLAAE 121

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKE 189
           GLFS   K  +P  PK IAV+TSP+GAVIRDI+     R+P+ +++++P  VQG++   +
Sbjct: 122 GLFS-APKQSLPKYPKRIAVLTSPSGAVIRDIITTTQRRYPIAQIVLYPTVVQGNKAADD 180

Query: 190 IANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGH 249
           +   I ++    +G      D +I+ RGGGSIEDLW FN+E + RAI ++  PIIS++GH
Sbjct: 181 VVKNIQRVEA--DGTF----DTMIIGRGGGSIEDLWPFNEERVARAIFDAKTPIISSVGH 234

Query: 250 ETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLE---ARLNNIIIRLIKYKINT 306
           ETD T+AD  AD+RA TPT AAE+AVPV   L   ++ +E   ARL    +  I+YK   
Sbjct: 235 ETDTTIADLVADVRAATPTAAAELAVPV---LSEEILRIEERQARLEQAFMHQIQYKQER 291

Query: 307 LNSLLKA--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              ++ +      ++       +LD+L + ++  L+ +++ K R    +I+R+       
Sbjct: 292 YQRVIGSYVFRQPERLYEAQSIKLDQLQQRMQQGLQTLLYDKDRQAQQLISRLAQQQPKA 351

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIA 400
            +Q + Q +     ++ Q + + ++ I+  K+ + A
Sbjct: 352 RLQASNQEV----SYLSQRLTKAMKDIYAAKENQFA 383


>gi|297529438|ref|YP_003670713.1| exodeoxyribonuclease VII large subunit [Geobacillus sp. C56-T3]
 gi|297252690|gb|ADI26136.1| exodeoxyribonuclease VII, large subunit [Geobacillus sp. C56-T3]
          Length = 448

 Score =  251 bits (641), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 160/477 (33%), Positives = 245/477 (51%), Gaps = 53/477 (11%)

Query: 25  KHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNKIEFLPEEGI 84
           K  V+ +L  + V+GEIS ++  HS GH YF+LKD+  RI A+++ G    + F PE+G+
Sbjct: 18  KFDVDPHLRDLWVKGEISNFKQ-HSRGHMYFTLKDSQGRIAAVMFAGYNQHLPFRPEDGM 76

Query: 85  EFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSDQHKNPIPFI 144
             L  G+I+ +  +  YQ+ ++ + P G G+L  A E+ K++L  EGLFS  HK P+P  
Sbjct: 77  NVLARGEISVYEPNGNYQLYVKEMQPEGVGSLYLAYEQLKQRLEAEGLFSPVHKKPLPAF 136

Query: 145 PKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIANAILQLNTLKEG 203
           P+ I V+TS TGA +RDI+  I  R+PL +VI+FP  VQGD     I  AI + N     
Sbjct: 137 PRCIGVVTSQTGAAVRDIMTTIRRRYPLAKVILFPALVQGDGAAPSIVRAIERANAFGG- 195

Query: 204 RTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWTLADYAADLR 263
                 D++I+ RGGGSIE+LW FN+E++ RAI  S IPIISA+GHETD+T+AD+ ADLR
Sbjct: 196 -----VDVLIVGRGGGSIEELWAFNEEIVARAIFASKIPIISAVGHETDFTIADFVADLR 250

Query: 264 APTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKALPNSDQTLSC 323
           APTPT AAEMA P    L   L   + RL    IR +K ++      L+ L  S      
Sbjct: 251 APTPTAAAEMAAPHVGELAERLAERKWRL----IRAMKERLAADKEQLRRLQGS----YA 302

Query: 324 SRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHILEKQQHIEQI 383
            RY   RL  + E  L                    D L+  + + R+ +++K  H +++
Sbjct: 303 FRY-PKRLYEQKEQQL--------------------DALLERLSRQRERLVDK--HRQRL 339

Query: 384 VKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSHKIKSCHTSVS 443
            +  +R   L +    A L  ++E+ K     L   ++  + R  F     +        
Sbjct: 340 HELDMR---LWRHHPAAELERMKERQKAAANALEKAMRTAVERHRFRFRSNLAR------ 390

Query: 444 ITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDGQANAIVIN 500
                L++ +    ++RGY+ + +     + +   L     + I   DG+ +  V  
Sbjct: 391 -----LEALSPLRIMERGYSLVYNEQGELVKRTNQLRIGEHLSIQVQDGRVDCQVTG 442


>gi|160934294|ref|ZP_02081681.1| hypothetical protein CLOLEP_03165 [Clostridium leptum DSM 753]
 gi|156866967|gb|EDO60339.1| hypothetical protein CLOLEP_03165 [Clostridium leptum DSM 753]
          Length = 406

 Score =  251 bits (641), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 125/284 (44%), Positives = 186/284 (65%), Gaps = 9/284 (3%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +VS+L++++K +++ N  L  V + GEIS +   + SGH YFSLKD  S I  +++    
Sbjct: 6   TVSQLNFYIKSLLDGNDALKQVFLTGEISNFTDHYRSGHFYFSLKDEKSVIKCVMFSRYS 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
           +++ F PE+G++ LV G ++ +  S +YQ+ +E + P G G L  A E+ K+KL +EGLF
Sbjct: 66  SRVRFHPEDGMKVLVRGGVSVYEASGQYQLYVEDMRPEGIGALNLAFEQLKQKLEKEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIF-PVKVQGDECPKEIAN 192
           S Q K PIP  P  + VITSPTGA ++DI   +  R P   IIF PV VQG+E P ++ +
Sbjct: 126 SPQRKRPIPPFPSRVGVITSPTGAAVQDIKSILGRRDPAAEIIFCPVLVQGEEAPGQLID 185

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           A+ ++N +      P  D++I+ RGGGS+EDLW FNDE + R I+ S IP+ISA+GHETD
Sbjct: 186 AVKRMNRI------PDIDVLIIGRGGGSLEDLWAFNDESLARTISQSRIPVISAVGHETD 239

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNII 296
           +T+ D+AADLRAPTP+ AAE+AVP     Q+  + +  +L   +
Sbjct: 240 FTICDFAADLRAPTPSAAAELAVPDMREYQAYFLQVCRKLKQAV 283


>gi|158521676|ref|YP_001529546.1| exodeoxyribonuclease VII, large subunit [Desulfococcus oleovorans
           Hxd3]
 gi|158510502|gb|ABW67469.1| exodeoxyribonuclease VII, large subunit [Desulfococcus oleovorans
           Hxd3]
          Length = 448

 Score =  251 bits (641), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 133/357 (37%), Positives = 219/357 (61%), Gaps = 16/357 (4%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
           Y+VS L+  +K ++E     + V GEIS ++    SGH YF+LKD+ +++ A+++     
Sbjct: 14  YTVSRLTGEIKVLLEKQFPIIWVEGEISNFKR-PGSGHFYFTLKDSTAQVQAVMFVNQNR 72

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
            ++F+PE+G++   +G+I+ +     YQ+I E ++P G G L+ A E+ KKKL +EGLF 
Sbjct: 73  GLKFMPEDGMKITGLGRISVYAPRGNYQVIFEHIMPQGMGELVAAFEQLKKKLADEGLFD 132

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANA 193
              K P+PF+P  + +I+SPTGAV+ D++  ++ RFP + + I P  VQGD+   EIA A
Sbjct: 133 PGRKKPVPFLPAKVCLISSPTGAVVHDMIHVMTRRFPGIEIEILPASVQGDKAAVEIAAA 192

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           +   N   +       D++++ARGGGS+EDL+ FN E + RA+A S+IP++SA+GHETD+
Sbjct: 193 LALANRRADA------DVLVVARGGGSLEDLFAFNTETVARAVAASAIPVVSAVGHETDF 246

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           T+ D+ ADLRAPTP+ AAE+ VPVK+ L +   NL  R+      +I+++   L  + K 
Sbjct: 247 TICDFVADLRAPTPSAAAELIVPVKKELLAHCRNLRVRMVKGFDNIIRHRRRALRDMAKR 306

Query: 314 LPNSDQTLSCSRYRLDRLP--------RELEHNLEIIIFRKYRHFNHIINRIKSDFL 362
           L +  + L  +  RLD L         RE+    E + +++ + F+ +  R+ ++ L
Sbjct: 307 LIDPRRALGDALLRLDELAMRLVRALDREIAKRAERLAWQQKQLFSRMPERLTTEGL 363


>gi|226311925|ref|YP_002771819.1| exodeoxyribonuclease VII large subunit [Brevibacillus brevis NBRC
           100599]
 gi|254783691|sp|C0ZC06|EX7L_BREBN RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|226094873|dbj|BAH43315.1| probable exodeoxyribonuclease VII large subunit [Brevibacillus
           brevis NBRC 100599]
          Length = 460

 Score =  251 bits (640), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 155/440 (35%), Positives = 242/440 (55%), Gaps = 14/440 (3%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           SVS+L+ ++K ++E    L  + VRGEIS +   HSSGH YF+LKD  SRI  +++    
Sbjct: 8   SVSDLNRYIKLVLEKEPHLQDIWVRGEISNFTH-HSSGHMYFTLKDKQSRIKVVMFASYN 66

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             + FLP++G + +V G I+ +     YQ   + + P G G+L  A E+ K+KL +EGLF
Sbjct: 67  RFLRFLPKDGAKAIVRGSISAYERDGAYQFYAKEMQPDGLGSLYLAFEQLKEKLAQEGLF 126

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIAN 192
           + + K  +P  PK + V+TSPTGA IRDI   I  R+P   +++ P  VQG + P  I +
Sbjct: 127 AAERKRMLPRFPKRVGVVTSPTGAAIRDICTTIRRRYPQAEIVLSPAVVQGADAPASIVS 186

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI  +N        P  D++I+ RGGGSIE+LW FNDE + RAIA S IP+ISA+GHETD
Sbjct: 187 AIRIMN------DQPDIDVLIVGRGGGSIEELWAFNDENVARAIATSLIPVISAVGHETD 240

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            T+AD+ AD+RA TPT AAE+AVP        +  LE R++  +   +  + N L  L  
Sbjct: 241 VTIADFVADVRAATPTAAAELAVPHYLEWVERVRQLEIRMHRAVRGTMTEQRNRLTRLGN 300

Query: 313 --ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNR 370
             A+   ++ L  +  RLDR    +  +++ ++ R+   +  +  +IK   L   I + R
Sbjct: 301 SYAMRQPERRLEEAAERLDRAHLRMRQSMKHLLDRRRERYTRLDEQIKRYRLADQIGEKR 360

Query: 371 QHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLRE-QTKNRIFYLHTHIKKLITRIE- 428
           +++ + +  +++ +   L    +    +IA L  L   +   R F L     +L+  +E 
Sbjct: 361 KNLSKLRATLDERMLGRLNQKRMAFAARIATLEALSPLKVMQRGFSLVYTNDRLVKSVEQ 420

Query: 429 FILSHKIKSCHTSVSITTRI 448
           F    +I    +  S T R+
Sbjct: 421 FAPGDEIMVRLSDGSATARV 440


>gi|325509497|gb|ADZ21133.1| exodeoxyribonuclease VII large subunit [Clostridium acetobutylicum
           EA 2018]
          Length = 399

 Score =  251 bits (640), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 137/315 (43%), Positives = 198/315 (62%), Gaps = 11/315 (3%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           SVSEL+ ++K +V+S+  LS+  V+GEIS ++  HSSGH YFSLKD   +I+ I+++   
Sbjct: 7   SVSELNNYIKRVVDSDYILSNAQVKGEISNFK-FHSSGHVYFSLKDEGGKINCIMFRSNA 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            K++F+PE G++  V G+++ +     YQ+    + P G G L  A EK K+KLL EG+F
Sbjct: 66  EKLKFIPENGMKVNVKGRVSVYVKDGAYQLYCTEITPEGRGELYEAFEKLKEKLLNEGMF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRF-PLRVIIFPVKVQGDECPKEIAN 192
           S++HK  IP  PK+I VITSPTGA IRDI+   + R   + +II P  VQG   P E+  
Sbjct: 126 SEEHKRNIPKYPKMIGVITSPTGAAIRDIINVATRRNKSVDMIICPTLVQGVNAPGELIK 185

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           A+  LN  ++       D IILARGGGSIE+LW FNDE +  A+ NS  P+++ +GHETD
Sbjct: 186 ALDYLNNRED------IDTIILARGGGSIEELWAFNDEKLAYAVYNSKKPVVTGVGHETD 239

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+ D+ +D RAPTP+ AAE+AVP      +S ++L+  L+  I   I+ K N L    +
Sbjct: 240 FTIVDFVSDRRAPTPSAAAEIAVPNINEEMNSFVSLKRALDTSIKTYIQNKCNQLEIAKR 299

Query: 313 ALP-NSDQTLSCSRY 326
            L  NS + L  + Y
Sbjct: 300 MLEKNSPEILIVNGY 314


>gi|258591117|emb|CBE67412.1| Exodeoxyribonuclease 7 large subunit (Exodeoxyribonuclease VII
           large subunit) (Exonuclease VII large subunit) [NC10
           bacterium 'Dutch sediment']
          Length = 413

 Score =  251 bits (640), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 126/283 (44%), Positives = 187/283 (66%), Gaps = 8/283 (2%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
           Y+VS+L+  ++  +E + + + V GE+S +   HSSGH YFSLKD  S+I  ++++    
Sbjct: 10  YTVSDLTTEIRATLEGSFAGIWVEGELSNFHR-HSSGHMYFSLKDEGSQIRVVMFRTANR 68

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
           ++ F P++G+  LV G+++ +    +YQ++ E + P G G L  A E+ K++L  EGLF 
Sbjct: 69  QLRFQPKDGLVLLVYGELSVYERRGEYQLVAEYMEPKGLGALQLAFEQLKQRLQAEGLFD 128

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANA 193
           D  K PIP +P+ I V+TSPTGA +RDIL  +  RF  + V+I PV VQGD+   EI  A
Sbjct: 129 DARKRPIPLLPRRIGVVTSPTGAAVRDILHVLRRRFAGVDVLICPVAVQGDQAAPEIVEA 188

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           + +LN  + G      D++I+ARGGGSIEDL  FN+E + RAIA S IP+ISAIGHE D+
Sbjct: 189 LGELN--RRGGL----DVVIVARGGGSIEDLQAFNEESVARAIAASRIPVISAIGHEIDY 242

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNII 296
           T+AD+ ADLRAPTP+ AAE+ +  ++ L   L +L +R+  +I
Sbjct: 243 TIADFVADLRAPTPSAAAELVIARQDELLQRLDDLGSRMAGVI 285


>gi|197117643|ref|YP_002138070.1| exodeoxyribonuclease VII large subunit [Geobacter bemidjiensis Bem]
 gi|226736762|sp|B5EI10|EX7L_GEOBB RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|197087003|gb|ACH38274.1| exodeoxyribonuclease VII, large subunit [Geobacter bemidjiensis
           Bem]
          Length = 458

 Score =  251 bits (640), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 162/481 (33%), Positives = 249/481 (51%), Gaps = 56/481 (11%)

Query: 16  SVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNK 75
           +VS L+  ++ ++E N   V V GEIS       SGH YF+LKD  ++I  ++++G    
Sbjct: 11  TVSALTALVRGLLEENFEQVWVEGEISNL-ACPQSGHCYFTLKDVGAQIRCVMFRGAFRS 69

Query: 76  IEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSD 135
           ++F P +G+  L  G++T F    +YQ++ + L P G G L  A  + K+KL +EGLFS+
Sbjct: 70  LKFTPRDGMRILTRGRLTLFEPRGEYQLVADYLEPQGIGGLQMAFIQLKEKLAKEGLFSE 129

Query: 136 QHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANAI 194
            HK  IP +P+ I V+TSPTGA IRDIL  ++ RF  + ++I PV+VQGD   +EIA+AI
Sbjct: 130 LHKREIPKLPRRIGVVTSPTGAAIRDILTVLNRRFTNVELLISPVRVQGDGAAREIADAI 189

Query: 195 LQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWT 254
             LN +         D++I+ RGGGS+EDLW FN+E++ RAI  S +P+ISA+GHE D+T
Sbjct: 190 DDLNRVGN------LDVMIVGRGGGSLEDLWAFNEEVVARAIHRSKVPVISAVGHEIDFT 243

Query: 255 LADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKAL 314
           +AD+ ADLRA TP+ AAE+ V  K+ L + +  L  RL+                     
Sbjct: 244 IADFVADLRAATPSAAAEIVVASKKELTAEVEALTHRLH--------------------- 282

Query: 315 PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHIL 374
                     + RL+R  R L   L   I    R   H+  R+  D L   + +    IL
Sbjct: 283 -------VSQQRRLER-SRALVTALSRAITDPSRFLGHLAQRV--DSLDARLTREAGLIL 332

Query: 375 EKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSHK 434
           +     E+IV    R   L ++     L    E+           +  L  R++  ++ +
Sbjct: 333 DDAS--ERIVTLTAR---LSRQTPALTLKRWEER-----------LATLSLRLDHAMTRR 376

Query: 435 IKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDT-NNNFITQKRNLATKTRILINFFDGQ 493
           +     S+ + T  L + +   TL RGY+  +     + +T  R LA   R+ ++F  G 
Sbjct: 377 LAVAAESIGLATGTLNAVSPLATLSRGYSITRKLPARSVVTSSRQLAPGDRVEVSFAAGS 436

Query: 494 A 494
           A
Sbjct: 437 A 437


>gi|196228978|ref|ZP_03127844.1| exodeoxyribonuclease VII, large subunit [Chthoniobacter flavus
           Ellin428]
 gi|196227259|gb|EDY21763.1| exodeoxyribonuclease VII, large subunit [Chthoniobacter flavus
           Ellin428]
          Length = 458

 Score =  251 bits (640), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 156/487 (32%), Positives = 247/487 (50%), Gaps = 53/487 (10%)

Query: 16  SVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIW--KGTL 73
           SVSEL+  ++  +E ++  V V GEIS YR    SGH YF+LKD  S++ A +W  +G L
Sbjct: 20  SVSELTRAVRATLEDHIGQVWVEGEISNYRK-QPSGHQYFTLKDEQSQV-ACVWFARGGL 77

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
              +    +G+   V G +T +    +YQ+ ++++  +G+G L    E  K+KL  EGLF
Sbjct: 78  RMKQVALSDGMHVQVRGALTVYEARGQYQLNVQTVQAAGAGLLQAKFEALKRKLEAEGLF 137

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIAN 192
             + K P+P  P  I ++TS   A +RD+L  ++ R P +RV+I PV+VQG    +EIA 
Sbjct: 138 DPERKRPLPRFPMTIGLVTSSNAAALRDMLNILARRAPWVRVVINPVRVQGQGAAQEIAG 197

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI + N LKE    P  D+I++ RGGGSIEDLW FN+E++ RAI  S++P++SA+GHE D
Sbjct: 198 AIAEFNDLKEQGILPL-DVIVVGRGGGSIEDLWEFNEEIVARAIVQSAVPVVSAVGHEID 256

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+AADLRAPTP+ AAE+ VP  E L+   +   ARL      L+  + N L  L +
Sbjct: 257 FTIADFAADLRAPTPSAAAELIVPDGEALRRYFVESRARLQRCAAGLLLRERNRLTYLSR 316

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
               S QTL                       R  R +   ++ +  + L   IQ+ R  
Sbjct: 317 V--ASPQTL----------------------LRTLREYTQRVD-MAGEILRRTIQEQRLA 351

Query: 373 ILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH-IKKLITRIEFIL 431
              +   +   +++HL                      +R   L+ H +    TR+    
Sbjct: 352 AERRLLDLRARLREHL---------------------PDRHLPLYRHRLAAAQTRLANCA 390

Query: 432 SHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFD 491
              ++      +    +L++ +   TL RGY+         I   +++A +T++     D
Sbjct: 391 RANLQKLQQRFAHAETLLKALSPDATLARGYSITSVQGGAIIRSAKDVAPQTKLTTRLKD 450

Query: 492 GQANAIV 498
           G  +++V
Sbjct: 451 GTIDSVV 457


>gi|125717529|ref|YP_001034662.1| exodeoxyribonuclease VII large subunit [Streptococcus sanguinis
           SK36]
 gi|158513224|sp|A3CLQ7|EX7L_STRSV RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|125497446|gb|ABN44112.1| Exodeoxyribonuclease VII large subunit, putative [Streptococcus
           sanguinis SK36]
          Length = 446

 Score =  251 bits (640), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 156/392 (39%), Positives = 223/392 (56%), Gaps = 29/392 (7%)

Query: 13  PEY-SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIW 69
           PEY SVS L+ +LK   E +  L  V + G++S +R      H YFSLKD  + I   IW
Sbjct: 2   PEYLSVSTLTKYLKMKFERDPYLERVYLTGQVSNFR--RRPNHQYFSLKDEKAVIQVTIW 59

Query: 70  KGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLE 129
            G   K+ F  EEG++  VIG++  +  S  Y IIIE   P G G L    E+ KKKL E
Sbjct: 60  SGVYQKLGFELEEGMKINVIGRVQLYEPSGSYSIIIEKAEPDGIGALAIQFEQLKKKLGE 119

Query: 130 EGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPK 188
           EGLF D+ K  +P  PK I V+TSP+GAVIRDI+  +S RFP + ++++P KVQGD    
Sbjct: 120 EGLFQDKFKQALPQFPKKIGVVTSPSGAVIRDIITTVSRRFPGVEIVLYPTKVQGDGAAA 179

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           ++A+ I     L   R+    D++I+ RGGGSIEDLW FN+E  VRAI  S IP+IS++G
Sbjct: 180 QVADHI----RLANERSV--LDVLIIGRGGGSIEDLWAFNEEKTVRAIFESRIPVISSVG 233

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPV-KEHLQSSLINLEARLNNIIIRLIKYKINTL 307
           HETD TLAD+ AD RA TPT AAE+A PV K  L   L   E R++  I   + Y    L
Sbjct: 234 HETDTTLADFVADHRAATPTAAAELATPVTKLDLLGHLQQQENRMSRAISNRLSYYRERL 293

Query: 308 NSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHN 365
           N L +++     ++       +LD+L   L+  +     R+Y  ++    R+K   L H 
Sbjct: 294 NKLTQSVIFRQPERLYDGHLQKLDQLNLRLKQKI-----REY--YSEEQQRVK--ILQHR 344

Query: 366 IQ-----KNRQHILEKQQHIEQIVKQHLRYIF 392
           ++        QH+ E+   +E++++ ++  I+
Sbjct: 345 LEALNPLSRVQHLQEQTAQLERLLRSNMAVIY 376


>gi|254490067|ref|ZP_05103260.1| exodeoxyribonuclease VII, large subunit [Methylophaga thiooxidans
           DMS010]
 gi|224464731|gb|EEF80987.1| exodeoxyribonuclease VII, large subunit [Methylophaga thiooxydans
           DMS010]
          Length = 485

 Score =  250 bits (639), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 145/458 (31%), Positives = 255/458 (55%), Gaps = 28/458 (6%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
           Y VS L    + ++E +   + V GEIS    + +SGH YF+LKD  +++   +++    
Sbjct: 5   YPVSRLVREARVLLEGSFPLLWVEGEISNL-AMPASGHIYFTLKDEAAQVRCAMFRNRNR 63

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
           ++ F PE G++ L+  ++T + G  ++Q+++E +  +GSG L  A E  K++L +EGLF 
Sbjct: 64  QLRFTPENGMQVLLRVRVTLYEGRGEFQLVVEHMEEAGSGALQRAYEALKQRLGQEGLFD 123

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLR-VIIFPVKVQGDECPKEIANA 193
           D HK PIP +P  I +I+SP GA + DI+  +  RFP   VI++PV VQG+   +++ +A
Sbjct: 124 DAHKKPIPALPHTIGIISSPDGAAVHDIVSVLKRRFPAAAVILYPVAVQGEAAARQLVDA 183

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           +   +  K+   C   D++I+ RGGGS+EDLW FNDE + RA+ N  +P+ISA+GHE D+
Sbjct: 184 VKLADHRKD---C---DVLIIGRGGGSLEDLWSFNDEQLARALFNCELPVISAVGHEIDF 237

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           T+AD+ AD+RAPTP+ AAE+AVP  + L + +  L  RL  +  + +  +   L  L + 
Sbjct: 238 TIADFVADVRAPTPSAAAEIAVPDAKQLLAKIQGLTQRLTVMTKQWLVSEQRHLQHLQRR 297

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           LP  D  L+  R  L++  + L    + I+    +  +++  R+          K+ Q  
Sbjct: 298 LPRPDVQLNQQRQVLNQQTKLLGSAWQRILMSSQQKLDYLSARL----------KHPQAQ 347

Query: 374 LEKQQH----IEQIVKQHLRYIFLEKKEKIAILHML----REQTKNRIFYLHTHIKKLIT 425
           ++KQQ     ++  + Q  R  F  K  + A+L +     R+   + +   H  +  +  
Sbjct: 348 IDKQQSKLAALQHRLGQAFRAEF--KHSETALLSLQQRLHRQLPTHAVIRHHEALSLVRK 405

Query: 426 RIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYT 463
           +++ ++  ++ +   ++    R L + +  NTL+RGY+
Sbjct: 406 QLDRLMLMQLDTAKQALKQQVRTLAAVSPLNTLERGYS 443


>gi|15895352|ref|NP_348701.1| exodeoxyribonuclease VII large subunit [Clostridium acetobutylicum
           ATCC 824]
 gi|22095674|sp|Q97HD0|EX7L_CLOAB RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|15025070|gb|AAK80041.1|AE007710_11 Exonuclease VII, large subunit [Clostridium acetobutylicum ATCC
           824]
          Length = 399

 Score =  250 bits (639), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 137/315 (43%), Positives = 198/315 (62%), Gaps = 11/315 (3%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           SVSEL+ ++K +V+S+  LS+  V+GEIS ++  HSSGH YFSLKD   +I+ I+++   
Sbjct: 7   SVSELNNYIKRVVDSDYILSNAQVKGEISNFK-FHSSGHVYFSLKDEGGKINCIMFRSNA 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            K++F+PE G++  V G+++ +     YQ+    + P G G L  A EK K+KLL EG+F
Sbjct: 66  EKLKFIPENGMKVNVKGRVSVYVKDGAYQLYCTEITPEGRGELYEAFEKLKEKLLNEGMF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRF-PLRVIIFPVKVQGDECPKEIAN 192
           S++HK  IP  PK+I VITSPTGA IRDI+   + R   + +II P  VQG   P E+  
Sbjct: 126 SEEHKRNIPKYPKMIGVITSPTGAAIRDIINVATRRNKSVDMIICPTLVQGVNAPGELIK 185

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           A+  LN  ++       D IILARGGGSIE+LW FNDE +  A+ NS  P+++ +GHETD
Sbjct: 186 ALDYLNNRED------IDTIILARGGGSIEELWAFNDEKLAYAVYNSKKPVVTGVGHETD 239

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+ D+ +D RAPTP+ AAE+AVP      +S ++L+  L+  I   I+ K N L    +
Sbjct: 240 FTIVDFVSDRRAPTPSAAAEIAVPNINEEMNSFVSLKRALDTSIKTYIQNKCNQLEIAKR 299

Query: 313 ALP-NSDQTLSCSRY 326
            L  NS + L  + Y
Sbjct: 300 MLEKNSPEILIVNGY 314


>gi|323702774|ref|ZP_08114434.1| exodeoxyribonuclease VII, large subunit [Desulfotomaculum
           nigrificans DSM 574]
 gi|323532291|gb|EGB22170.1| exodeoxyribonuclease VII, large subunit [Desulfotomaculum
           nigrificans DSM 574]
          Length = 401

 Score =  250 bits (639), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 138/352 (39%), Positives = 217/352 (61%), Gaps = 20/352 (5%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           SVSEL+ ++K  +ES+  L+++ V+GEIS  + IHSSGH YF+LKD  S + A++++   
Sbjct: 5   SVSELTKYIKDKIESDYILANIWVKGEISNLK-IHSSGHIYFTLKDQESCLKAVMFRSRG 63

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            ++ F PE G+  +V G ++ +     YQ+  E + P G G L  A E+ K+KL   GLF
Sbjct: 64  RRLLFRPEYGMHVIVRGYVSVYERDGTYQLYAEEMEPDGIGALYIAFEQMKQKLAARGLF 123

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIAN 192
            +  K PIP IP+++ +ITSPTGA ++D+L  +  R+  +++I+ PV VQG+  P EIA 
Sbjct: 124 DEGRKRPIPRIPRVVGIITSPTGAAVQDMLNIMRRRWSGVQIILAPVLVQGESAPGEIAR 183

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI ++N +         D++I+ RGGGS+E+LW FN E +  AIANS+IP+ISA+GHETD
Sbjct: 184 AIGRMNQVGG------IDVLIVGRGGGSLEELWAFNTEEVAMAIANSAIPVISAVGHETD 237

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD  ADLRAPTP+ AAE+ VP +  +Q  L +L+ RL    ++ +   +      LK
Sbjct: 238 YTIADMVADLRAPTPSAAAELVVPDQREMQRYLRSLQQRL----VKAVHNNLERNRQRLK 293

Query: 313 ALPNSDQ-----TLSCSRYR-LDRLPRELEHNLEIIIFRKYRHFNHIINRIK 358
           A  NS        ++ +R + LDRL   L+    +++  K     ++  +++
Sbjct: 294 ACTNSPSLQRPFLITGNRQQTLDRLTTALQRAGRLMLADKSAALANLAGKLQ 345


>gi|125624489|ref|YP_001032972.1| exodeoxyribonuclease VII large subunit [Lactococcus lactis subsp.
           cremoris MG1363]
 gi|158512800|sp|A2RLU4|EX7L_LACLM RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|124493297|emb|CAL98266.1| exodeoxyribonuclease VII, large subunit [Lactococcus lactis subsp.
           cremoris MG1363]
 gi|300071278|gb|ADJ60678.1| exodeoxyribonuclease VII large subunit [Lactococcus lactis subsp.
           cremoris NZ9000]
          Length = 417

 Score =  250 bits (639), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 142/309 (45%), Positives = 193/309 (62%), Gaps = 19/309 (6%)

Query: 14  EY-SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           EY SVS L+ +LK   E +  L  V + GEIS +R      H YF+LKD  + I A +W 
Sbjct: 3   EYLSVSTLTKYLKAKFERDPYLERVYLTGEISNFR--RRPNHQYFALKDEGAVIQATMWA 60

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           G   K++F  EEG++ L IG+I+ +P S  Y I IESL+P G G L    E+ KKKL  E
Sbjct: 61  GQFRKLDFELEEGMKVLAIGRISIYPPSGSYSINIESLVPDGVGALALKFEQLKKKLAAE 120

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKE 189
           GLF  + K  +P   K IAV+TSP+GAVIRDI+  +  RFP+ +++++P KVQG    +E
Sbjct: 121 GLFDQRWKQNLPQFSKKIAVVTSPSGAVIRDIITTVQRRFPMSQIVLYPTKVQGAGAAEE 180

Query: 190 IANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGH 249
           I+  I + N   +       D++I+ RGGGSIEDLW FN+E++VRAI  S IPIIS++GH
Sbjct: 181 ISGNIRRANERGDF------DVMIIGRGGGSIEDLWGFNEEIVVRAIFESRIPIISSVGH 234

Query: 250 ETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINL----EARLNNIIIRLIKYKIN 305
           ETD TLAD+ AD RA TPT AAE+A P   + +  LIN     E+RL N +  LIK +  
Sbjct: 235 ETDVTLADFVADSRAATPTAAAELATP---NTKIDLINWANEQESRLFNRLTHLIKIRRE 291

Query: 306 TLNSLLKAL 314
            L  L +++
Sbjct: 292 RLEKLSQSV 300


>gi|281491349|ref|YP_003353329.1| exodeoxyribonuclease VII large subunit [Lactococcus lactis subsp.
           lactis KF147]
 gi|281375090|gb|ADA64608.1| Exodeoxyribonuclease VII, large subunit [Lactococcus lactis subsp.
           lactis KF147]
          Length = 417

 Score =  250 bits (638), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 140/309 (45%), Positives = 193/309 (62%), Gaps = 19/309 (6%)

Query: 14  EY-SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           EY SVS L+ +LK   + +  L  V + GEIS +R      H YF+LKD  + I A +W 
Sbjct: 3   EYLSVSTLTKYLKAKFDRDPYLERVYLTGEISNFR--RRPNHQYFALKDEGAVIQATMWA 60

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           G   K++F  EEG++ L +G+I+ +P S  Y I IESL+P G G L    E+ KKKL  E
Sbjct: 61  GQFRKLDFELEEGMKVLAVGRISIYPPSGSYSINIESLVPDGVGALAVKFEQLKKKLTAE 120

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKE 189
           GLF  + K  +P   K IAV+TSP+GAVIRDI+  +  RFP+ +++++P KVQG    +E
Sbjct: 121 GLFEQRWKQTLPQFSKKIAVVTSPSGAVIRDIITTVQRRFPMSQIVLYPTKVQGQGSAEE 180

Query: 190 IANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGH 249
           IA  I + N   +       D++I+ RGGGSIEDLW FN+E++VRAI  S IPIIS++GH
Sbjct: 181 IAGNIRRANQRGDF------DVMIIGRGGGSIEDLWGFNEEIVVRAIFESRIPIISSVGH 234

Query: 250 ETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINL----EARLNNIIIRLIKYKIN 305
           ETD TLAD+ AD RA TPT AAE+A P   + +  LIN     E RL N +  LIK +  
Sbjct: 235 ETDVTLADFVADSRAATPTAAAELATP---NTKVDLINWTNEQEKRLFNRLTHLIKIRRE 291

Query: 306 TLNSLLKAL 314
            ++ L +++
Sbjct: 292 RVDKLSQSV 300


>gi|218960584|ref|YP_001740359.1| Exonuclease VII large subunit [Candidatus Cloacamonas
           acidaminovorans]
 gi|167729241|emb|CAO80152.1| Exonuclease VII large subunit [Candidatus Cloacamonas
           acidaminovorans]
          Length = 446

 Score =  250 bits (638), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 123/279 (44%), Positives = 182/279 (65%), Gaps = 7/279 (2%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
           YSV E++  ++ ++E++L  V V GEISG+   HSSGH YF+LKD ++ +    +KG   
Sbjct: 7   YSVYEITRQVRQVIETSLQPVFVMGEISGFIR-HSSGHIYFNLKDENATLRCTFFKGANA 65

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
            + F P +G++ +  GK+T +     Y + ++ +  +G G L    E+ KKKL +EGLF+
Sbjct: 66  SLTFQPADGMQVICFGKLTVYEKGGYYNLNVQKMQEAGMGLLQQKFEQLKKKLEKEGLFA 125

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANAI 194
            +HK P+P  P  I +ITSPTGA ++DI+  I  R+P+ +I++P  VQG + P +I   I
Sbjct: 126 AEHKKPLPKYPDRIGIITSPTGAALQDIINIIKRRYPVELIVYPALVQGSDAPPQIIQGI 185

Query: 195 LQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWT 254
              N  ++       D II+ RGGGS EDL+ FNDE + RAI  SS+P+ISA+GHE D+T
Sbjct: 186 RYFNKTRD------VDFIIITRGGGSQEDLFCFNDEALARAIYASSLPVISAVGHEIDFT 239

Query: 255 LADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLN 293
           LAD+ ADLRAPTP+ AAE+AVP K+ L + L +L+ RL+
Sbjct: 240 LADFVADLRAPTPSAAAELAVPDKKDLLNLLASLKKRLD 278


>gi|120554649|ref|YP_959000.1| exodeoxyribonuclease VII large subunit [Marinobacter aquaeolei VT8]
 gi|120324498|gb|ABM18813.1| Exodeoxyribonuclease VII large subunit [Marinobacter aquaeolei VT8]
          Length = 451

 Score =  249 bits (637), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 164/486 (33%), Positives = 243/486 (50%), Gaps = 59/486 (12%)

Query: 16  SVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNK 75
           +VSEL++  +H++ES+   V V GE+SG+    SSGH YFSLKD   +I   +++G   +
Sbjct: 14  TVSELNHQARHLLESSFMQVWVEGELSGF-SRPSSGHWYFSLKDQKCQIRCAMFRGANQR 72

Query: 76  IEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSD 135
           I  LP EG +  + GK+T +     +QII+E L P+G G L  A E  K +L  EGLF  
Sbjct: 73  IRTLPREGDQIRIRGKVTLYENRGDFQIIVEHLEPAGLGALQQAFEALKARLQGEGLFDP 132

Query: 136 QHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANAI 194
             K PIP  P+ I V+TSPTGA I DIL  +  R P + V ++P  VQG     +I  AI
Sbjct: 133 ARKKPIPATPRHIGVVTSPTGAAIHDILTVLKRRCPAIPVTLYPTAVQGQPATADIVQAI 192

Query: 195 --LQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
              Q + L         D++I+ RGGGS+EDLW FN+E + RAIA   IP +SA+GHE D
Sbjct: 193 DRAQQHGLA--------DVLIIGRGGGSLEDLWCFNEEAVARAIAACPIPTVSAVGHEVD 244

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            T+AD+ ADLRAPTP+ AAE   P ++     L   + RL     RL++   N L  L  
Sbjct: 245 VTIADFVADLRAPTPSAAAEKISPDQQDWLRRLTEQQGRLGQSARRLLQRLDNQLGHLSA 304

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
            L +  + L     R+D    ELE  L   I  +         + K+D+L+  +      
Sbjct: 305 RLRDPRRELLEKAQRMD----ELELRLNKAIRDRLDQ-----QKQKTDYLLQRMSAQ--- 352

Query: 373 ILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILS 432
               ++ ++ + +Q  R   LE++  +A  H LR++ +                    L 
Sbjct: 353 --SPRRTLKTVREQTQR---LEERLTLATRHQLRQKDER-------------------LQ 388

Query: 433 HKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDG 492
           H  ++ H    +            TL RGY  ++D N+  + +  +L T ++I      G
Sbjct: 389 HIAQTLHVVSPLV-----------TLGRGYAIVKDDNDRIVRKAGDLETGSQITARLGHG 437

Query: 493 QANAIV 498
             +A V
Sbjct: 438 SVSARV 443


>gi|257899151|ref|ZP_05678804.1| exonuclease VII [Enterococcus faecium Com15]
 gi|257837063|gb|EEV62137.1| exonuclease VII [Enterococcus faecium Com15]
          Length = 445

 Score =  249 bits (637), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 126/294 (42%), Positives = 192/294 (65%), Gaps = 12/294 (4%)

Query: 14  EY-SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           EY +V+ L+ +LK   +++  L  V + GEIS +R + ++ H YFSLKD+H++I AI++K
Sbjct: 4   EYLTVTTLTRYLKRKFDADPYLERVYLTGEISNFR-LRANAHQYFSLKDDHAKISAIMFK 62

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           G   K+ F P+EG++ LV+G+I+ +     YQI +E + P G G L   LE+RK+KL++E
Sbjct: 63  GAFQKLRFQPKEGMKVLVVGRISLYEAGGSYQIYVEHMEPDGIGALYQELEERKEKLMKE 122

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKE 189
           GLF    K  +P  PK IA++TSP+GAVIRDI+  +  R+P+ ++++FP  VQG++    
Sbjct: 123 GLFQG-PKKMLPRFPKRIAILTSPSGAVIRDIITTVKRRYPIVQLVLFPTVVQGNQAADN 181

Query: 190 IANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGH 249
           +   I ++  + +       D +I+ RGGGSIEDLW FN+E + RAI  ++ P+IS++GH
Sbjct: 182 VVKNIRRVEEMGDF------DTMIIGRGGGSIEDLWPFNEERVARAIYQANTPVISSVGH 235

Query: 250 ETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYK 303
           ETD T+AD  AD+RA TPT AAE+AVPV       +   +ARL    +R I+ K
Sbjct: 236 ETDTTIADLVADVRAATPTAAAELAVPVLSEELMRIQERQARLQQAFVRQIQRK 289


>gi|257885165|ref|ZP_05664818.1| exonuclease VII [Enterococcus faecium 1,231,501]
 gi|261206505|ref|ZP_05921205.1| exonuclease VII [Enterococcus faecium TC 6]
 gi|289565415|ref|ZP_06445864.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecium
           D344SRF]
 gi|294618977|ref|ZP_06698472.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecium
           E1679]
 gi|257821017|gb|EEV48151.1| exonuclease VII [Enterococcus faecium 1,231,501]
 gi|260079215|gb|EEW66906.1| exonuclease VII [Enterococcus faecium TC 6]
 gi|289162744|gb|EFD10595.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecium
           D344SRF]
 gi|291594638|gb|EFF26020.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecium
           E1679]
          Length = 445

 Score =  249 bits (637), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 127/294 (43%), Positives = 191/294 (64%), Gaps = 12/294 (4%)

Query: 14  EY-SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           EY +V+ L+ +LK   +++  L  V + GEIS +R + ++ H YFSLKD+H++I AI++K
Sbjct: 4   EYLTVTTLTRYLKRKFDADPYLERVYLTGEISNFR-LRANAHQYFSLKDDHAKISAIMFK 62

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           G   K+ F P+EG++ LV+G+I+ +     YQI +E + P G G L   LE+RK+KL++E
Sbjct: 63  GAFQKLRFQPKEGMKVLVVGRISLYEAGGSYQIYVEHMEPDGIGALYQELEERKEKLMKE 122

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKE 189
           GLF    K  +P  PK IAV+TSP+GAVIRDI+  +  R+P+ ++++FP  VQG++    
Sbjct: 123 GLFQG-PKKMLPRFPKRIAVLTSPSGAVIRDIITTVKRRYPIVQLVLFPTVVQGNQAADN 181

Query: 190 IANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGH 249
           +   I ++  +         D +I+ RGGGSIEDLW FN+E + RAI  ++ P+IS++GH
Sbjct: 182 VVRNIQRVEEMGNF------DTMIIGRGGGSIEDLWPFNEERVARAIYQANTPVISSVGH 235

Query: 250 ETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYK 303
           ETD T+AD  AD+RA TPT AAE+AVPV       +   +ARL    +R I+ K
Sbjct: 236 ETDTTIADLVADVRAATPTAAAELAVPVLSEELMRIQERQARLQQAFVRQIQRK 289


>gi|300115025|ref|YP_003761600.1| exodeoxyribonuclease VII large subunit [Nitrosococcus watsonii
           C-113]
 gi|299540962|gb|ADJ29279.1| exodeoxyribonuclease VII, large subunit [Nitrosococcus watsonii
           C-113]
          Length = 452

 Score =  249 bits (637), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 157/481 (32%), Positives = 251/481 (52%), Gaps = 59/481 (12%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
           Y++S L    +H++E +   + + GE+S      SSGH YF+LKD  +++   +++G   
Sbjct: 15  YTISRLVREARHLLEGSFPLLWIEGEVSNL-SRPSSGHFYFTLKDKTTQVRCAMFRGRNR 73

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
            +    EEG++ L   ++  +    ++Q+I+E L  +G G L  A E  K++L  EGLF+
Sbjct: 74  LLGITLEEGMQILARVQVGLYEARGEFQLIVEYLEKAGDGALRRAFEALKQRLSSEGLFA 133

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANA 193
             HK  +P +P+ I +ITSP+GA IRDIL  +  RFP + V+I+PV VQG+   ++IA A
Sbjct: 134 TSHKRSLPILPRQIGIITSPSGAAIRDILSVLKRRFPTVPVLIYPVPVQGEGAAQKIATA 193

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I +    ++  TC   D++ILARGGGS+EDLW FN+E + RAI +  IPIIS +GHE D+
Sbjct: 194 IAKA---EQQHTC---DLLILARGGGSLEDLWAFNEEALARAIYHCPIPIISGVGHEIDF 247

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           T+AD+AAD RAPTP+ AAEMAVP       +++NLE RL ++  + ++Y   +L SL + 
Sbjct: 248 TIADFAADQRAPTPSAAAEMAVPDSREWYRNVLNLEQRLGSLFQQRLRYLRQSLESLTQR 307

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           L +    L     R+D    ELE  L+       R + H+                    
Sbjct: 308 LRHPQARLQEGAQRID----ELEQRLD-------RAWTHL-------------------- 336

Query: 374 LEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIF--YLHTHIKKLITRIEFIL 431
             K++ + Q+    L+   L   + +   H LR    N++   Y   H++K   ++E   
Sbjct: 337 --KRERLHQLGGLSLQLQRLNPAQYLKACH-LRLGELNQLLHTYQQQHLEKQRMQLE--- 390

Query: 432 SHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFD 491
                       +  R LQ+   + TL+RGY  +       + +   +    RI +   +
Sbjct: 391 ------------MAQRSLQAINPQTTLERGYAIVTGPKGIVLRKASQVQPGARIEVQLAE 438

Query: 492 G 492
           G
Sbjct: 439 G 439


>gi|15835222|ref|NP_296981.1| exodeoxyribonuclease VII large subunit [Chlamydia muridarum Nigg]
 gi|270285393|ref|ZP_06194787.1| exodeoxyribonuclease VII large subunit [Chlamydia muridarum Nigg]
 gi|270289407|ref|ZP_06195709.1| exodeoxyribonuclease VII large subunit [Chlamydia muridarum Weiss]
 gi|301336790|ref|ZP_07224992.1| exodeoxyribonuclease VII large subunit [Chlamydia muridarum
           MopnTet14]
 gi|14194733|sp|Q9PK65|EX7L_CHLMU RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|7190643|gb|AAF39436.1| exodeoxyribonuclease, large subunit [Chlamydia muridarum Nigg]
          Length = 516

 Score =  249 bits (637), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 178/527 (33%), Positives = 272/527 (51%), Gaps = 68/527 (12%)

Query: 9   SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAII 68
           S+  P   VS L+  +K+++E N   V V+GE+S    + +SGH YF++KD+ + ++   
Sbjct: 2   SITSPPVEVSVLTDSIKNLLEKNFLRVVVKGELSNV-SLQTSGHLYFAIKDSKAVLNGAF 60

Query: 69  WKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLL 128
           +       +  P++G   ++ GK+T +    +YQI+  +L  SG G LL   E+RK++L 
Sbjct: 61  FHFRSKYFDRRPKDGDYVILHGKLTVYAPRGQYQIVAYALTFSGEGNLLQQFEERKQRLA 120

Query: 129 EEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCR-FPLRVIIFPVKVQGDECP 187
            EG F  + K  IP   + I VITSPTGAVI+DIL+ +S R    +VI++PV VQG    
Sbjct: 121 AEGYFDPKRKRQIPSEARTIGVITSPTGAVIQDILRVLSRRCHQFQVILYPVTVQGPTAA 180

Query: 188 KEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAI 247
           +EI+ AI   N     +   + D +I+ARGGGSIEDLW FN+E++V+AIA SSIPIISA+
Sbjct: 181 QEISRAIQVFN-----QENIKIDTLIVARGGGSIEDLWAFNEEILVKAIAASSIPIISAV 235

Query: 248 GHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTL 307
           GHETD+TL D+AAD+RAPTP+ AAE+     E     L NL   L++   + I  K N L
Sbjct: 236 GHETDFTLCDFAADVRAPTPSAAAEIVCKSSEQYHQELQNLLRHLSSHSRQFIAAKKNLL 295

Query: 308 NSLLKALPNSD------QTLSCSRYRLDR-LPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           +   K L  +D      QTL  +R  L+R L  +LEH  +        H       +KSD
Sbjct: 296 SHWKKHLATADFYHTAQQTLDYTRLSLERTLDAKLEHYKQ--------HLAQYKRWLKSD 347

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLH--- 417
            LI    +  +H+    Q +E  +K  L         K+++  +   + KN +  L    
Sbjct: 348 ILI----RVEKHLSNLNQALESAIKNKLY------SNKVSLHQLYTSRFKNELPNLQHRT 397

Query: 418 THIKKLIT----RIEFILSHKIKSCHTSVSITTRILQSFAY------------------- 454
            H K L+     R+ F++++   S  T +    R+ + F++                   
Sbjct: 398 QHAKHLLNQLSRRLHFVMAN---SQETKLQRFARLQEEFSFMIQHLLTKAKERCQSVQEQ 454

Query: 455 ------KNTLKRGYTSIQDTN-NNFITQKRNLATKTRILINFFDGQA 494
                 KN LKRG+  + D N ++ I    +L     + +   DG+A
Sbjct: 455 MASLNPKNVLKRGFAQLFDFNKHSVIISAESLKQSDLVRVCLQDGEA 501


>gi|69244727|ref|ZP_00602991.1| Exonuclease VII, large subunit [Enterococcus faecium DO]
 gi|257879353|ref|ZP_05659006.1| exonuclease VII [Enterococcus faecium 1,230,933]
 gi|257881781|ref|ZP_05661434.1| exonuclease VII [Enterococcus faecium 1,231,502]
 gi|257890179|ref|ZP_05669832.1| exonuclease VII [Enterococcus faecium 1,231,410]
 gi|257893507|ref|ZP_05673160.1| exonuclease VII [Enterococcus faecium 1,231,408]
 gi|258615759|ref|ZP_05713529.1| exodeoxyribonuclease VII large subunit [Enterococcus faecium DO]
 gi|260558795|ref|ZP_05830984.1| exonuclease VII [Enterococcus faecium C68]
 gi|293560488|ref|ZP_06676980.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecium
           E1162]
 gi|294621589|ref|ZP_06700754.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecium
           U0317]
 gi|314937885|ref|ZP_07845201.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecium
           TX0133a04]
 gi|314941376|ref|ZP_07848269.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecium
           TX0133C]
 gi|314950135|ref|ZP_07853421.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecium
           TX0082]
 gi|314951324|ref|ZP_07854378.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecium
           TX0133A]
 gi|314992845|ref|ZP_07858246.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecium
           TX0133B]
 gi|314998049|ref|ZP_07862937.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecium
           TX0133a01]
 gi|68196318|gb|EAN10747.1| Exonuclease VII, large subunit [Enterococcus faecium DO]
 gi|257813581|gb|EEV42339.1| exonuclease VII [Enterococcus faecium 1,230,933]
 gi|257817439|gb|EEV44767.1| exonuclease VII [Enterococcus faecium 1,231,502]
 gi|257826539|gb|EEV53165.1| exonuclease VII [Enterococcus faecium 1,231,410]
 gi|257829886|gb|EEV56493.1| exonuclease VII [Enterococcus faecium 1,231,408]
 gi|260075254|gb|EEW63567.1| exonuclease VII [Enterococcus faecium C68]
 gi|291598754|gb|EFF29806.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecium
           U0317]
 gi|291605636|gb|EFF35078.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecium
           E1162]
 gi|313587891|gb|EFR66736.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecium
           TX0133a01]
 gi|313592649|gb|EFR71494.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecium
           TX0133B]
 gi|313596541|gb|EFR75386.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecium
           TX0133A]
 gi|313599799|gb|EFR78642.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecium
           TX0133C]
 gi|313642743|gb|EFS07323.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecium
           TX0133a04]
 gi|313643576|gb|EFS08156.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecium
           TX0082]
          Length = 445

 Score =  249 bits (636), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 127/294 (43%), Positives = 191/294 (64%), Gaps = 12/294 (4%)

Query: 14  EY-SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           EY +V+ L+ +LK   +++  L  V + GEIS +R + ++ H YFSLKD+H++I AI++K
Sbjct: 4   EYLTVTTLTKYLKRKFDADPYLERVYLTGEISNFR-LRANAHQYFSLKDDHAKISAIMFK 62

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           G   K+ F P+EG++ LV+G+I+ +     YQI +E + P G G L   LE+RK+KL++E
Sbjct: 63  GAFQKLRFQPKEGMKVLVVGRISLYEAGGSYQIYVEHMEPDGIGALYQELEERKEKLMKE 122

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKE 189
           GLF    K  +P  PK IAV+TSP+GAVIRDI+  +  R+P+ ++++FP  VQG++    
Sbjct: 123 GLFQG-PKKMLPRFPKRIAVLTSPSGAVIRDIITTVKRRYPIVQLVLFPTVVQGNQAADN 181

Query: 190 IANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGH 249
           +   I ++  +         D +I+ RGGGSIEDLW FN+E + RAI  ++ P+IS++GH
Sbjct: 182 VVRNIQRVEEMGNF------DTMIIGRGGGSIEDLWPFNEERVARAIYQANTPVISSVGH 235

Query: 250 ETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYK 303
           ETD T+AD  AD+RA TPT AAE+AVPV       +   +ARL    +R I+ K
Sbjct: 236 ETDTTIADLVADVRAATPTAAAELAVPVLSEELMRIQERQARLQQAFVRQIQRK 289


>gi|293568314|ref|ZP_06679638.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecium
           E1071]
 gi|291589026|gb|EFF20850.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecium
           E1071]
          Length = 445

 Score =  249 bits (636), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 127/294 (43%), Positives = 191/294 (64%), Gaps = 12/294 (4%)

Query: 14  EY-SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           EY +V+ L+ +LK   +++  L  V + GEIS +R + ++ H YFSLKD+H++I AI++K
Sbjct: 4   EYLTVTTLTKYLKRKFDADPYLERVYLTGEISNFR-LRANAHQYFSLKDDHAKISAIMFK 62

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           G   K+ F P+EG++ LV+G+I+ +     YQI +E + P G G L   LE+RK+KL++E
Sbjct: 63  GAFQKLRFQPKEGMKVLVVGRISLYEAGGSYQIYVEHMEPDGIGALYQELEERKEKLMKE 122

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKE 189
           GLF    K  +P  PK IAV+TSP+GAVIRDI+  +  R+P+ ++++FP  VQG++    
Sbjct: 123 GLFQG-PKKMLPRFPKRIAVLTSPSGAVIRDIITTVKRRYPIVQLVLFPTVVQGNQAADN 181

Query: 190 IANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGH 249
           +   I ++  +         D +I+ RGGGSIEDLW FN+E + RAI  ++ P+IS++GH
Sbjct: 182 VVRNIQRVEEMGNF------DTMIIGRGGGSIEDLWPFNEERVARAIYQANTPVISSVGH 235

Query: 250 ETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYK 303
           ETD T+AD  AD+RA TPT AAE+AVPV       +   +ARL    +R I+ K
Sbjct: 236 ETDTTIADLVADVRAATPTAAAELAVPVLSEELMRIQERQARLQQAFVRQIQRK 289


>gi|15672836|ref|NP_267010.1| exodeoxyribonuclease VII large subunit [Lactococcus lactis subsp.
           lactis Il1403]
 gi|14194717|sp|Q9CH84|EX7L_LACLA RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|12723782|gb|AAK04952.1|AE006320_1 exonuclease VII large subunit [Lactococcus lactis subsp. lactis
           Il1403]
          Length = 417

 Score =  249 bits (636), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 139/309 (44%), Positives = 193/309 (62%), Gaps = 19/309 (6%)

Query: 14  EY-SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           EY SVS L+ +LK   + +  L  V + GEIS +R      H YF+LKD  + I A +W 
Sbjct: 3   EYLSVSTLTKYLKAKFDRDRYLERVYLTGEISNFR--RRPNHQYFALKDEGAVIQATMWA 60

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           G   K++F  EEG++ L +G+I+ +P S  Y I IESL+P G G L    E+ KKKL  E
Sbjct: 61  GQFRKLDFELEEGMKVLAVGRISIYPPSGSYSINIESLVPDGVGALAVKFEQLKKKLTAE 120

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKE 189
           GLF  + K  +P   K IAV+TSP+GAVIRDI+  +  RFP+ +++++P KVQG    +E
Sbjct: 121 GLFEQRWKQTLPQFSKKIAVVTSPSGAVIRDIITTVQRRFPMSQIVLYPTKVQGQGSAEE 180

Query: 190 IANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGH 249
           IA  I + N   +       D++I+ RGGGSIEDLW FN+E++VRAI  S IPIIS++GH
Sbjct: 181 IAGNIRRANQRGD------FDVMIIGRGGGSIEDLWGFNEEIVVRAIFESRIPIISSVGH 234

Query: 250 ETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINL----EARLNNIIIRLIKYKIN 305
           ETD TLAD+ AD RA TPT AAE+A P   + +  LIN     E RL N +  +IK +  
Sbjct: 235 ETDVTLADFVADSRAATPTAAAELATP---NTKVDLINWANEQEKRLFNRLTHVIKIRRE 291

Query: 306 TLNSLLKAL 314
            ++ L +++
Sbjct: 292 RVDKLSQSV 300


>gi|268324170|emb|CBH37758.1| probable exonuclease VII, large subunit [uncultured archaeon]
          Length = 444

 Score =  249 bits (636), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 129/301 (42%), Positives = 193/301 (64%), Gaps = 6/301 (1%)

Query: 15  YSVSELSYHLKHIVE--SNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           YSV E++ +++  ++  S LS V V+GE+S      +SGH YF+LKD  S +  ++++  
Sbjct: 41  YSVQEVTSYIRRRLDEDSMLSDVYVKGELSNL-SQPTSGHLYFTLKDKFSELRCVMFRDK 99

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
              ++F PE+G+  ++ G I+ +     YQ+ ++ L   G G L  A E+ KKKL  EGL
Sbjct: 100 NRGLKFTPEDGMSVILRGHISVYERRGSYQLYVDELQAEGIGALYLAFEQLKKKLKGEGL 159

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIA 191
           F  ++K PIP  P+ I +ITSPTGA IRD+L     RFP + +++ PV VQG++ P++I 
Sbjct: 160 FDSKYKKPIPSFPRKIGIITSPTGAAIRDMLNITKRRFPHVYILVAPVAVQGEDAPRQIV 219

Query: 192 NAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHET 251
           NAI  +N + E R   + D+++L RGGGSIE+LW FN+E + R I  S IP+ISA+GHET
Sbjct: 220 NAIRLMNRVNEERM--KIDVLVLGRGGGSIEELWAFNEEDVAREIFASKIPVISAVGHET 277

Query: 252 DWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLL 311
           D+T+AD+ AD RA TP+ AAE+AVP K  ++ +L +LE R+   I   I+Y    L S+ 
Sbjct: 278 DFTIADFVADRRAATPSEAAELAVPDKREIERNLSSLELRMQQNIYNTIEYHRKRLESIE 337

Query: 312 K 312
           K
Sbjct: 338 K 338


>gi|91203444|emb|CAJ71097.1| strongly similar to exodeoxyribonuclease VII large chain
           Escherichia coli (K12) [Candidatus Kuenenia
           stuttgartiensis]
          Length = 412

 Score =  249 bits (635), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 141/333 (42%), Positives = 213/333 (63%), Gaps = 19/333 (5%)

Query: 16  SVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNK 75
           ++S ++  +++ +E   SHV + GE+S  +   SSGH Y +LKD H++I A+I+K   N 
Sbjct: 20  TISGITGKIRNSLEQGFSHVWITGEVSNLKK-PSSGHLYLTLKDEHAQIQAVIFKSVANW 78

Query: 76  IEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSD 135
           I+F  ++G+E L  G IT +    +YQIIIE++ P G G L  A  K K++L +EGLF  
Sbjct: 79  IKFDLKDGMEVLAFGSITVYEPRGQYQIIIENIEPKGFGALQQAFLKLKERLGKEGLFDP 138

Query: 136 QHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANAI 194
            +K P+P +P+ IA++TS TGA I+DIL  I+ RF  + ++I+PV+VQG+   +EIANAI
Sbjct: 139 CYKKPLPLLPQKIAIVTSLTGAAIKDILNVINRRFAKMEILIYPVRVQGEGAAREIANAI 198

Query: 195 LQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWT 254
             LNT+         D+II+ RGGGS+EDLW FN+E++ R+I  S IP+ISA+GHE D T
Sbjct: 199 DNLNTIAG------IDVIIVGRGGGSLEDLWAFNEEVVARSIFTSKIPVISAVGHEIDVT 252

Query: 255 LADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNS-LLKA 313
           ++D  AD+RA TPT AAE+ VP  + L  +L  ++ARL    I+ +  KI T  S LL+A
Sbjct: 253 ISDLVADIRALTPTEAAELVVPCYDQLTDALEKIKARL----IQSLYNKIKTDRSRLLRA 308

Query: 314 LPNSDQTLSCSR--YRLDRLPRELEHNLEIIIF 344
               + +    R   R+ RL + L+ N++ ++ 
Sbjct: 309 ----EHSFPFKRPFDRIHRLQQVLDENMQRLVM 337


>gi|293571747|ref|ZP_06682766.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecium E980]
 gi|291608204|gb|EFF37507.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecium E980]
          Length = 445

 Score =  249 bits (635), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 126/294 (42%), Positives = 192/294 (65%), Gaps = 12/294 (4%)

Query: 14  EY-SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           EY +V+ L+ +LK   +++  L  V + GEIS +R + ++ H YFSLKD+H++I AI++K
Sbjct: 4   EYLTVTTLTRYLKRKFDADPYLERVYLTGEISNFR-LRANAHQYFSLKDDHAKISAIMFK 62

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           G   K+ F P+EG++ LV+G+I+ +     YQI +E + P G G L   LE+RK+KL++E
Sbjct: 63  GAFQKLRFHPKEGMKVLVVGRISLYEAGGSYQIYVEHMEPDGIGALYQELEERKEKLMKE 122

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKE 189
           GLF    K  +P  PK IA++TSP+GAVIRDI+  +  R+P+ ++++FP  VQG++    
Sbjct: 123 GLFQG-PKKMLPRFPKRIAILTSPSGAVIRDIITTVKRRYPIVQLVLFPTVVQGNQAADN 181

Query: 190 IANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGH 249
           +   I ++  + +       D +I+ RGGGSIEDLW FN+E + RAI  ++ P+IS++GH
Sbjct: 182 VVKNIRRVEEMGDF------DTMIIGRGGGSIEDLWPFNEERVARAIYQANTPVISSVGH 235

Query: 250 ETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYK 303
           ETD T+AD  AD+RA TPT AAE+AVPV       +   +ARL    +R I+ K
Sbjct: 236 ETDTTIADLVADVRAATPTAAAELAVPVLSEELMRIQERQARLQQAFVRQIQRK 289


>gi|194016883|ref|ZP_03055496.1| exodeoxyribonuclease VII, large subunit [Bacillus pumilus ATCC
           7061]
 gi|194011489|gb|EDW21058.1| exodeoxyribonuclease VII, large subunit [Bacillus pumilus ATCC
           7061]
          Length = 448

 Score =  249 bits (635), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 166/492 (33%), Positives = 267/492 (54%), Gaps = 62/492 (12%)

Query: 16  SVSELSYHLKH--IVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ ++K    V+ +L  + ++GE+S  + IHS GH YF+LKD ++R+ A++++ + 
Sbjct: 8   TVTALTKYIKRKFDVDPHLEDIWIKGELSNVK-IHSRGHVYFTLKDENARMQAVMFQRSA 66

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            K+ F P+ G++  V G I  +  S  YQ+  + + P G G L  A E+ KKKL  EGLF
Sbjct: 67  AKLPFSPKSGMKVFVRGGIQVYEPSGNYQLYAKEMQPDGVGALHLAYEELKKKLASEGLF 126

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRF-PLRVIIFPVKVQGDECPKEIAN 192
             ++K PIP  P+++ VITSPTGA +RD++  I+ R+   ++I+ P  VQG+   + I  
Sbjct: 127 DARYKKPIPEYPEVVGVITSPTGAAVRDVITTINRRYQQAKIIVLPALVQGEHATRSIVE 186

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
            I + N   E + C   D++I+ RGGGSIE+LW FN+E + RAI  S IPIISA+GHETD
Sbjct: 187 RIKEAN---EKQLC---DVLIVGRGGGSIEELWAFNEEAVARAIFASDIPIISAVGHETD 240

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL---IKYKINTLNS 309
           +T++D+ AD+RAPTPTGAAE+AVP       S  +L  R+ +I IRL   +K + +    
Sbjct: 241 FTISDFTADMRAPTPTGAAELAVP-------STTDLIERIKSIDIRLTRAVKNRTSQAKD 293

Query: 310 LLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKN 369
            L AL +S        Y   R P+ L+        +K + F+ + +R +        Q +
Sbjct: 294 RLVALQSS--------YAF-RFPKRLQE-------QKEQQFDLVFDRFQK-------QLS 330

Query: 370 RQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEF 429
           RQ  L++     Q+ +Q  R   L  KE++        Q K R    H +  + + R   
Sbjct: 331 RQIELKR----SQLDRQTYRLKPLHPKEQLL-------QAKKR----HANETEQLIR--- 372

Query: 430 ILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINF 489
            ++ ++K+ H+        L +      ++RGY S+    +  I     + T+ ++ I  
Sbjct: 373 SMNVQMKTIHSQFQSVLGKLNALNPLQVMERGY-SLAYKEDELIKSVNQVETQDQLTITM 431

Query: 490 FDGQANAIVINK 501
            DG+    VI K
Sbjct: 432 KDGRLICEVIEK 443


>gi|332686258|ref|YP_004456032.1| exodeoxyribonuclease VII large subunit [Melissococcus plutonius
           ATCC 35311]
 gi|332370267|dbj|BAK21223.1| exodeoxyribonuclease VII large subunit [Melissococcus plutonius
           ATCC 35311]
          Length = 448

 Score =  249 bits (635), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 140/366 (38%), Positives = 219/366 (59%), Gaps = 21/366 (5%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ +LK   +++  L  + + GEIS +R +  + H YFSLKD+ ++I AI++K   
Sbjct: 7   TVTALTKYLKRKFDADPYLGRIYLTGEISNFR-LRVNAHQYFSLKDDGAKISAIMFKSAF 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            K++F P+EG++ LV+G+I+ +  +  YQI I+ + P G G L  AL + K+KL +EGLF
Sbjct: 66  QKLKFQPKEGMKVLVVGRISLYENNGAYQIYIDHMEPDGIGALYQALAELKEKLAKEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
            ++ K  +P  PK IAVITSP+GAVIRDI+  +  R+P+ ++++FP  VQG++   +I  
Sbjct: 126 -NKVKRKLPLYPKRIAVITSPSGAVIRDIITTVHRRYPIAQLVLFPTLVQGEQAADDI-- 182

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
               +  ++        D IIL RGGGSIEDLW FN+E + RAI  S IPIIS++GHETD
Sbjct: 183 ----VRNIERAEKIGNFDTIILGRGGGSIEDLWPFNEESVARAIYQSKIPIISSVGHETD 238

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            T+AD  AD+RA TPT AAEMAVPV   L   L+ ++ R   +    + Y +       K
Sbjct: 239 TTIADLVADVRAATPTAAAEMAVPV---LSEELLKIKERQERLAQAFL-YLVQQQEEHFK 294

Query: 313 ALPNS------DQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNI 366
            L NS      ++       +LD++ + L+   E I  +K      I+N++     ++ I
Sbjct: 295 HLKNSYVFKQPERLYEGQTLKLDQVTQRLQQLAEAIYHQKQLQTQSILNQLYQQAPLNQI 354

Query: 367 QKNRQH 372
           ++ +Q+
Sbjct: 355 KEKKQY 360


>gi|326406401|gb|ADZ63472.1| exodeoxyribonuclease VII large subunit [Lactococcus lactis subsp.
           lactis CV56]
          Length = 417

 Score =  249 bits (635), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 139/309 (44%), Positives = 193/309 (62%), Gaps = 19/309 (6%)

Query: 14  EY-SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           EY SVS L+ +LK   + +  L  V + GEIS +R      H YF+LKD  + I A +W 
Sbjct: 3   EYLSVSTLTKYLKAKFDRDPYLERVYLTGEISNFR--RRPNHQYFALKDEGAVIQATMWA 60

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           G   K++F  EEG++ L +G+I+ +P S  Y I IESL+P G G L    E+ KKKL  E
Sbjct: 61  GQFRKLDFELEEGMKVLAVGRISIYPPSGSYSINIESLVPDGVGALAVKFEQLKKKLTAE 120

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKE 189
           GLF  + K  +P   K IAV+TSP+GAVIRDI+  +  RFP+ +++++P KVQG    +E
Sbjct: 121 GLFEQRWKQTLPQFSKKIAVVTSPSGAVIRDIITTVQRRFPMSQIVLYPTKVQGQGSAEE 180

Query: 190 IANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGH 249
           IA  I + N   +       D++I+ RGGGSIEDLW FN+E++VRAI  S IPIIS++GH
Sbjct: 181 IAGNIRRANQRGDF------DVMIIGRGGGSIEDLWGFNEEIVVRAIFESRIPIISSVGH 234

Query: 250 ETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINL----EARLNNIIIRLIKYKIN 305
           ETD TLAD+ AD RA TPT AAE+A P   + +  LIN     E RL N +  +IK +  
Sbjct: 235 ETDVTLADFVADSRAATPTAAAELATP---NTKVDLINWANEQEKRLFNRLTHVIKIRRE 291

Query: 306 TLNSLLKAL 314
            ++ L +++
Sbjct: 292 RVDKLSQSV 300


>gi|299822997|ref|ZP_07054883.1| exodeoxyribonuclease VII large subunit [Listeria grayi DSM 20601]
 gi|299816526|gb|EFI83764.1| exodeoxyribonuclease VII large subunit [Listeria grayi DSM 20601]
          Length = 446

 Score =  248 bits (634), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 138/379 (36%), Positives = 221/379 (58%), Gaps = 14/379 (3%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           SV  L+ +++   +++  L HV V+GEIS  +   +SGH YF++KD+ + I  +++  ++
Sbjct: 8   SVIALTKYIERKFDADPYLKHVYVKGEISNLKK-PASGHIYFTVKDDLAMIRCVMFAKSV 66

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            K+ F PE+G+   + G++  F  + +YQ   E + P G G L   LE+ K KL EEGLF
Sbjct: 67  AKLGFDPEDGMNIRLQGRVNVFTKAGRYQFYAEEMEPDGVGALYVKLEQLKSKLTEEGLF 126

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIAN 192
           +D HK P+P  P  +AV+TS TGA IRD++  I  R P  +++++P  VQGD   K I  
Sbjct: 127 ADSHKKPLPLFPAKVAVVTSRTGAAIRDVITTIQRRMPTTQILVYPTVVQGDHAGKTIVA 186

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
            I ++N   +       D+II  RGGGS+E+LW FN+E +VRA+ +S IPIISA+GHETD
Sbjct: 187 NIERINQRND------IDVIITGRGGGSLEELWAFNEEPVVRAVYHSDIPIISAVGHETD 240

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYK---INTLNS 309
           + L D+AAD+RA TPT AAE+AVP +  L+  L+    RL N + R+++ K   +  L  
Sbjct: 241 FALTDFAADVRAATPTAAAELAVPDQRDLKERLLERHYRLVNQMNRVVERKEVQMKRLQD 300

Query: 310 LLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKN 369
            LK L    Q +     ++D     L   L   + +K   +  +  RI+   L  +I+  
Sbjct: 301 RLKLLTPKRQ-MEQQAEKIDYFSERLVRALRTQVTQKRTDWQQLAYRIEHVELAKDIRAE 359

Query: 370 RQHILEKQQHIEQIVKQHL 388
           R+ +  ++Q +++ ++  +
Sbjct: 360 RERLELREQSLKRALRTQI 378


>gi|327439757|dbj|BAK16122.1| exonuclease VII, large subunit [Solibacillus silvestris StLB046]
          Length = 452

 Score =  248 bits (634), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 141/396 (35%), Positives = 228/396 (57%), Gaps = 18/396 (4%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           SV  L+ ++K   +++  L  V V GE+S  + +HSSGH YF+LKD+ SRI+A +++   
Sbjct: 8   SVKALTKYIKRKFDADPHLRDVYVTGELSNVK-VHSSGHIYFTLKDDSSRINATMFRSQA 66

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
           +K+ F PEEG++  + G +  +  S  YQ+  +++ P G G L  A  + K++L  EGLF
Sbjct: 67  SKLSFKPEEGMKVFIRGDVNVYEASGAYQLYAQTMEPDGIGGLFVAFNQLKERLQNEGLF 126

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIAN 192
           +   K PIP  PK I V+T+ TGA IRDI   I+ R+P   ++I+P  VQG      I  
Sbjct: 127 NPNFKQPIPQFPKTIGVLTATTGAAIRDICTTINRRYPQAEILIYPTLVQGAGAAPNITE 186

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
            I   N  + G  C   D++I+ RGGGSIEDLW FN+E++ RAI  S IP+ISA+GHETD
Sbjct: 187 NIYLAN--RHG-FC---DVLIVGRGGGSIEDLWAFNEEIVARAIFESRIPVISAVGHETD 240

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            T+AD+ ADLRAPTPT AAE+AVP ++ L   +++ ++ L+ ++   + ++ N L  L  
Sbjct: 241 TTIADFVADLRAPTPTAAAELAVPNQQQLYQQILHYQSILHQMMTSKLNFERNRLTKLQN 300

Query: 313 ALP--NSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNR 370
           + P    ++       RL ++   L++  ++ +  +      I +++K    +H +   +
Sbjct: 301 SYPLATPERLYRPFIERLVQVDLSLQNATKLYMMNEKSKLQSIDSKMKLYSPVHQLIAAK 360

Query: 371 QHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLR 406
           Q +  + Q +   ++Q L       + K+A  + LR
Sbjct: 361 QQLEHRTQTLTNRMQQQL------AQNKVAFTNQLR 390


>gi|89898503|ref|YP_515613.1| exodeoxyribonuclease VII large subunit [Chlamydophila felis
           Fe/C-56]
 gi|123483062|sp|Q253S0|EX7L_CHLFF RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|89331875|dbj|BAE81468.1| exodeoxyribonuclease VII large subunit [Chlamydophila felis
           Fe/C-56]
          Length = 555

 Score =  248 bits (634), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 177/550 (32%), Positives = 278/550 (50%), Gaps = 71/550 (12%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           P  +V+ L+  +K+++ESN  HV V+GE+S    +  SGH YF +KD+ S ++   +   
Sbjct: 6   PPQAVTTLTESIKNLLESNFCHVVVKGELSNV-SLQPSGHLYFGIKDSRSFLNGAFFHFK 64

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
               +  P++G   ++ GK+T +    +YQI+  +L+ +G G LL   E+ KK+L  EG 
Sbjct: 65  SKYFDRRPKDGDSVIIHGKLTVYAPRGQYQIVAHALVYAGEGDLLQKFEETKKRLAAEGY 124

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCR-FPLRVIIFPVKVQGDECPKEIA 191
           F+ + K  +P IP+ I VITSPTGAVI+DIL+ +S R +  +++I+PV VQG    KEI+
Sbjct: 125 FALEKKQTLPNIPQSIGVITSPTGAVIQDILRVLSRRCYQYKILIYPVTVQGATAAKEIS 184

Query: 192 NAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHET 251
            AI ++N  KE       D++ILARGGGSIEDLW FN+E++V+AI  SSIPIISAIGHET
Sbjct: 185 RAIEEMN--KENL----ADVLILARGGGSIEDLWAFNEEIVVKAIDASSIPIISAIGHET 238

Query: 252 DWTLADYAADLRAPTPTGAAEMAVPVKEH----LQSSLINLEARLNNII----------- 296
           D+TL D+AAD+RAPTP+ AAE+     E      +S L  L A    ++           
Sbjct: 239 DYTLCDFAADVRAPTPSAAAEIVCQSSEQQIQVFKSYLRYLNAHSQQLLSGKIKQIQQWK 298

Query: 297 -----IRLIKYKINTLNSLLKALPNSDQT-LSCSRYRLDRLPRELE-----------HNL 339
                +   +    +L+ L  ++  S QT LS  + R  +  R L+           H+L
Sbjct: 299 RYLDHVDFFRSAHQSLDYLCLSVERSIQTKLSQYKQRYMQYARWLQSDVLQRMTYRLHDL 358

Query: 340 EIIIFRKYRH----FNHIINRIKSDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYI---- 391
             +I + + +      H+  + K +   HN Q+  Q +   +Q + + + Q L Y     
Sbjct: 359 WKMIVQAFHNRLTAAKHLCMQKKKNLTFHNTQQFIQKLDLWKQQLHRALTQRLGYCSQSL 418

Query: 392 -----------------FLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIE---FIL 431
                            F + K  + +L   +  T+     +  H +  +   E   F L
Sbjct: 419 THQQTLLKHFTIKLNQQFTKGKHTLNLLQ--KRLTRTFANTVDEHRENYVRSRENLIFSL 476

Query: 432 SHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNF-ITQKRNLATKTRILINFF 490
            H ++         ++ L     KN  KRGY  + D N NF I   ++L   + + +   
Sbjct: 477 HHLVERNREKYYTLSKQLTLLNPKNVFKRGYAMLFDFNENFAIISAKSLHKHSCVRVRLQ 536

Query: 491 DGQANAIVIN 500
           DG+A   V +
Sbjct: 537 DGEATLTVTD 546


>gi|320162024|ref|YP_004175249.1| exodeoxyribonuclease VII large subunit [Anaerolinea thermophila
           UNI-1]
 gi|319995878|dbj|BAJ64649.1| exodeoxyribonuclease VII large subunit [Anaerolinea thermophila
           UNI-1]
          Length = 413

 Score =  248 bits (634), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 139/349 (39%), Positives = 204/349 (58%), Gaps = 18/349 (5%)

Query: 13  PEYSVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           P  SVSEL+  ++ ++ES   LS + V GEIS +    +SGH YF+LKD+ + +  +IW+
Sbjct: 10  PALSVSELTRLIRSLLESEPALSEIWVAGEISNFTR-AASGHVYFTLKDSGAALKCVIWR 68

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
                +    ++GI     G I  +     YQ  + ++ P+G G L     + K +L  E
Sbjct: 69  NAARTLRVPLQDGIAIEAFGSIGVYEQGGNYQFYVTAVRPAGEGYLYQQFLRLKAQLEAE 128

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKE 189
           GLF+++ K PIP  P+ I V+TSPTGA ++DIL  +  R+PL  VI+ P  VQG+E P E
Sbjct: 129 GLFAEERKRPIPTFPRRIGVVTSPTGAALQDILNTLRRRYPLVEVILAPSAVQGEEAPLE 188

Query: 190 IANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGH 249
           +  A+  LN +      P  D+I+LARGGGSIEDLW FNDE +VR +A S +P+I+ +GH
Sbjct: 189 LVQALNALNRI------PDLDVILLARGGGSIEDLWAFNDEGVVRTVAASRVPVITGVGH 242

Query: 250 ETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLE---ARLNNIIIRLIKYKINT 306
           ETD+TL D+AADLRAPTPTGAA +A P +  L   LI +E    RLN +I + +  +   
Sbjct: 243 ETDFTLVDFAADLRAPTPTGAATLATPDRAEL---LIQVERTLQRLNRLISQRVNLESAR 299

Query: 307 LNSLLKALPNSD--QTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHI 353
           LN L   L  +   + +  +R RLD     L++    +I ++  H   +
Sbjct: 300 LNQLESRLQRASPVRRIEDNRQRLDNAILRLQNTAARLIAQRQAHLQAL 348


>gi|253701626|ref|YP_003022815.1| exodeoxyribonuclease VII large subunit [Geobacter sp. M21]
 gi|259646293|sp|C6E2U7|EX7L_GEOSM RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|251776476|gb|ACT19057.1| exodeoxyribonuclease VII, large subunit [Geobacter sp. M21]
          Length = 458

 Score =  248 bits (634), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 161/481 (33%), Positives = 249/481 (51%), Gaps = 56/481 (11%)

Query: 16  SVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNK 75
           +VS L+  ++ ++E N   V V GEIS       SGH YF+LKD  ++I  ++++G    
Sbjct: 11  TVSALTALVRGLLEENFEQVWVEGEISNL-ACPQSGHCYFTLKDAGAQIRCVMFRGAFRS 69

Query: 76  IEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSD 135
           ++F P +G+  L  G++T F    +YQ++ + L P G G L  A  + K+KL +EGLFS+
Sbjct: 70  LKFTPRDGMRILTRGRLTLFEPRGEYQLVADYLEPQGIGGLQMAFIQLKEKLAKEGLFSE 129

Query: 136 QHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANAI 194
            HK  IP +P+ I ++TSPTGA IRDIL  ++ RF  + ++I PV+VQG+   +EIA+AI
Sbjct: 130 LHKIEIPKLPRRIGIVTSPTGAAIRDILTVLNRRFTNVELLISPVRVQGEGAAREIADAI 189

Query: 195 LQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWT 254
             LN +         D++I+ RGGGS+EDLW FN+E++ RAI  S +P+ISA+GHE D+T
Sbjct: 190 DDLNRVGN------IDVMIVGRGGGSLEDLWAFNEEVVARAIHRSKVPVISAVGHEIDFT 243

Query: 255 LADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKAL 314
           +AD+ ADLRA TP+ AAE+ V  K+ L + +  L  RL+                     
Sbjct: 244 IADFVADLRAATPSAAAELVVASKKELTAEVEALSHRLH--------------------- 282

Query: 315 PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHIL 374
                     + RL+R  R L   L   I    R   H+  R+  D L   + +    IL
Sbjct: 283 -------VSQQRRLER-SRALVTALSRAITDPSRVLGHLAQRV--DSLDARLVREAGLIL 332

Query: 375 EKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSHK 434
           +     E+IV    R   L ++     L    E+           +  L  R++  ++ +
Sbjct: 333 DDAS--ERIVTLTAR---LSRQTPALTLKRWEER-----------LATLSLRLDHAMTRR 376

Query: 435 IKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDT-NNNFITQKRNLATKTRILINFFDGQ 493
           +     SV + T  L + +   TL RGY+  +     + +T  R LA   R+ ++F  G 
Sbjct: 377 LACAAESVGLATGTLNAVSPLATLSRGYSITRKLPARSVVTSSRQLAPGDRVEVSFAAGS 436

Query: 494 A 494
           A
Sbjct: 437 A 437


>gi|261405953|ref|YP_003242194.1| exodeoxyribonuclease VII large subunit [Paenibacillus sp. Y412MC10]
 gi|261282416|gb|ACX64387.1| exodeoxyribonuclease VII, large subunit [Paenibacillus sp.
           Y412MC10]
          Length = 456

 Score =  248 bits (633), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 138/330 (41%), Positives = 200/330 (60%), Gaps = 12/330 (3%)

Query: 16  SVSELSYHLKHIVE--SNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           SV +L+ +++  +E  S LS V +RGEIS +   HSSGH YF+LKD  SRI AI++    
Sbjct: 11  SVKDLNRYIRMKMEGDSRLSDVWIRGEISNFTH-HSSGHMYFTLKDEGSRIRAIMFATHN 69

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            ++ F+P+EG   +  G ++ +    +YQ     + P G G+L  A E+ K KL EEGLF
Sbjct: 70  QRLPFIPKEGSRVIARGNVSVYERDGQYQFYAVQMQPDGIGSLYLAYEQLKSKLEEEGLF 129

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIAN 192
           +   K P+P  PK I VITSPTGA +RDI+  I  R+P    I++PV VQG      I  
Sbjct: 130 AADRKRPLPRYPKTIGVITSPTGAAVRDIMITIRRRYPQANAILYPVLVQGKGAAPSIVK 189

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI  +N + E       D++I+ RGGGS+E+LW FN+E++ RAI  S IPI+SA+GHETD
Sbjct: 190 AIRTMNDMAEA------DVLIVGRGGGSLEELWAFNEEIVARAIYQSHIPIVSAVGHETD 243

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ ADLRA TPT AAE+AVP    L+  L   + +LN  + + ++     L SL +
Sbjct: 244 FTIADFVADLRAATPTAAAELAVPSSAELRGQLAQRQRQLNQGLQQRLQRSRERLISLQR 303

Query: 313 A--LPNSDQTLSCSRYRLDRLPRELEHNLE 340
           +  L +  + +     RLD L + L+ +L+
Sbjct: 304 SPVLVHPRRYMLQHAERLDMLSQRLQGHLK 333


>gi|262276799|ref|ZP_06054592.1| exodeoxyribonuclease VII, large subunit [alpha proteobacterium
           HIMB114]
 gi|262223902|gb|EEY74361.1| exodeoxyribonuclease VII, large subunit [alpha proteobacterium
           HIMB114]
          Length = 400

 Score =  248 bits (633), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 130/266 (48%), Positives = 169/266 (63%), Gaps = 11/266 (4%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           PE+SV+E S   K+I+E N S + VRGEIS  +     GH YF++KD +  ++++ W   
Sbjct: 5   PEFSVTEFSNLAKNILEENFSLIRVRGEISSVKNFK--GHLYFTIKDENFVLNSVCWASK 62

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSK--YQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           +  ++  PE+GIE +  GKI+T+  SS   YQ+ +  +   G G LL  +E+RKKKL EE
Sbjct: 63  VPYLQIQPEDGIEVIAEGKISTYAKSSISIYQLQVNQIEIKGEGALLKLIEQRKKKLEEE 122

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEI 190
           GLF DQ+K  IP  PK I VITSPTGAVI DI+ RI  RFP  + ++PV VQG     E+
Sbjct: 123 GLFDDQNKKSIPVFPKNIGVITSPTGAVIMDIIDRIEARFPTNIKLYPVSVQGTNAVNEV 182

Query: 191 ANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHE 250
              I  L   +  +     D +I+ARGGG IEDL  FNDE +VR +     PIISAIGHE
Sbjct: 183 ---IAGLKFFENNKV----DTLIIARGGGGIEDLMPFNDENLVREVYKLKTPIISAIGHE 235

Query: 251 TDWTLADYAADLRAPTPTGAAEMAVP 276
           TD+TL D+ ADLRA TPT AAE AVP
Sbjct: 236 TDFTLLDFVADLRAATPTAAAEYAVP 261


>gi|315173306|gb|EFU17323.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           TX1346]
          Length = 448

 Score =  248 bits (633), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 139/389 (35%), Positives = 230/389 (59%), Gaps = 17/389 (4%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ +LK   +++  L  V + GEIS +R   ++ H YFSLKD+H++I AI++K   
Sbjct: 7   TVTALTKYLKRKFDADPYLGRVYLTGEISNFR-FRANAHQYFSLKDDHAKISAIMFKSAF 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            K++F P+EG++ +V+G+I+ +  S  YQI IE + P G G L  AL + ++KL +EGLF
Sbjct: 66  QKLKFQPKEGMKVMVVGRISLYENSGSYQIYIEHMEPDGVGALYQALAELREKLGKEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
            +  K  +P  PK IAV+TSP+GAVIRDI+  +  R+P+ ++++FP  VQGD+   +I  
Sbjct: 126 -EGPKQQLPRYPKRIAVVTSPSGAVIRDIITTVKRRYPIAQLVLFPTLVQGDQAADDIVR 184

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
            I + +   +       D +I+ RGGGSIEDLW FN+E + RAI  ++ PIIS++GHETD
Sbjct: 185 NIQRADAQGDF------DTMIIGRGGGSIEDLWPFNEEKVARAIHAATTPIISSVGHETD 238

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            T+AD  AD+RA TPT AAE+AVPV       +    +RL    + L++ +      L  
Sbjct: 239 VTIADMVADVRAATPTAAAELAVPVLNEELLRISERRSRLEQSFLYLLQQRTERFQRLQN 298

Query: 313 A--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNR 370
           +      ++       +LDR+ + L   +  I  +K R    II +++       +++++
Sbjct: 299 SYVFKQPERLYEGQTIKLDRMTQRLFQAMTTIHHQKQRQAQGIIAQLQQQTPKGQLRESQ 358

Query: 371 QHILEKQQHIEQIVKQHLRYIFLEKKEKI 399
           Q +   Q++++  + Q    +FL K+++ 
Sbjct: 359 QQLAFLQRNLQTQMTQ----LFLNKQKQF 383


>gi|329924767|ref|ZP_08279756.1| exodeoxyribonuclease VII, large subunit [Paenibacillus sp. HGF5]
 gi|328940432|gb|EGG36755.1| exodeoxyribonuclease VII, large subunit [Paenibacillus sp. HGF5]
          Length = 456

 Score =  248 bits (633), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 137/330 (41%), Positives = 200/330 (60%), Gaps = 12/330 (3%)

Query: 16  SVSELSYHLKHIVE--SNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           SV +L+ +++  +E  S LS V +RGEIS +   HSSGH YF+LKD  SRI AI++    
Sbjct: 11  SVKDLNRYIRMKMEGDSRLSDVWIRGEISNFTH-HSSGHMYFTLKDEGSRIRAIMFATHN 69

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            ++ F+P+EG   +  G ++ +    +YQ     + P G G+L  A E+ K KL EEGLF
Sbjct: 70  QRLPFIPKEGSRVIARGNVSVYERDGQYQFYAVQMQPDGIGSLYLAYEQLKSKLEEEGLF 129

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIAN 192
           +   K P+P  PK I VITSPTGA +RDI+  I  R+P    I++PV VQG      I  
Sbjct: 130 AADRKRPLPRYPKTIGVITSPTGAAVRDIMITIRRRYPQANTILYPVLVQGKGAAPSIVK 189

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI  +N + E       D++I+ RGGGS+E+LW FN+E++ RAI  S IP++SA+GHETD
Sbjct: 190 AIRTMNDMAEA------DVLIVGRGGGSLEELWAFNEEIVARAIYQSHIPVVSAVGHETD 243

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ ADLRA TPT AAE+AVP    L+  L   + +LN  + + ++     L SL +
Sbjct: 244 FTIADFVADLRAATPTAAAELAVPSSAELRGQLAQRQRQLNQGLQQRLQRSRERLISLQR 303

Query: 313 A--LPNSDQTLSCSRYRLDRLPRELEHNLE 340
           +  L +  + +     RLD L + L+ +L+
Sbjct: 304 SPVLVHPRRYMLQHAERLDMLSQRLQGHLK 333


>gi|116511676|ref|YP_808892.1| exodeoxyribonuclease VII large subunit [Lactococcus lactis subsp.
           cremoris SK11]
 gi|116107330|gb|ABJ72470.1| Exodeoxyribonuclease VII large subunit [Lactococcus lactis subsp.
           cremoris SK11]
          Length = 422

 Score =  248 bits (632), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 142/309 (45%), Positives = 192/309 (62%), Gaps = 19/309 (6%)

Query: 14  EY-SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           EY SVS L+ +LK   E +  L  V + GEIS +R      H YF+LKD  + I A +W 
Sbjct: 8   EYLSVSTLTKYLKAKFERDPYLERVYLTGEISNFR--RRPNHQYFALKDEGAVIQATMWA 65

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           G   K++F  EEG++ L IG+I+ +P S  Y I IESL+P G G L    E+ KKKL  E
Sbjct: 66  GQFRKLDFELEEGMKVLAIGRISIYPPSGSYSINIESLVPDGVGALALKFEQLKKKLAAE 125

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKE 189
           GLF  + K  +P   K IAV TSP+GAVIRDI+  +  RFP+ +++++P KVQG    +E
Sbjct: 126 GLFDQRWKQNLPQFSKKIAVATSPSGAVIRDIITTVQRRFPMSQIVLYPTKVQGAGAAEE 185

Query: 190 IANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGH 249
           I+  I + N   +       D++I+ RGGGSIEDLW FN+E++VRAI  S IPIIS++GH
Sbjct: 186 ISGNIRRANERGDF------DVMIIGRGGGSIEDLWGFNEEIVVRAIFESRIPIISSVGH 239

Query: 250 ETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINL----EARLNNIIIRLIKYKIN 305
           ETD TLAD+ AD RA TPT AAE+A P   + +  LIN     E+RL N +  LIK +  
Sbjct: 240 ETDVTLADFVADSRAATPTTAAELATP---NTKIDLINWANEQESRLFNRLTHLIKIRRE 296

Query: 306 TLNSLLKAL 314
            L  L +++
Sbjct: 297 RLEKLSQSV 305


>gi|259046626|ref|ZP_05737027.1| exodeoxyribonuclease VII, large subunit [Granulicatella adiacens
           ATCC 49175]
 gi|259036791|gb|EEW38046.1| exodeoxyribonuclease VII, large subunit [Granulicatella adiacens
           ATCC 49175]
          Length = 444

 Score =  248 bits (632), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 138/308 (44%), Positives = 198/308 (64%), Gaps = 18/308 (5%)

Query: 14  EY-SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           EY +VS L+ ++K   + +  L  V + GEIS +    +S H YF+LKD ++ I A +++
Sbjct: 4   EYLTVSALTKYIKTKFDRDPHLDRVYLTGEISNFN--KNSVHKYFNLKDENAIIAATMFQ 61

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           G   KI+F PEEG++ LVIG++T +  S KYQ+IIE + P G G L  A E+ KKKL EE
Sbjct: 62  GAYKKIQFQPEEGMKVLVIGRVTVYEKSGKYQMIIEHMEPDGVGALYQAYEQLKKKLTEE 121

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKE 189
           G+FS   K PIP  PK IA++TS TGAVIRDI   ++ RFP+ +++++P  VQG      
Sbjct: 122 GVFSG-PKKPIPVFPKKIAILTSDTGAVIRDIQTTVARRFPIAQLVLYPTVVQGVHA--- 177

Query: 190 IANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGH 249
           + + +  L+ +++       D++I+ RGGGSIEDLW FN+E +VR +A+ S+PIIS++GH
Sbjct: 178 VPSILKNLDLVEQSDA----DVVIIGRGGGSIEDLWAFNEEPVVRRVASFSLPIISSVGH 233

Query: 250 ETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNS 309
           ETD TL D+AAD RA TPT AAE+A PV   +  +L NL  RL   ++     ++NT   
Sbjct: 234 ETDTTLTDFAADQRAATPTAAAELATPVLNDIHLTLGNLTGRLQTTMLN----QLNTRKE 289

Query: 310 LLKALPNS 317
           LL  L  S
Sbjct: 290 LLSKLEKS 297


>gi|260583698|ref|ZP_05851446.1| exodeoxyribonuclease VII, large subunit [Granulicatella elegans
           ATCC 700633]
 gi|260158324|gb|EEW93392.1| exodeoxyribonuclease VII, large subunit [Granulicatella elegans
           ATCC 700633]
          Length = 446

 Score =  248 bits (632), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 141/333 (42%), Positives = 205/333 (61%), Gaps = 16/333 (4%)

Query: 14  EY-SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           EY +VS L+ ++K+  + +  L  V + GEIS +R      H YFSLKD ++ I A +++
Sbjct: 4   EYVTVSALTKYIKYKFDKDPHLGRVYLTGEISNFR--LRPTHQYFSLKDENAIISATMFQ 61

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
               KI+F PEEG++ LVIGK++ F  S +YQI IE + P G G L  A E+ KKKL  E
Sbjct: 62  SAFKKIQFRPEEGMKVLVIGKVSVFEKSGQYQINIEHMEPDGVGALYLAYEQLKKKLEAE 121

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKE 189
           GLFS   K PIP  PK IA++TS +GAVI+DI   ++ RFP+ +++++P  VQG      
Sbjct: 122 GLFS-LPKKPIPQFPKKIAILTSESGAVIQDIQTTVARRFPIVQLVLYPTVVQGVHA--- 177

Query: 190 IANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGH 249
             N+IL+   L E       D++I+ RGGGSIEDLW FN+E +VR +A  SIP+IS++GH
Sbjct: 178 -VNSILKNLDLVEKEDY---DVVIIGRGGGSIEDLWAFNEEPVVRRVAELSIPVISSVGH 233

Query: 250 ETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNS 309
           ETD TL D+ +D+RA TPT AAE+A PV   +   L NL+ RL   + R ++ K   + +
Sbjct: 234 ETDTTLIDFVSDMRAATPTAAAEIATPVLMEIHQQLRNLQTRLEQALSRQLQIKRERMQA 293

Query: 310 LLKA--LPNSDQTLSCSRYRLDRLPRELEHNLE 340
           L  A    N ++     + R+D+L   L+  ++
Sbjct: 294 LANASIFQNPERIYQVYQQRVDQLEMRLQQMMQ 326


>gi|315658201|ref|ZP_07911073.1| exodeoxyribonuclease VII large subunit [Staphylococcus lugdunensis
           M23590]
 gi|315496530|gb|EFU84853.1| exodeoxyribonuclease VII large subunit [Staphylococcus lugdunensis
           M23590]
          Length = 445

 Score =  248 bits (632), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 175/493 (35%), Positives = 258/493 (52%), Gaps = 66/493 (13%)

Query: 14  EY-SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           EY SVS L+ ++K+  + +  L  V ++GE+S ++  HSSGH YF++KD +S I A+++K
Sbjct: 3   EYLSVSTLTKYIKYKFDQDPHLQSVLIKGELSNFKR-HSSGHLYFNVKDQNSVISAMMFK 61

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           G   KI F P+EG E L+  +++ +     YQI +  +   G G L   LE+ KKKL +E
Sbjct: 62  GNAAKINFDPKEGDEVLIEARVSVYERRGNYQIYVNKMQLDGIGNLYQRLEELKKKLTKE 121

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK--VQGDECPK 188
           GLF  Q+K  IP  PK IA++T+ TGA IRDI   I  R+PL V   P+   VQG +  +
Sbjct: 122 GLFDQQYKKSIPKYPKKIAILTASTGAAIRDIQTTIESRYPL-VEKIPISTLVQGTQAKQ 180

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           +I   I   ++L         D II+ RGGGSIEDLW+FN+E +VRAI N   PIISA+G
Sbjct: 181 DIIEKIRYADSL-------NVDTIIVGRGGGSIEDLWNFNEEEVVRAIYNCQTPIISAVG 233

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HETD+TL+D+AAD+RA TPT AA +A P +  L               ++ IK +  TL 
Sbjct: 234 HETDFTLSDFAADIRAATPTQAAVIATPDQYDL---------------MQQIKQQQFTLT 278

Query: 309 SLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQK 368
             +             R R+++  ++L+H         Y  F       K   L+++ Q 
Sbjct: 279 RYI-------------RQRIEQHRKQLQH------ISSYYKF-------KQPSLLYDQQI 312

Query: 369 NRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKN---RIFYLHTHIKKLIT 425
            R+  LEKQ +++ I K        E+K+ + I+   R   KN    I        +L T
Sbjct: 313 QRRDDLEKQLNLKIITK------LKEQKQNLQIIQQ-RFNIKNFKQHILTEQRQTNQLET 365

Query: 426 RIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRI 485
            +  I+ H++K   T +      L   +  NT+ RGY SI   +N  +T   +L     I
Sbjct: 366 NLTKIIQHQLKQFSTLLHNQVEQLNHLSPTNTMLRGY-SIIHKDNQVVTSTHDLTVNDDI 424

Query: 486 LINFFDGQANAIV 498
            +N  DGQ  A +
Sbjct: 425 TLNMKDGQVEATI 437


>gi|302389867|ref|YP_003825688.1| Exodeoxyribonuclease VII large subunit [Thermosediminibacter oceani
           DSM 16646]
 gi|302200495|gb|ADL08065.1| Exodeoxyribonuclease VII large subunit [Thermosediminibacter oceani
           DSM 16646]
          Length = 410

 Score =  248 bits (632), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 134/300 (44%), Positives = 188/300 (62%), Gaps = 14/300 (4%)

Query: 10  LDHPEYSVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           +  P  +VSEL+  +K++ +SN  L  V VRGEIS ++  H SGH YF LKD  ++I  +
Sbjct: 1   MAAPVLTVSELTGIIKYLFDSNEILRQVYVRGEISNFK-YHLSGHIYFVLKDEKAQIRCV 59

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           ++K     + F+PE G+  +  G +T +  + +YQ+ ++ + P G G L  A EK K KL
Sbjct: 60  MFKNKSVLLPFMPENGMRVVAFGYVTVYEKNGEYQLYVDDMEPDGIGALYLAYEKLKAKL 119

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
            +EGLF    K  IPF+PK I +ITS  GA I+D+L  I  RFP + ++I PV VQG + 
Sbjct: 120 QKEGLFDANRKKAIPFLPKNIGIITSINGAAIKDLLTVIRRRFPNVNILIAPVSVQGKQA 179

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
             EI  AI  LN +       + D+II+ARGGGSIE+LW FN+E + RAI +S IPIISA
Sbjct: 180 ADEICEAIKDLNRIG------KLDVIIVARGGGSIEELWTFNEEKVARAIYSSRIPIISA 233

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD+T+AD+ AD RAPTP+ A EM VP K  L   L +++ R   II  +  + +NT
Sbjct: 234 VGHETDYTIADFVADKRAPTPSAAGEMVVPEKNQL---LADIDQRKKRIIAAMCAF-LNT 289


>gi|222055715|ref|YP_002538077.1| exodeoxyribonuclease VII, large subunit [Geobacter sp. FRC-32]
 gi|259646292|sp|B9M0X3|EX7L_GEOSF RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|221565004|gb|ACM20976.1| exodeoxyribonuclease VII, large subunit [Geobacter sp. FRC-32]
          Length = 445

 Score =  247 bits (631), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 145/382 (37%), Positives = 229/382 (59%), Gaps = 17/382 (4%)

Query: 4   FSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSR 63
           F++KN L     SVS+L+  +++++E N  HV V GE+S       SGH YF+LKD  ++
Sbjct: 3   FAEKNIL-----SVSQLTGLVRNVLEDNFDHVWVEGEVSNL-ATPGSGHLYFTLKDASAQ 56

Query: 64  IDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKR 123
           +  ++++ ++  ++F P +G+  +  G+++ F    +YQ+I+E L P G G L  A  + 
Sbjct: 57  LRCVMFRASVRALKFKPSDGMGLIARGRLSVFDARGEYQLIVEYLEPKGIGALQLAFIQL 116

Query: 124 KKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQ 182
           K++L +EGLFSD HK  IP +P+ I ++TS TGA I DIL  ++ RF  ++V++ PVKVQ
Sbjct: 117 KERLAKEGLFSDSHKKDIPRLPQRIGIVTSATGAAIHDILNVLNRRFANVQVLLRPVKVQ 176

Query: 183 GDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIP 242
           G+   +EIA A+  LN           D++I+ RGGGS+EDLW FN+E++ RAI  SSIP
Sbjct: 177 GEGAAEEIAAAVNDLNRYGS------IDVMIVGRGGGSLEDLWAFNEEIVARAIYRSSIP 230

Query: 243 IISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKY 302
           +ISA+GHE D+T++D+ ADLRAPTP+ AAEM +  K  + + L  L  RL   + RL+  
Sbjct: 231 VISAVGHEIDFTISDFVADLRAPTPSAAAEMVIKSKAEISAELEALFHRLGMAVRRLLNE 290

Query: 303 KINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKY--RHFNHIINRIKSD 360
               LN L++A+ +    L     RLD L       +  ++ R     HF H  +R++  
Sbjct: 291 HWGELNGLVRAVKDPSMLLGHLAQRLDDLEGRSWRCIRQLLIRSADTNHFLH--DRLRLQ 348

Query: 361 FLIHNIQKNRQHILEKQQHIEQ 382
             +  +++ R+ +L  Q  IE+
Sbjct: 349 NPVLRLERCREQLLLVQSRIEK 370


>gi|293553171|ref|ZP_06673808.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecium
           E1039]
 gi|291602581|gb|EFF32796.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecium
           E1039]
          Length = 445

 Score =  247 bits (631), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 126/294 (42%), Positives = 191/294 (64%), Gaps = 12/294 (4%)

Query: 14  EY-SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           EY +V+ L+ +LK   +++  L  V + GEIS +R + ++ H YFSLKD++++I AI++K
Sbjct: 4   EYLTVTTLTKYLKRKFDADPYLERVYLTGEISNFR-LRANAHQYFSLKDDYAKISAIMFK 62

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           G   K+ F P+EG++ LV+G+I+ +     YQI +E + P G G L   LE+RK+KL++E
Sbjct: 63  GAFQKLRFQPKEGMKVLVVGRISLYEAGGSYQIYVEHMEPDGIGALYQELEERKEKLMKE 122

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKE 189
           GLF    K  +P  PK IAV+TSP+GAVIRDI+  +  R+P+ ++++FP  VQG++    
Sbjct: 123 GLFQG-PKKMLPRFPKRIAVLTSPSGAVIRDIITTVKRRYPIVQLVLFPTVVQGNQAADN 181

Query: 190 IANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGH 249
           +   I ++  +         D +I+ RGGGSIEDLW FN+E + RAI  ++ P+IS++GH
Sbjct: 182 VVRNIQRVEEMGNF------DTMIIGRGGGSIEDLWPFNEERVARAIYQANTPVISSVGH 235

Query: 250 ETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYK 303
           ETD T+AD  AD+RA TPT AAE+AVPV       +   +ARL    +R I+ K
Sbjct: 236 ETDTTIADLVADVRAATPTAAAELAVPVLSEELMRIQERQARLQQAFVRQIQRK 289


>gi|189347516|ref|YP_001944045.1| exodeoxyribonuclease VII large subunit [Chlorobium limicola DSM
           245]
 gi|189341663|gb|ACD91066.1| exodeoxyribonuclease VII, large subunit [Chlorobium limicola DSM
           245]
          Length = 465

 Score =  247 bits (630), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 128/282 (45%), Positives = 186/282 (65%), Gaps = 4/282 (1%)

Query: 16  SVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNK 75
           SVSEL++ +K  +ES    V V+GEIS  +  HSSGH Y +LKD+ ++I A+IWK T  +
Sbjct: 70  SVSELTFRIKSELESIFPVVRVKGEISNCKR-HSSGHTYLTLKDDQAQIPAVIWKNTGTR 128

Query: 76  IEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSD 135
           I F   +G+E +  G++  +P S +YQ+I  S+  +G G L  A     +KL + G F+ 
Sbjct: 129 ISFDLRDGMEVIAEGRLEVYPPSGRYQLICSSVTEAGQGQLQQAFAMLLQKLAKAGYFNA 188

Query: 136 QHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANAI 194
           + K  IP IP+ I +ITSPTGAVI D+ + I  RFP +R+++FPV+VQGD+  +E+   I
Sbjct: 189 ERKKKIPAIPETIGIITSPTGAVIEDMGRVIERRFPAVRILLFPVRVQGDDAAREVKRGI 248

Query: 195 LQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWT 254
              N   + R   R D++I+ARGGGS+EDL  FN+EM+  AI  SS+P+ISA+GHETD T
Sbjct: 249 DYFNNPADPRH--RADVLIVARGGGSMEDLQAFNEEMVAEAIYRSSVPVISAVGHETDIT 306

Query: 255 LADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNII 296
           +AD  ADLRA TP+ AAE+AVP +  L  ++ N + R + ++
Sbjct: 307 IADMVADLRAGTPSIAAELAVPDRGDLLKTIENQQMRQSALM 348


>gi|94269423|ref|ZP_01291459.1| Exodeoxyribonuclease VII [delta proteobacterium MLMS-1]
 gi|93451227|gb|EAT02130.1| Exodeoxyribonuclease VII [delta proteobacterium MLMS-1]
          Length = 445

 Score =  247 bits (630), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 134/335 (40%), Positives = 200/335 (59%), Gaps = 8/335 (2%)

Query: 7   KNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDA 66
           +N  D+   +VSEL+  ++ ++E++ + V V GEIS  R   +SGH YF+LKD H+++  
Sbjct: 6   ENPFDNRIQTVSELTRSIRGLLETSYNMVTVSGEISNLRR-PASGHLYFTLKDAHAQLRG 64

Query: 67  IIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKK 126
           +++KG    +   P +G+E L  G+++ +    +YQ+I++ +   G+G L  A ++ K K
Sbjct: 65  VLFKGQQRYLACNPADGLEVLCRGRLSVYEPRGEYQLIVDFMDGKGAGLLRVAFDRLKAK 124

Query: 127 LLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVI-IFPVKVQGDE 185
           L  EGLF    K P+PF+P+ IA++TSP GA +RD L +     P   I I PV+VQGD 
Sbjct: 125 LEAEGLFEPARKKPLPFLPRRIALVTSPQGAAVRDFLTQAGKLCPFTAIEIMPVRVQGDG 184

Query: 186 CPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIIS 245
              EIA+AI QLN  +        +II+L RGGGS+EDLW FN+E + RAIA S IP++S
Sbjct: 185 AAAEIADAIHQLNERQSS------EIIVLCRGGGSLEDLWAFNEEAVARAIAASQIPVVS 238

Query: 246 AIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKIN 305
           A+GHE D+T+AD  ADLRAPTPT AA + +P  E L +    L  RL   + R +     
Sbjct: 239 AVGHEVDYTIADLVADLRAPTPTAAARLILPDGEQLLAQARELSHRLAAAMRRHLLEARR 298

Query: 306 TLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLE 340
            L +  + L +  + L+    RLD L  +L   L+
Sbjct: 299 RLEAEQRLLRDPARGLAQHAIRLDYLRADLARALQ 333


>gi|94268197|ref|ZP_01291113.1| Exodeoxyribonuclease VII [delta proteobacterium MLMS-1]
 gi|93451692|gb|EAT02469.1| Exodeoxyribonuclease VII [delta proteobacterium MLMS-1]
          Length = 445

 Score =  247 bits (630), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 134/335 (40%), Positives = 200/335 (59%), Gaps = 8/335 (2%)

Query: 7   KNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDA 66
           +N  D+   +VSEL+  ++ ++E++ + V V GEIS  R   +SGH YF+LKD H+++  
Sbjct: 6   ENPFDNRIQTVSELTRSIRGLLETSYNMVTVSGEISNLRR-PASGHLYFTLKDAHAQLRG 64

Query: 67  IIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKK 126
           +++KG    +   P +G+E L  G+++ +    +YQ+I++ +   G+G L  A ++ K K
Sbjct: 65  VLFKGQQRYLACNPADGLEVLCRGRLSVYEPRGEYQLIVDFMDGKGAGLLRVAFDRLKAK 124

Query: 127 LLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVI-IFPVKVQGDE 185
           L  EGLF    K P+PF+P+ IA++TSP GA +RD L +     P   I I PV+VQGD 
Sbjct: 125 LEAEGLFEPARKKPLPFLPRRIALVTSPQGAAVRDFLTQAGKLCPFTAIEIMPVRVQGDG 184

Query: 186 CPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIIS 245
              EIA+AI QLN  +        +II+L RGGGS+EDLW FN+E + RAIA S IP++S
Sbjct: 185 AAAEIADAIHQLNERQSS------EIIVLCRGGGSLEDLWAFNEEAVARAIAASQIPVVS 238

Query: 246 AIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKIN 305
           A+GHE D+T+AD  ADLRAPTPT AA + +P  E L +    L  RL   + R +     
Sbjct: 239 AVGHEVDYTIADLVADLRAPTPTAAARLILPDGEQLLAQARELSHRLAAAMRRHLLEARR 298

Query: 306 TLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLE 340
            L +  + L +  + L+    RLD L  +L   L+
Sbjct: 299 RLEAEQRLLRDPARGLAQHAIRLDYLRADLARALQ 333


>gi|227550444|ref|ZP_03980493.1| Exodeoxyribonuclease VII [Enterococcus faecium TX1330]
 gi|257897153|ref|ZP_05676806.1| exonuclease VII [Enterococcus faecium Com12]
 gi|293377378|ref|ZP_06623582.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecium
           PC4.1]
 gi|227180345|gb|EEI61317.1| Exodeoxyribonuclease VII [Enterococcus faecium TX1330]
 gi|257833718|gb|EEV60139.1| exonuclease VII [Enterococcus faecium Com12]
 gi|292644070|gb|EFF62176.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecium
           PC4.1]
          Length = 453

 Score =  247 bits (630), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 125/294 (42%), Positives = 191/294 (64%), Gaps = 12/294 (4%)

Query: 14  EY-SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           EY +V+ L+ +LK   +++  L  V + GEIS +R + ++ H YFSLKD+H++I AI++K
Sbjct: 4   EYLTVTTLTRYLKRKFDADPYLERVYLTGEISNFR-LRANAHQYFSLKDDHAKISAIMFK 62

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           G   K+ F P+EG++ LV+G+I+ +     YQI +E + P G G L   LE+RK+KL++E
Sbjct: 63  GAFQKLRFQPKEGMKVLVVGRISLYEAGGSYQIYVEHMEPDGIGALYQELEERKEKLMKE 122

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKE 189
           GLF    K  +P  PK IA++TSP+GAVIRDI+  +  R+P+ ++++FP  VQG++    
Sbjct: 123 GLFQG-PKKMLPRFPKRIAILTSPSGAVIRDIITTVKRRYPIVQLVLFPTVVQGNQAADN 181

Query: 190 IANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGH 249
           +   I ++  + +       D +I+ RGGGSIEDLW FN+E + RAI  ++ P+IS++GH
Sbjct: 182 VVKNIRRVEEMGDF------DTMIIGRGGGSIEDLWPFNEERVARAIYQANTPVISSVGH 235

Query: 250 ETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYK 303
           ETD T+AD  AD+RA TPT AAE+AVPV       +   +ARL    +  I+ K
Sbjct: 236 ETDTTIADLVADVRAATPTAAAELAVPVLSEELMRIQERQARLQQAFVHQIQRK 289


>gi|257888472|ref|ZP_05668125.1| exonuclease VII [Enterococcus faecium 1,141,733]
 gi|257824526|gb|EEV51458.1| exonuclease VII [Enterococcus faecium 1,141,733]
          Length = 445

 Score =  247 bits (630), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 125/294 (42%), Positives = 191/294 (64%), Gaps = 12/294 (4%)

Query: 14  EY-SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           EY +V+ L+ +LK   +++  L  V + GEIS +R + ++ H YFSLKD+H++I AI++K
Sbjct: 4   EYLTVTTLTRYLKRKFDADPYLERVYLTGEISNFR-LRANAHQYFSLKDDHAKISAIMFK 62

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           G   K+ F P+EG++ LV+G+I+ +     YQI +E + P G G L   LE+RK+KL++E
Sbjct: 63  GAFQKLRFQPKEGMKVLVVGRISLYEAGGSYQIYVEHMEPDGIGALYQELEERKEKLMKE 122

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKE 189
           GLF    K  +P  PK IA++TSP+GAVIRDI+  +  R+P+ ++++FP  VQG++    
Sbjct: 123 GLFQG-PKKMLPRFPKRIAILTSPSGAVIRDIITTVKRRYPIVQLVLFPTVVQGNQAADN 181

Query: 190 IANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGH 249
           +   I ++  + +       D +I+ RGGGSIEDLW FN+E + RAI  ++ P+IS++GH
Sbjct: 182 VVKNIRRVEEMGDF------DTMIIGRGGGSIEDLWPFNEERVARAIYQANTPVISSVGH 235

Query: 250 ETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYK 303
           ETD T+AD  AD+RA TPT AAE+AVPV       +   +ARL    +  I+ K
Sbjct: 236 ETDTTIADLVADVRAATPTAAAELAVPVLSEELMRIQERQARLQQAFVHQIQRK 289


>gi|227530528|ref|ZP_03960577.1| exodeoxyribonuclease VII large subunit [Lactobacillus vaginalis
           ATCC 49540]
 gi|227349534|gb|EEJ39825.1| exodeoxyribonuclease VII large subunit [Lactobacillus vaginalis
           ATCC 49540]
          Length = 445

 Score =  246 bits (629), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 144/380 (37%), Positives = 223/380 (58%), Gaps = 20/380 (5%)

Query: 10  LDHPEY-SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDA 66
           +D  +Y +VSEL+ +LK   + +  L  V + GE+S +R      H YFS+KD ++ IDA
Sbjct: 1   MDRSQYLTVSELTSYLKQKFDRDPYLKTVYLTGELSNFR--LRQRHQYFSIKDENAVIDA 58

Query: 67  IIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKK 126
           ++++    ++ F PE G++ LV+G I  +  S +YQI ++ + P G G L    E+ KKK
Sbjct: 59  VMFERQFRQVNFRPETGMKILVVGHIGLYEKSGRYQIYVDRMEPDGLGALYLQFEQLKKK 118

Query: 127 LLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDE 185
           L  EGLF DQ   PIP  PK IAV+TS  GAVIRDI   +  R+P+ +V++FP  VQGD+
Sbjct: 119 LGAEGLF-DQIPRPIPQFPKRIAVVTSLDGAVIRDINTTVRRRYPIAQVVLFPTVVQGDK 177

Query: 186 CPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIIS 245
              +IA  I + N +         D +I+ RGGGS+EDLW FN+E++ RAIA+S IP+IS
Sbjct: 178 AATDIARQINRANQIGNF------DTMIIGRGGGSLEDLWPFNEEIVARAIADSHIPVIS 231

Query: 246 AIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINL---EARLNNIIIRLIKY 302
           ++GHETD T+AD  AD RA TPT AAE+A P    L   L+ +   + RLNN + +LI +
Sbjct: 232 SVGHETDTTIADLVADQRAATPTAAAELATP--NRLADVLMTIQDDQVRLNNTMKKLIDF 289

Query: 303 KINTLNSLLKALPNSDQTLSCSRY--RLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
               L   L++      +     Y  +LD+L + LE+N+  ++  +      +  R++ +
Sbjct: 290 DRKQLQKQLQSYIFQQPSRLYENYAQKLDQLTQTLENNVSNLVKDRLNRVQQLQGRLQIN 349

Query: 361 FLIHNIQKNRQHILEKQQHI 380
              H I++ ++ + + Q  +
Sbjct: 350 SPQHTIERAQETVTQLQNRL 369


>gi|29375561|ref|NP_814715.1| exodeoxyribonuclease VII large subunit [Enterococcus faecalis V583]
 gi|227555089|ref|ZP_03985136.1| exodeoxyribonuclease VII large subunit [Enterococcus faecalis HH22]
 gi|81838968|sp|Q836W6|EX7L_ENTFA RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|29343022|gb|AAO80785.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           V583]
 gi|227175757|gb|EEI56729.1| exodeoxyribonuclease VII large subunit [Enterococcus faecalis HH22]
 gi|315574276|gb|EFU86467.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           TX0309B]
 gi|315581569|gb|EFU93760.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           TX0309A]
          Length = 448

 Score =  246 bits (629), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 138/389 (35%), Positives = 230/389 (59%), Gaps = 17/389 (4%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ +LK   +++  L  V + GEIS +R   ++ H YFSLKD+H++I AI++K   
Sbjct: 7   TVTALTKYLKRKFDADPYLGRVYLTGEISNFR-FRANAHQYFSLKDDHAKISAIMFKSAF 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            K++F P+EG++ +V+G+I+ +  S  YQI IE + P G G L  AL + ++KL +EGLF
Sbjct: 66  QKLKFQPKEGMKVMVVGRISLYENSGSYQIYIEHMEPDGVGALYQALAELREKLGKEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
            +  K  +P  PK IAV+TSP+GAVIRDI+  +  R+P+ ++++FP  VQG++   +I  
Sbjct: 126 -EGPKQQLPRYPKRIAVVTSPSGAVIRDIITTVKRRYPIAQLVLFPTLVQGEQAADDIVR 184

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
            I + +   +       D +I+ RGGGSIEDLW FN+E + RAI  ++ PIIS++GHETD
Sbjct: 185 NIQRADAQSDF------DTMIIGRGGGSIEDLWPFNEEKVARAIHAATTPIISSVGHETD 238

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            T+AD  AD+RA TPT AAE+AVPV       +    +RL    + L++ +      L  
Sbjct: 239 VTIADMVADVRAATPTAAAELAVPVLNEELLRISERRSRLEQSFLYLLQQRTERFQRLQN 298

Query: 313 A--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNR 370
           +      ++       +LDR+ + L   +  I  +K R    II +++       +++++
Sbjct: 299 SYVFKQPERLYEGQTIKLDRMTQRLFQAMTTIHHQKQRQAQGIIAQLQQQTPKGQLRESQ 358

Query: 371 QHILEKQQHIEQIVKQHLRYIFLEKKEKI 399
           Q +   Q++++  + Q    +FL K+++ 
Sbjct: 359 QQLAFLQRNLQTQMTQ----LFLNKQKQF 383


>gi|289550705|ref|YP_003471609.1| Exodeoxyribonuclease VII large subunit [Staphylococcus lugdunensis
           HKU09-01]
 gi|289180237|gb|ADC87482.1| Exodeoxyribonuclease VII large subunit [Staphylococcus lugdunensis
           HKU09-01]
          Length = 445

 Score =  246 bits (629), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 175/493 (35%), Positives = 257/493 (52%), Gaps = 66/493 (13%)

Query: 14  EY-SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           EY SVS L+ ++K+  + +  L  V ++GE+S ++  HSSGH YF++KD +S I A+++K
Sbjct: 3   EYLSVSTLTKYIKYKFDQDPHLQSVLIKGELSNFKR-HSSGHLYFNVKDQNSVISAMMFK 61

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           G   KI F P+EG E L+  +++ +     YQI +  +   G G L   LE+ KKKL +E
Sbjct: 62  GNAAKINFDPKEGDEVLIEARVSVYERRGNYQIYVNKMQLDGIGNLYQRLEELKKKLTKE 121

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK--VQGDECPK 188
           GLF  Q+K  IP  PK IA++T+ TGA IRDI   I  R+PL V   P+   VQG +  +
Sbjct: 122 GLFDQQYKKSIPKYPKKIAILTASTGAAIRDIQTTIESRYPL-VEKIPISTLVQGTQAKQ 180

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           +I   I   ++L         D II+ RGGGSIEDLW+FN+E +VRAI N   PIISA+G
Sbjct: 181 DIIEKIRYADSL-------NVDTIIVGRGGGSIEDLWNFNEEEVVRAIYNCQTPIISAVG 233

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HETD+TL+D+AAD+RA TPT AA +A P +  L               ++ IK +  TL 
Sbjct: 234 HETDFTLSDFAADIRAATPTQAAVIATPDQYDL---------------MQQIKQQQFTLT 278

Query: 309 SLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQK 368
             +             R R+ +  ++L+H         Y  F       K   L+++ Q 
Sbjct: 279 RYI-------------RQRIKQHRKQLQH------ISSYYKF-------KQPSLLYDQQI 312

Query: 369 NRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKN---RIFYLHTHIKKLIT 425
            R+  LEKQ +++ I K        E+K+ + I+   R   KN    I        +L T
Sbjct: 313 QRRDDLEKQLNLKIITK------LKEQKQNLQIIQQ-RFNIKNFKQHILTEQRQTNQLET 365

Query: 426 RIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRI 485
            +  I+ H++K   T +      L   +  NT+ RGY SI   +N  +T   +L     I
Sbjct: 366 NLTKIIQHQLKQFSTLLHNQVEQLNHLSPTNTMLRGY-SIIHKDNQVVTSTHDLTVNDDI 424

Query: 486 LINFFDGQANAIV 498
            +N  DGQ  A +
Sbjct: 425 TLNMKDGQVEATI 437


>gi|325473468|gb|EGC76663.1| exodeoxyribonuclease 7 large subunit [Treponema denticola F0402]
          Length = 398

 Score =  246 bits (628), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 127/302 (42%), Positives = 187/302 (61%), Gaps = 16/302 (5%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
           YSV E++  +K ++ES   +V + GEIS +R   ++GH YF+LKD  + I A+++KG   
Sbjct: 5   YSVYEITLQIKELLESGFGYVSIEGEISNFRP-SAAGHLYFTLKDEKASIQAVMFKGKTR 63

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
            + F+P++G+     G I+ +     YQIIIE +  +G G +L  LE+RKKKL  EG+F 
Sbjct: 64  SLSFVPKDGMTVKAEGAISVYEQRGSYQIIIEEMSLAGEGNILKMLEERKKKLAAEGIFD 123

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCR-FPLRVIIFPVKVQGDECPKEIANA 193
            + K P+P+ PK IAVITSPTGA +RDI+  +  R   + +++ P  VQG+E    +   
Sbjct: 124 SERKKPLPYFPKRIAVITSPTGAAVRDIINVVKRRNEKIGIVVLPAIVQGEEAAPVL--- 180

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I QL    E       D+II+ RGGGS+EDL  F+DE +VRAIA    P+ISA+GHE DW
Sbjct: 181 IRQLKIADEKNLG---DLIIIGRGGGSLEDLLPFSDEELVRAIAACKTPVISAVGHEIDW 237

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLI--------NLEARLNNIIIRLIKYKIN 305
            L+D+AAD+RAPTP+ AAE+A P+   +  S+         N+E R+  I + L  +K +
Sbjct: 238 ALSDFAADMRAPTPSAAAELAAPILNDIMYSIAVNREDLTQNIENRIERIRLMLNNFKPD 297

Query: 306 TL 307
           +L
Sbjct: 298 SL 299


>gi|146312641|ref|YP_001177715.1| exodeoxyribonuclease VII large subunit [Enterobacter sp. 638]
 gi|166919633|sp|A4WD84|EX7L_ENT38 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|145319517|gb|ABP61664.1| exodeoxyribonuclease VII, large subunit [Enterobacter sp. 638]
          Length = 457

 Score =  246 bits (628), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 159/505 (31%), Positives = 253/505 (50%), Gaps = 67/505 (13%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
           Y+VS L+  ++ ++E  +  V + GEIS +    SSGH YF+LKD+++++   +++ +  
Sbjct: 10  YTVSRLNQSVRLLLEQEMGQVWISGEISNFTQ-PSSGHWYFTLKDDNAQVRCAMFRNSNR 68

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
           ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL  EGLF 
Sbjct: 69  RVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKLSAEGLFD 128

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANA 193
            Q K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ P +I  A
Sbjct: 129 QQFKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDAPGQIVRA 188

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N   E   C   D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA+GHETD 
Sbjct: 189 IELANARHE---C---DVLIVGRGGGSLEDLWSFNDERVARAIFASQIPVVSAVGHETDV 242

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           T+AD+ +D+RAPTP+ AAE+   V  + Q                           LL+ 
Sbjct: 243 TIADFVSDMRAPTPSAAAEV---VSRNQQ--------------------------ELLRQ 273

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           + N  Q               LE  ++  +  + R F  + +R++        Q++ Q  
Sbjct: 274 MQNGQQ--------------RLEMAMDYFLANRTRRFTQLHHRLQ--------QQHPQLR 311

Query: 374 LEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLR-------EQTKNRIFYLHTHIKKLITR 426
           LE+QQ + + ++Q + +  L+ + K  + H  R       +  + +I+   T I++L  R
Sbjct: 312 LERQQTVLERLRQRMNFA-LDNQLKRVVSHQQRMTQRLNQQNPQPKIYRTQTRIQQLEYR 370

Query: 427 IEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRIL 486
           +   L  ++ +           L++ +  +TL RGY+    T+   + Q + +     + 
Sbjct: 371 LAENLRARLSTTRERFGNAVTHLEAVSPLSTLARGYSVTTATDGKVLKQTKQVKAGDLMT 430

Query: 487 INFFDGQANAIVINKAPPKEQPTKK 511
               DG   + V    P K+   KK
Sbjct: 431 TRLADGWVESEVKGITPAKKTRKKK 455


>gi|258511743|ref|YP_003185177.1| exodeoxyribonuclease VII, large subunit [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
 gi|257478469|gb|ACV58788.1| exodeoxyribonuclease VII, large subunit [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
          Length = 469

 Score =  246 bits (628), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 161/504 (31%), Positives = 251/504 (49%), Gaps = 59/504 (11%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLK 58
           MN  ++  +      +V+EL+  +K  +ES+  L    V GEIS ++  H SGH YF+LK
Sbjct: 1   MNALTRAAAEAEAVLTVTELNRRIKERLESDPRLIQCRVVGEISNFKH-HPSGHMYFTLK 59

Query: 59  DNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLT 118
           D  SRI A+++     +++F PE+G+  +  G +  F    +YQ+ +E L P G G L  
Sbjct: 60  DETSRIRAVMFSSRNRRLQFQPEDGMRVIAFGSVGVFERDGQYQLYVEDLEPDGLGALYV 119

Query: 119 ALEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIF 177
             E+ +++L  EGLF+ + K  +P  P  + V+TSPTGAVIRDI   I  R+PL RVI+ 
Sbjct: 120 RYEQLRQQLAAEGLFAPERKRLLPRFPLRVGVVTSPTGAVIRDICTTIERRYPLARVILA 179

Query: 178 PVKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIA 237
           P +VQG +    I  A+  L  L+     P+ D+II+ RGGGS+E+LW FN+EM+VRA+A
Sbjct: 180 PAQVQGPDAAPTIVRALEVLYALE-----PKVDVIIVGRGGGSLEELWPFNEEMVVRAVA 234

Query: 238 NSSIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIII 297
            S +P++SA+GHETD TL D+AAD+RA TPT AAE+  P +  L++ L    AR     +
Sbjct: 235 RSPVPVVSAVGHETDVTLCDFAADVRAATPTAAAELVCPHQAELRAYLEQASARARKAAL 294

Query: 298 RLIKYKINTLNSLLK--ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIIN 355
             + +    L  L     L +  + ++  R  +D +   +       I  + R    +  
Sbjct: 295 VKVAWGRERLLDLAGRPVLRDPTRIIAVRRQLVDFIETRVREAQRRPIGLRRRALADLER 354

Query: 356 RIKSDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFY 415
           R++   L   IQ  R+ ++  +                         H +R  T+ ++  
Sbjct: 355 RLQRVQLGGAIQGRRRDLMRLE-------------------------HQVRSLTERQLLV 389

Query: 416 LHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNN-NFIT 474
               ++ +I ++E                    L   A    L+RGY  I D +  + IT
Sbjct: 390 QSRKLEGVIGKLE-------------------ALNPLA---VLRRGYGVILDEDGRSVIT 427

Query: 475 QKRNLATKTRILINFFDGQANAIV 498
             ++LA   RI I   DG   A V
Sbjct: 428 SAQSLAPGKRIGIRMHDGTVEAEV 451


>gi|255974046|ref|ZP_05424632.1| exonuclease VII [Enterococcus faecalis T2]
 gi|307278971|ref|ZP_07560030.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           TX0860]
 gi|255966918|gb|EET97540.1| exonuclease VII [Enterococcus faecalis T2]
 gi|306504358|gb|EFM73569.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           TX0860]
          Length = 448

 Score =  246 bits (628), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 138/389 (35%), Positives = 230/389 (59%), Gaps = 17/389 (4%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ +LK   +++  L  V + GEIS +R   ++ H YFSLKD+H++I AI++K   
Sbjct: 7   TVTALTKYLKRKFDADPYLGRVYLTGEISNFR-FRANAHQYFSLKDDHAKISAIMFKSAF 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            K++F P+EG++ +V+G+I+ +  S  YQI IE + P G G L  AL + ++KL +EGLF
Sbjct: 66  QKLKFQPKEGMKVMVVGRISLYENSGSYQIYIEHMEPDGVGALYQALAELREKLGKEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
            +  K  +P  PK IAV+TSP+GAVIRDI+  +  R+P+ ++++FP  VQG++   +I  
Sbjct: 126 -EGPKQQLPRYPKRIAVVTSPSGAVIRDIITTVKRRYPIAQLVLFPTLVQGEQAADDIVR 184

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
            I + +   +       D +I+ RGGGSIEDLW FN+E + RAI  ++ PIIS++GHETD
Sbjct: 185 NIQRADAQGDF------DTMIIGRGGGSIEDLWPFNEEKVARAIHAATTPIISSVGHETD 238

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            T+AD  AD+RA TPT AAE+AVPV       +    +RL    + L++ +      L  
Sbjct: 239 VTIADMVADVRAATPTAAAELAVPVLNEELLRISERRSRLEQSFLYLLQQRTERFQRLQN 298

Query: 313 A--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNR 370
           +      ++       +LDR+ + L   +  I  +K R    II +++       +++++
Sbjct: 299 SYVFKQPERLYEGQTIKLDRMTQRLFQAMTTIHHKKQRQAQGIIAQLQQQTPKGQLRESQ 358

Query: 371 QHILEKQQHIEQIVKQHLRYIFLEKKEKI 399
           Q +   Q++++  + Q    +FL K+++ 
Sbjct: 359 QQLAFLQRNLQTQMTQ----LFLNKQKQF 383


>gi|227517902|ref|ZP_03947951.1| exodeoxyribonuclease VII large subunit [Enterococcus faecalis
           TX0104]
 gi|229546826|ref|ZP_04435551.1| exodeoxyribonuclease VII large subunit [Enterococcus faecalis
           TX1322]
 gi|229548920|ref|ZP_04437645.1| exodeoxyribonuclease VII large subunit [Enterococcus faecalis ATCC
           29200]
 gi|255971433|ref|ZP_05422019.1| exonuclease VII [Enterococcus faecalis T1]
 gi|256617902|ref|ZP_05474748.1| exonuclease VII [Enterococcus faecalis ATCC 4200]
 gi|256761735|ref|ZP_05502315.1| exonuclease VII [Enterococcus faecalis T3]
 gi|256852632|ref|ZP_05558003.1| exodeoxyribonuclease VII large subunit [Enterococcus faecalis T8]
 gi|256957071|ref|ZP_05561242.1| exonuclease VII [Enterococcus faecalis DS5]
 gi|256962596|ref|ZP_05566767.1| exonuclease VII [Enterococcus faecalis HIP11704]
 gi|257077867|ref|ZP_05572228.1| exonuclease VII [Enterococcus faecalis JH1]
 gi|257083888|ref|ZP_05578249.1| exonuclease VII [Enterococcus faecalis Fly1]
 gi|257089388|ref|ZP_05583749.1| exonuclease VII large subunit [Enterococcus faecalis CH188]
 gi|257415597|ref|ZP_05592591.1| exonuclease VII [Enterococcus faecalis AR01/DG]
 gi|257418570|ref|ZP_05595564.1| exodeoxyribonuclease VII large subunit [Enterococcus faecalis T11]
 gi|257421228|ref|ZP_05598218.1| exodeoxyribonuclease VII large subunit [Enterococcus faecalis X98]
 gi|294780569|ref|ZP_06745932.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           PC1.1]
 gi|300859769|ref|ZP_07105857.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           TUSoD Ef11]
 gi|307268060|ref|ZP_07549448.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           TX4248]
 gi|307271990|ref|ZP_07553257.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           TX0855]
 gi|307289418|ref|ZP_07569372.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           TX0109]
 gi|312904542|ref|ZP_07763700.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           TX0635]
 gi|312952748|ref|ZP_07771610.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           TX0102]
 gi|227074656|gb|EEI12619.1| exodeoxyribonuclease VII large subunit [Enterococcus faecalis
           TX0104]
 gi|229305941|gb|EEN71937.1| exodeoxyribonuclease VII large subunit [Enterococcus faecalis ATCC
           29200]
 gi|229307991|gb|EEN73978.1| exodeoxyribonuclease VII large subunit [Enterococcus faecalis
           TX1322]
 gi|255962451|gb|EET94927.1| exonuclease VII [Enterococcus faecalis T1]
 gi|256597429|gb|EEU16605.1| exonuclease VII [Enterococcus faecalis ATCC 4200]
 gi|256682986|gb|EEU22681.1| exonuclease VII [Enterococcus faecalis T3]
 gi|256711977|gb|EEU27014.1| exodeoxyribonuclease VII large subunit [Enterococcus faecalis T8]
 gi|256947567|gb|EEU64199.1| exonuclease VII [Enterococcus faecalis DS5]
 gi|256953092|gb|EEU69724.1| exonuclease VII [Enterococcus faecalis HIP11704]
 gi|256985897|gb|EEU73199.1| exonuclease VII [Enterococcus faecalis JH1]
 gi|256991918|gb|EEU79220.1| exonuclease VII [Enterococcus faecalis Fly1]
 gi|256998200|gb|EEU84720.1| exonuclease VII large subunit [Enterococcus faecalis CH188]
 gi|257157425|gb|EEU87385.1| exonuclease VII [Enterococcus faecalis ARO1/DG]
 gi|257160398|gb|EEU90358.1| exodeoxyribonuclease VII large subunit [Enterococcus faecalis T11]
 gi|257163052|gb|EEU93012.1| exodeoxyribonuclease VII large subunit [Enterococcus faecalis X98]
 gi|294452396|gb|EFG20835.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           PC1.1]
 gi|295113843|emb|CBL32480.1| Exodeoxyribonuclease VII large subunit [Enterococcus sp. 7L76]
 gi|300850587|gb|EFK78336.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           TUSoD Ef11]
 gi|306499673|gb|EFM69036.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           TX0109]
 gi|306511337|gb|EFM80340.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           TX0855]
 gi|306515701|gb|EFM84228.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           TX4248]
 gi|310629264|gb|EFQ12547.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           TX0102]
 gi|310632055|gb|EFQ15338.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           TX0635]
 gi|315029669|gb|EFT41601.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           TX4000]
 gi|315031734|gb|EFT43666.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           TX0017]
 gi|315034209|gb|EFT46141.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           TX0027]
 gi|315144363|gb|EFT88379.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           TX2141]
 gi|315147931|gb|EFT91947.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           TX4244]
 gi|315153056|gb|EFT97072.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           TX0031]
 gi|315156828|gb|EFU00845.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           TX0043]
 gi|315157615|gb|EFU01632.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           TX0312]
 gi|315162957|gb|EFU06974.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           TX0645]
 gi|315165155|gb|EFU09172.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           TX1302]
 gi|315168055|gb|EFU12072.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           TX1341]
 gi|315577404|gb|EFU89595.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           TX0630]
 gi|323480219|gb|ADX79658.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis 62]
 gi|327534566|gb|AEA93400.1| exodeoxyribonuclease VII large subunit [Enterococcus faecalis
           OG1RF]
 gi|329574368|gb|EGG55940.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           TX1467]
          Length = 448

 Score =  246 bits (628), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 138/389 (35%), Positives = 230/389 (59%), Gaps = 17/389 (4%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ +LK   +++  L  V + GEIS +R   ++ H YFSLKD+H++I AI++K   
Sbjct: 7   TVTALTKYLKRKFDADPYLGRVYLTGEISNFR-FRANAHQYFSLKDDHAKISAIMFKSAF 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            K++F P+EG++ +V+G+I+ +  S  YQI IE + P G G L  AL + ++KL +EGLF
Sbjct: 66  QKLKFQPKEGMKVMVVGRISLYENSGSYQIYIEHMEPDGVGALYQALAELREKLGKEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
            +  K  +P  PK IAV+TSP+GAVIRDI+  +  R+P+ ++++FP  VQG++   +I  
Sbjct: 126 -EGPKQQLPRYPKRIAVVTSPSGAVIRDIITTVKRRYPIAQLVLFPTLVQGEQAADDIVR 184

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
            I + +   +       D +I+ RGGGSIEDLW FN+E + RAI  ++ PIIS++GHETD
Sbjct: 185 NIQRADAQGDF------DTMIIGRGGGSIEDLWPFNEEKVARAIHAATTPIISSVGHETD 238

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            T+AD  AD+RA TPT AAE+AVPV       +    +RL    + L++ +      L  
Sbjct: 239 VTIADMVADVRAATPTAAAELAVPVLNEELLRISERRSRLEQSFLYLLQQRTERFQRLQN 298

Query: 313 A--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNR 370
           +      ++       +LDR+ + L   +  I  +K R    II +++       +++++
Sbjct: 299 SYVFKQPERLYEGQTIKLDRMTQRLFQAMTTIHHQKQRQAQGIIAQLQQQTPKGQLRESQ 358

Query: 371 QHILEKQQHIEQIVKQHLRYIFLEKKEKI 399
           Q +   Q++++  + Q    +FL K+++ 
Sbjct: 359 QQLAFLQRNLQTQMTQ----LFLNKQKQF 383


>gi|307275461|ref|ZP_07556603.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           TX2134]
 gi|306507849|gb|EFM76977.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           TX2134]
          Length = 448

 Score =  246 bits (628), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 138/389 (35%), Positives = 230/389 (59%), Gaps = 17/389 (4%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ +LK   +++  L  V + GEIS +R   ++ H YFSLKD+H++I AI++K   
Sbjct: 7   TVTALTKYLKRKFDADPYLGRVYLTGEISNFR-FRANAHQYFSLKDDHAKISAIMFKSAF 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            K++F P+EG++ +V+G+I+ +  S  YQI IE + P G G L  AL + ++KL +EGLF
Sbjct: 66  QKLKFQPKEGMKVMVVGRISLYENSGSYQIYIEHMEPDGVGALYQALAELREKLGKEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
            +  K  +P  PK IAV+TSP+GAVIRDI+  +  R+P+ ++++FP  VQG++   +I  
Sbjct: 126 -EGPKQQLPRYPKRIAVVTSPSGAVIRDIITTVKRRYPIAQLVLFPTLVQGEQAADDIVR 184

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
            I + +   +       D +I+ RGGGSIEDLW FN+E + RAI  ++ PIIS++GHETD
Sbjct: 185 NIQRADAQGDF------DTMIIGRGGGSIEDLWPFNEEKVARAIHAATTPIISSVGHETD 238

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            T+AD  AD+RA TPT AAE+AVPV       +    +RL    + L++ +      L  
Sbjct: 239 VTIADMVADVRAATPTAAAELAVPVLNEELLRISERRSRLEQSFLYLLQQRTERFQRLQN 298

Query: 313 A--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNR 370
           +      ++       +LDR+ + L   +  I  +K R    II +++       +++++
Sbjct: 299 SYVFKQPERLYEGQTIKLDRMTQRLFQAMTTIHHQKQRQAQGIIAQLQQQTPKGQLRESQ 358

Query: 371 QHILEKQQHIEQIVKQHLRYIFLEKKEKI 399
           Q +   Q++++  + Q    +FL K+++ 
Sbjct: 359 QQLAFLQRNLQTQMTQ----LFLNKQKQF 383


>gi|315171917|gb|EFU15934.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           TX1342]
          Length = 448

 Score =  246 bits (628), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 138/389 (35%), Positives = 230/389 (59%), Gaps = 17/389 (4%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ +LK   +++  L  V + GEIS +R   ++ H YFSLKD+H++I AI++K   
Sbjct: 7   TVTALTKYLKRKFDADPYLGRVYLTGEISNFR-FRANAHQYFSLKDDHAKISAIMFKSAF 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            K++F P+EG++ +V+G+I+ +  S  YQI IE + P G G L  AL + ++KL +EGLF
Sbjct: 66  QKLKFQPKEGMKVMVVGRISLYENSGSYQIYIEHMEPDGVGALYQALAELREKLGKEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
            +  K  +P  PK IAV+TSP+GAVIRDI+  +  R+P+ ++++FP  VQG++   +I  
Sbjct: 126 -EGPKQQLPRYPKRIAVVTSPSGAVIRDIITTVKRRYPIAQLVLFPTLVQGEQAADDIVR 184

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
            I + +   +       D +I+ RGGGSIEDLW FN+E + RAI  ++ PIIS++GHETD
Sbjct: 185 NIQRADAQGDF------DTMIIGRGGGSIEDLWPFNEEKVARAIHAATTPIISSVGHETD 238

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            T+AD  AD+RA TPT AAE+AVPV       +    +RL    + L++ +      L  
Sbjct: 239 VTIADMVADVRAATPTAAAELAVPVLNEELLRISERRSRLEQSFLYLLQQRTERFQRLQN 298

Query: 313 A--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNR 370
           +      ++       +LDR+ + L   +  I  +K R    II +++       +++++
Sbjct: 299 SYVFKQPERLYEGQTIKLDRMTQRLFQAMTTIHHQKQRQAQGIIAQLQQQTPKGQLRESQ 358

Query: 371 QHILEKQQHIEQIVKQHLRYIFLEKKEKI 399
           Q +   Q++++  + Q    +FL K+++ 
Sbjct: 359 QQLAFLQRNLQTQMTQ----LFLNKQKQF 383


>gi|312900450|ref|ZP_07759757.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           TX0470]
 gi|311292426|gb|EFQ70982.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           TX0470]
          Length = 448

 Score =  246 bits (628), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 138/389 (35%), Positives = 230/389 (59%), Gaps = 17/389 (4%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ +LK   +++  L  V + GEIS +R   ++ H YFSLKD+H++I AI++K   
Sbjct: 7   TVTALTKYLKRKFDADPYLGRVYLTGEISNFR-FRANAHQYFSLKDDHAKISAIMFKSAF 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            K++F P+EG++ +V+G+I+ +  S  YQI IE + P G G L  AL + ++KL +EGLF
Sbjct: 66  QKLKFQPKEGMKVMVVGRISLYENSGSYQIYIEHMEPDGVGALYQALAELREKLGKEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
            +  K  +P  PK IAV+TSP+GAVIRDI+  +  R+P+ ++++FP  VQG++   +I  
Sbjct: 126 -EGPKQQLPRYPKRIAVVTSPSGAVIRDIITTVKRRYPIAQLVLFPTLVQGEQAADDIVR 184

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
            I + +   +       D +I+ RGGGSIEDLW FN+E + RAI  ++ PIIS++GHETD
Sbjct: 185 NIQRADAQGDF------DTMIIGRGGGSIEDLWPFNEEKVARAIHATTTPIISSVGHETD 238

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            T+AD  AD+RA TPT AAE+AVPV       +    +RL    + L++ +      L  
Sbjct: 239 VTIADMVADVRAATPTAAAELAVPVLNEELLRISERRSRLEQSFLYLLQQRTERFQRLQN 298

Query: 313 A--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNR 370
           +      ++       +LDR+ + L   +  I  +K R    II +++       +++++
Sbjct: 299 SYVFKQPERLYEGQTIKLDRMTQRLFQAMTTIHHQKQRQAQGIIAQLQQQTPKGQLRESQ 358

Query: 371 QHILEKQQHIEQIVKQHLRYIFLEKKEKI 399
           Q +   Q++++  + Q    +FL K+++ 
Sbjct: 359 QQLAFLQRNLQTQMTQ----LFLNKQKQF 383


>gi|315149501|gb|EFT93517.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           TX0012]
          Length = 448

 Score =  246 bits (627), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 138/389 (35%), Positives = 230/389 (59%), Gaps = 17/389 (4%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ +LK   +++  L  V + GEIS +R   ++ H YFSLKD+H++I AI++K   
Sbjct: 7   TVTALTKYLKRKFDADPYLGRVYLTGEISNFR-FRANAHQYFSLKDDHAKISAIMFKSAF 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            K++F P+EG++ +V+G+I+ +  S  YQI IE + P G G L  AL + ++KL +EGLF
Sbjct: 66  QKLKFQPKEGMKVMVVGRISLYENSGSYQIYIEHMEPDGVGALYQALAELREKLGKEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
            +  K  +P  PK IAV+TSP+GAVIRDI+  +  R+P+ ++++FP  VQG++   +I  
Sbjct: 126 -EGPKQQLPRYPKRIAVVTSPSGAVIRDIITTVKRRYPIAQLVLFPTLVQGEQAADDIVR 184

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
            I + +   +       D +I+ RGGGSIEDLW FN+E + RAI  ++ PIIS++GHETD
Sbjct: 185 NIQRADAQGDF------DTMIIGRGGGSIEDLWPFNEEKVARAIHAATTPIISSVGHETD 238

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            T+AD  AD+RA TPT AAE+AVPV       +    +RL    + L++ +      L  
Sbjct: 239 VTIADMVADVRAATPTAAAELAVPVLNEELLRISERRSRLEQSFLYLLQQRTERFQRLQN 298

Query: 313 A--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNR 370
           +      ++       +LDR+ + L   +  I  +K R    II +++       +++++
Sbjct: 299 SYVFKQPERLYEGQTIKLDRMTQRLFQAMTTIHHQKQRQAQGIIAQLQQQTPKGQLRESQ 358

Query: 371 QHILEKQQHIEQIVKQHLRYIFLEKKEKI 399
           Q +   Q++++  + Q    +FL K+++ 
Sbjct: 359 QQLAFFQRNLQTQMTQ----LFLNKQKQF 383


>gi|313623885|gb|EFR94000.1| exodeoxyribonuclease VII, large subunit [Listeria innocua FSL
           J1-023]
          Length = 451

 Score =  246 bits (627), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 133/365 (36%), Positives = 212/365 (58%), Gaps = 10/365 (2%)

Query: 28  VESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNKIEFLPEEGIEFL 87
           V+  +  V VRGEIS  +   +SGH YF++KD  + + +++++  + KI F+PE+G+  L
Sbjct: 23  VDPYMKQVFVRGEISNLKQ-PASGHLYFTVKDEFAMLRSVMFQKAVQKIGFVPEDGMNVL 81

Query: 88  VIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSDQHKNPIPFIPKI 147
           + G+I  F  + +YQ   E + P G G L   LE+ K +L +EGLF++ HK  +P  P  
Sbjct: 82  ITGRIGVFTKAGRYQFYAEHMEPDGVGALYIQLEQLKSQLEKEGLFAEAHKKVLPSFPSK 141

Query: 148 IAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANAILQLNTLKEGRTC 206
           +AV+TS TGA +RDIL  I  R P + VI++P  VQGD+  + I   I ++N   +    
Sbjct: 142 VAVVTSKTGAAVRDILTTIHRRMPSVEVIVYPTVVQGDKAAQRIVKNIGRINQRND---- 197

Query: 207 PRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWTLADYAADLRAPT 266
              D++I+ RGGGS+E+LW FN+E +VRA+ +S +P+ISA+GHETD+ L+D++AD+RA T
Sbjct: 198 --IDVMIIGRGGGSLEELWAFNEEPVVRAVYDSDVPVISAVGHETDFALSDFSADVRAAT 255

Query: 267 PTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK--ALPNSDQTLSCS 324
           PT AAE+AVP    L+  L   + RL  +  +L++ K  TL  L +   L      L   
Sbjct: 256 PTAAAELAVPDYRDLEERLAERKYRLLAVTRQLLERKERTLEQLKQHLILNGPKHQLEQQ 315

Query: 325 RYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHILEKQQHIEQIV 384
             R D     L++     +  K   FN + +R+        I   ++ I  ++Q +++ +
Sbjct: 316 MERTDYFAERLKNAFSKQVLLKQTTFNRLNDRLHYYHPKKEIALQKEQITLRKQALDKAM 375

Query: 385 KQHLR 389
           KQ L+
Sbjct: 376 KQQLK 380


>gi|328952414|ref|YP_004369748.1| Exodeoxyribonuclease 7 large subunit [Desulfobacca acetoxidans DSM
           11109]
 gi|328452738|gb|AEB08567.1| Exodeoxyribonuclease 7 large subunit [Desulfobacca acetoxidans DSM
           11109]
          Length = 460

 Score =  246 bits (627), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 130/323 (40%), Positives = 196/323 (60%), Gaps = 8/323 (2%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
           YSV++L+  +K  +E     V V+GE+S  R  HS GH YF+LKD  S++  +I++    
Sbjct: 16  YSVADLTRMIKDRLEQEFPLVWVQGEVSNLRSPHS-GHCYFTLKDEASQLRVVIFRSYYQ 74

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
            + F P + ++ +  G++T +    +YQ++ +   P G G L  A E+ K +L  EGLF 
Sbjct: 75  AMRFKPVDSLKIVCRGQLTVYEPRGEYQLLADYTEPLGMGALAQAFEQLKARLDAEGLFD 134

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANA 193
            ++K P+P++P  +AV+TSP+GA IRD LQ +  RFP ++V+++PV+VQG    +EI  A
Sbjct: 135 PRYKKPLPYLPHRLAVVTSPSGAAIRDFLQILHRRFPNIQVLVYPVRVQGAGAAEEIVGA 194

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           +  LNT+      P  D+IIL RGGGS+EDLW FN+E + RAI  S+IP+ISA+GHE D+
Sbjct: 195 LRTLNTM------PDLDVIILTRGGGSLEDLWAFNEEKVARAIFQSTIPVISAVGHEIDF 248

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           T+AD+ AD RAPTP+ AAE+ V   E LQ  L  L   L    + L++     L      
Sbjct: 249 TIADFVADRRAPTPSAAAELVVRPLEELQLELQRLSLSLQRRFLNLLQQGRERLRLSGHR 308

Query: 314 LPNSDQTLSCSRYRLDRLPRELE 336
           L +  + ++  R RLD    +L+
Sbjct: 309 LKDPRRRVADLRLRLDERAEQLQ 331


>gi|91773480|ref|YP_566172.1| exodeoxyribonuclease VII large subunit [Methanococcoides burtonii
           DSM 6242]
 gi|91712495|gb|ABE52422.1| Exodeoxyribonuclease VII, large subunit [Methanococcoides burtonii
           DSM 6242]
          Length = 407

 Score =  246 bits (627), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 139/339 (41%), Positives = 201/339 (59%), Gaps = 14/339 (4%)

Query: 13  PEYSVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           P Y+V+EL+  +K+ + +N  L+ + V+GEIS     HSSGH YF++KD  S+I  + +K
Sbjct: 2   PAYTVTELNNLIKNTLTNNPKLNQIWVQGEISNLTK-HSSGHYYFTVKDGKSQISCVSFK 60

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
                + F  E  ++ LV G +  +    +YQ+ ++ + P G G L  A E+ K KL +E
Sbjct: 61  SVNRNLRFELESSMKVLVFGSVDVYVVRGQYQLYVQDIRPDGVGELYKAYEQLKNKLEQE 120

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEI 190
           GLFSD HK PIP  P  I V+TSPTGA I DIL  I  R+P+ +++ P  VQG+   + I
Sbjct: 121 GLFSDVHKIPIPGYPLRIGVVTSPTGAAIHDILNVIRRRYPVNILLSPTIVQGERSAESI 180

Query: 191 ANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHE 250
             +I  LN           D+II+ RGGGS+EDLW FN+E++ RAI NS  PI+SA+GHE
Sbjct: 181 VRSIELLNQTD-------VDVIIVGRGGGSLEDLWSFNEEVVARAIFNSKKPIVSAVGHE 233

Query: 251 TDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSL 310
           TD+T+AD+ AD+RAPTP+ AAE+ VP ++ ++  L  L +RL N +  +I      L  +
Sbjct: 234 TDFTIADFTADMRAPTPSAAAELVVPDQKEVKRHLATLSSRLENEVEHVISQGKGRLEQI 293

Query: 311 LKALPNS---DQTLSCSRYRLDRLPRELEHNLEIIIFRK 346
            K L      D  L  S+Y LD L  +L  ++   I  K
Sbjct: 294 RKKLEPQHIMDMLLQDSQY-LDELTMKLTSSMGKTIVDK 331


>gi|295695405|ref|YP_003588643.1| exodeoxyribonuclease VII, large subunit [Bacillus tusciae DSM 2912]
 gi|295411007|gb|ADG05499.1| exodeoxyribonuclease VII, large subunit [Bacillus tusciae DSM 2912]
          Length = 479

 Score =  246 bits (627), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 137/371 (36%), Positives = 209/371 (56%), Gaps = 12/371 (3%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +VSEL+ +++ ++E +  L  V V GEIS +   HSSGH YFSLKD  SRI A+++    
Sbjct: 10  TVSELTAYVRELLERDELLQEVWVMGEISNFTH-HSSGHMYFSLKDAGSRIRAVMFASRN 68

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            K+ F PEEG++ +  G++  F     YQ+ +E + P G G+L  A  + + +L +EGLF
Sbjct: 69  RKLIFRPEEGMKVVARGRVAVFDRDGTYQLYVEEMQPEGVGSLYLAFLQTRDRLQKEGLF 128

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
             + K P+P  P+++ VITS  GA IRDI   +  R+PL RV+IFP  VQG   P  +A 
Sbjct: 129 DRERKRPLPAFPRVVGVITSTEGAAIRDIATTLRRRYPLARVVIFPALVQGPGAPASLAE 188

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           A+       E       D+II+ RGGGS E+LW FNDE + RAIA + +P++SA+GHETD
Sbjct: 189 ALATACAYGE------LDVIIIGRGGGSPEELWAFNDESLARAIAAAPVPVVSAVGHETD 242

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+ADY AD+RAPTPT AAE+  P    L+  +      L + ++R ++     L  LL 
Sbjct: 243 FTIADYVADVRAPTPTAAAELVAPHVLELRRRVEEARRALVDALVRRVQGDRQRLEHLLG 302

Query: 313 --ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNR 370
              L   +Q +   R  +D L   L       +FR+      + + +        IQ+++
Sbjct: 303 RPGLRRPEQWIQWRRQTVDGLHTRLGQAAWKSVFRRKEALIRLTDILGRHSPKEQIQRSQ 362

Query: 371 QHILEKQQHIE 381
             +  ++Q ++
Sbjct: 363 NRLETQKQKLQ 373


>gi|52548905|gb|AAU82754.1| exonuclease VII large subunit [uncultured archaeon GZfos19C8]
          Length = 447

 Score =  245 bits (626), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 129/301 (42%), Positives = 191/301 (63%), Gaps = 6/301 (1%)

Query: 15  YSVSELSYHLKHIVE--SNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           YSV E++ +++  ++  S LS V V+GE+S      +SGH YF+LKD  S +  ++++  
Sbjct: 44  YSVQEVTSYIRRRLDEDSMLSDVYVKGELSNLSQ-PTSGHLYFTLKDKFSELRCVMFRDK 102

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
              ++F PE+G+  ++ G I+ +     YQ+ ++ L   G G L  A E+ KKKL  EGL
Sbjct: 103 NRGLKFRPEDGMSVILRGHISVYERRGSYQLYVDELQAEGIGALYLAFEQLKKKLKGEGL 162

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIA 191
           F  ++K PIP  P+ I +ITSPTGA IRD+L     RFP + +++ PV VQG+E P +I 
Sbjct: 163 FDPKYKKPIPSFPRKIGIITSPTGAAIRDMLNITKRRFPHVHILLAPVAVQGEEAPGQIV 222

Query: 192 NAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHET 251
           NAI  +N + E R   + D+++L RGGGSIE+LW FN+E + R I  S IP+ISA+GHET
Sbjct: 223 NAIRLMNRVNEERM--KIDVLVLGRGGGSIEELWAFNEEAVAREIFASKIPVISAVGHET 280

Query: 252 DWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLL 311
           D+T+AD+ AD RA TP+ AAE+AVP K  ++ +L +L  R+   I   I+Y    L S+ 
Sbjct: 281 DFTIADFVADRRAATPSEAAELAVPDKREIERNLSSLALRMQQNIYNTIEYHRKRLESIE 340

Query: 312 K 312
           K
Sbjct: 341 K 341


>gi|225018825|ref|ZP_03708017.1| hypothetical protein CLOSTMETH_02775 [Clostridium methylpentosum
           DSM 5476]
 gi|224948385|gb|EEG29594.1| hypothetical protein CLOSTMETH_02775 [Clostridium methylpentosum
           DSM 5476]
          Length = 398

 Score =  245 bits (626), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 143/358 (39%), Positives = 204/358 (56%), Gaps = 31/358 (8%)

Query: 13  PEYSVSELSYHLKHI--VESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           P YSVSE++  +K I   E     + +RGEIS +     SGH YF+LKD  S I  ++++
Sbjct: 2   PSYSVSEVNRFIKQIFAAEDIFYGLHIRGEISNFVNHVRSGHFYFTLKDQTSSIKCVMFR 61

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
              +++ FLPE G+  ++ G +  F     YQ+ +  + P G+G L  A E+ KKKL  E
Sbjct: 62  SNASRLPFLPENGMNVILRGDVQVFERDGVYQVYVADIQPDGTGALYMAYEQLKKKLDAE 121

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVI-IFPVKVQGDECPKE 189
           GLF  Q K P+P  P  I VITS TGA ++DIL  +  R+P+  + +FP  VQG++ P+ 
Sbjct: 122 GLFDPQRKRPLPPYPGAIGVITSKTGAALQDILNILRRRYPVCTVKLFPALVQGEQAPES 181

Query: 190 IANAILQLNTLKEGRTCPRP-DIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           I  A  + N     RT   P D++I+ RGGGS+EDLW FNDE + RAIA   +P+ISA+G
Sbjct: 182 IIQAFARAN-----RT---PLDLVIVGRGGGSLEDLWAFNDEGVARAIAGCRVPVISAVG 233

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HE D+T+AD+AADLRAPTP+ AAE+AVP        ++NL   ++N    +  Y +++L 
Sbjct: 234 HEVDYTIADFAADLRAPTPSAAAELAVP-------DIVNLRTMIDNYAEMVYNYTVSSLQ 286

Query: 309 SLLKALPNSDQTLSCSRYRL-DRLPRE-LE---HNLEIIIFRKYRHFNHIINRIKSDF 361
                  N +Q L     RL  R P   LE   H+LE +  R +  F  +  R    F
Sbjct: 287 -------NGEQQLDSLSTRLMARAPGAVLEHSCHSLESLDSRLHLSFEGMYGRCGQRF 337


>gi|331005661|ref|ZP_08329028.1| Exodeoxyribonuclease VII large subunit [gamma proteobacterium
           IMCC1989]
 gi|330420519|gb|EGG94818.1| Exodeoxyribonuclease VII large subunit [gamma proteobacterium
           IMCC1989]
          Length = 452

 Score =  245 bits (626), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 131/315 (41%), Positives = 191/315 (60%), Gaps = 8/315 (2%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           MN    +NS      SVS+L+   K ++E++ + V V GEIS      SSGH YFSLKDN
Sbjct: 1   MNTLLTENSPKKTLLSVSQLNRRAKQLLETHFAFVWVSGEISNL-AKPSSGHWYFSLKDN 59

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            +++   ++K    ++ + PE G +  +  +++ + G  +YQ+I+E +  +G G L    
Sbjct: 60  AAQVRCAMFKNANQRLRWTPESGQQVSIRARVSLYEGRGEYQLIVEHMEMAGDGQLQQQY 119

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVI-IFPV 179
           E+ K  L +EGLF + +K  +P  P+ I +ITSPTGA + DIL  +  R+P+  I IFPV
Sbjct: 120 ERLKATLSDEGLFDESYKKNLPIYPRHIGIITSPTGAAVHDILSVLRRRYPIAPISIFPV 179

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
            VQGD    EI NAI + N L+      R D+IIL+RGGGSIEDLW FNDE + R I  S
Sbjct: 180 SVQGDNAAPEIINAIKKANKLE------RCDVIILSRGGGSIEDLWAFNDETLARTIFAS 233

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
           +IP+ISA+GHE D+T+AD+ AD+RAPTP+ +AEM  P +  L       ++RL     + 
Sbjct: 234 NIPVISAVGHEVDFTIADFVADVRAPTPSVSAEMTTPDQHELAQLFDRYQSRLLRSFQQS 293

Query: 300 IKYKINTLNSLLKAL 314
           I+ + + +N L K L
Sbjct: 294 IQSRTDRINFLNKRL 308


>gi|256960161|ref|ZP_05564332.1| exonuclease VII [Enterococcus faecalis Merz96]
 gi|293382529|ref|ZP_06628463.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           R712]
 gi|293387871|ref|ZP_06632410.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           S613]
 gi|312906868|ref|ZP_07765865.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           DAPTO 512]
 gi|312978877|ref|ZP_07790603.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           DAPTO 516]
 gi|256950657|gb|EEU67289.1| exonuclease VII [Enterococcus faecalis Merz96]
 gi|291080077|gb|EFE17441.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           R712]
 gi|291082718|gb|EFE19681.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           S613]
 gi|310627122|gb|EFQ10405.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           DAPTO 512]
 gi|311288314|gb|EFQ66870.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           DAPTO 516]
          Length = 448

 Score =  245 bits (626), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 138/389 (35%), Positives = 230/389 (59%), Gaps = 17/389 (4%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ +LK   +++  L  V + GEIS +R   ++ H YFSLKD+H++I AI++K   
Sbjct: 7   TVTALTKYLKRKFDADPYLGRVYLTGEISNFR-FRANAHQYFSLKDDHAKISAIMFKSAF 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            K++F P+EG++ +V+G+I+ +  S  YQI IE + P G G L  AL + ++KL +EGLF
Sbjct: 66  QKLKFQPKEGMKVMVVGRISLYENSGSYQIYIEHMEPDGVGALYQALAELREKLGKEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
            +  K  +P  PK IAV+TSP+GAVIRDI+  +  R+P+ ++++FP  VQG++   +I  
Sbjct: 126 -EGPKQQLPRYPKRIAVVTSPSGAVIRDIITTVKRRYPIAQLVLFPTLVQGEQAADDIVR 184

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
            I + +   +       D +I+ RGGGSIEDLW FN+E + RAI  ++ PIIS++GHETD
Sbjct: 185 NIQRADAQGDF------DTMIIGRGGGSIEDLWPFNEEKVSRAIHAATTPIISSVGHETD 238

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            T+AD  AD+RA TPT AAE+AVPV       +    +RL    + L++ +      L  
Sbjct: 239 VTIADMVADVRAATPTAAAELAVPVLNEELLRISERRSRLEQSFLYLLQQRTERFQRLQN 298

Query: 313 A--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNR 370
           +      ++       +LDR+ + L   +  I  +K R    II +++       +++++
Sbjct: 299 SYVFKQPERLYEGQTIKLDRMTQRLFQAMTTIHHQKQRQAQGIIAQLQQQTPKGQLRESQ 358

Query: 371 QHILEKQQHIEQIVKQHLRYIFLEKKEKI 399
           Q +   Q++++  + Q    +FL K+++ 
Sbjct: 359 QQLAFLQRNLQTQMTQ----LFLNKQKQF 383


>gi|257869056|ref|ZP_05648709.1| exonuclease VII [Enterococcus gallinarum EG2]
 gi|257803220|gb|EEV32042.1| exonuclease VII [Enterococcus gallinarum EG2]
          Length = 450

 Score =  245 bits (626), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 141/391 (36%), Positives = 225/391 (57%), Gaps = 25/391 (6%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ +LK   +++  L  V + GEIS +R      H YFSLKD+ ++I  +++KG  
Sbjct: 7   TVTALTKYLKRKFDADPYLERVYLTGEISNFR--RRPNHQYFSLKDDGAKISTVMFKGAF 64

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
           +K+ F PEEG++ L +G+I+ +  S  YQ+ IE + P G G L  A E+ KKKL EEGLF
Sbjct: 65  DKLRFQPEEGMKVLAVGRISLYEASGNYQMYIEHMEPDGVGALYQAYEQLKKKLAEEGLF 124

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
           S   K  +P  PK IAV+TSP+GAVIRDI+     R+P+  +++FP  VQGD+   ++  
Sbjct: 125 S-APKKILPRFPKRIAVLTSPSGAVIRDIITTAQRRYPIAEIVLFPTVVQGDKAADDVVK 183

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
            I ++    +G      D +I+ RGGGSIEDLW FN+E + RAI  +  P+IS++GHETD
Sbjct: 184 NIQRVEA--DGTF----DTMIIGRGGGSIEDLWPFNEERVARAIFAAETPVISSVGHETD 237

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLE---ARLNNIIIRLIKYKINTLNS 309
            T+AD  AD+RA TPT AAE+AVPV   L   ++ +E    RL    +  I+ K      
Sbjct: 238 TTIADLVADVRAATPTAAAELAVPV---LSEEILRIEEKQTRLEQAFMYQIQRKQERFQR 294

Query: 310 LLKA--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQ 367
            + +      ++       +LD+L + +  +L+  ++ K +  + +I+R++       + 
Sbjct: 295 AVGSYIFRQPERLYEAQAIKLDQLQQRMNQSLQTQLYDKEKVASQLIHRLEQQLPKARLS 354

Query: 368 KNRQHILEKQQHIEQIVKQHLRYIFLEKKEK 398
              Q +    Q +E+ ++     + +EKKE+
Sbjct: 355 AAGQEVTYLTQRLEKAIQ-----LSVEKKEQ 380


>gi|16800466|ref|NP_470734.1| exodeoxyribonuclease VII large subunit [Listeria innocua Clip11262]
 gi|22095671|sp|Q92BZ3|EX7L_LISIN RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|16413871|emb|CAC96629.1| lin1398 [Listeria innocua Clip11262]
          Length = 450

 Score =  245 bits (625), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 132/365 (36%), Positives = 212/365 (58%), Gaps = 10/365 (2%)

Query: 28  VESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNKIEFLPEEGIEFL 87
           V+  +  V VRGEIS  +   +SGH YF++KD  + + +++++  + KI F+PE+G+  L
Sbjct: 22  VDPYMKQVFVRGEISNLKQ-PASGHLYFTVKDEFAMLRSVMFQKAVQKIGFVPEDGMNVL 80

Query: 88  VIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSDQHKNPIPFIPKI 147
           + G+I  F  + +YQ   E + P G G L   LE+ K +L +EGLF++ HK  +P  P  
Sbjct: 81  ITGRIGVFTKAGRYQFYAEHMEPDGVGALYIQLEQLKSQLEKEGLFAEAHKKVLPSFPSK 140

Query: 148 IAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANAILQLNTLKEGRTC 206
           +AV+TS TGA +RDIL  I  R P + VI++P  VQGD+  + I   I ++N   +    
Sbjct: 141 VAVVTSKTGAAVRDILTTIHRRMPSVEVIVYPTVVQGDKAAQRIVENIGRINQRND---- 196

Query: 207 PRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWTLADYAADLRAPT 266
              D++I+ RGGGS+E+LW FN+E +VRA+ +S +P+ISA+GHETD+ L+D++AD+RA T
Sbjct: 197 --IDVMIIGRGGGSLEELWAFNEEPVVRAVYDSDVPVISAVGHETDFALSDFSADVRAAT 254

Query: 267 PTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK--ALPNSDQTLSCS 324
           PT AAE+AVP    L+  L   + RL  +  +L++ K   L  L +   L      L   
Sbjct: 255 PTAAAELAVPDYRDLEERLAERKYRLLAVTRQLLERKERALEQLKQHLILNGPKHQLEQQ 314

Query: 325 RYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHILEKQQHIEQIV 384
             R D     L++     +  K   FN + +R+        I   ++ I+ ++Q +++ +
Sbjct: 315 MERTDYFAERLKNAFSKQVLLKQTTFNRLNDRLHYYHPKKEIALQKEQIILRKQALDKAM 374

Query: 385 KQHLR 389
           KQ L+
Sbjct: 375 KQQLK 379


>gi|307290058|ref|ZP_07569982.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           TX0411]
 gi|306498900|gb|EFM68394.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           TX0411]
          Length = 448

 Score =  245 bits (625), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 137/389 (35%), Positives = 229/389 (58%), Gaps = 17/389 (4%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ +LK   +++  L  V + GEIS +R   ++ H YFSLKD+H++I AI++K   
Sbjct: 7   TVTALTKYLKRKFDADPYLGRVYLTGEISNFR-FRANAHQYFSLKDDHAKISAIMFKSAF 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            K++F P+EG++ +V+G+I+ +  S  YQI IE + P G G L  AL + ++KL +EGLF
Sbjct: 66  QKLKFQPKEGMKVMVVGRISLYENSGSYQIYIEHMEPDGVGALYQALAELREKLGKEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
               +  +P  PK IAV+TSP+GAVIRDI+  +  R+P+ ++++FP  VQG++   +I  
Sbjct: 126 EGPEQQ-LPRYPKRIAVVTSPSGAVIRDIITTVKRRYPIAQLVLFPTLVQGEQAADDIVR 184

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
            I + +   +       D +I+ RGGGSIEDLW FN+E + RAI  ++ PIIS++GHETD
Sbjct: 185 NIQRADAQGDF------DTMIIGRGGGSIEDLWPFNEEKVARAIHAATTPIISSVGHETD 238

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            T+AD  AD+RA TPT AAE+AVPV       +    +RL    + L++ +      L  
Sbjct: 239 VTIADMVADVRAATPTAAAELAVPVLNEELLRISERRSRLEQSFLYLLQQRTERFQRLQN 298

Query: 313 A--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNR 370
           +      ++       +LDR+ + L   +  I  +K R    II +++       +++++
Sbjct: 299 SYVFKQPERLYEGQTIKLDRMTQRLFQAMTTIHHQKQRQAQGIIAQLQQQTPKGQLRESQ 358

Query: 371 QHILEKQQHIEQIVKQHLRYIFLEKKEKI 399
           Q +   Q++++  + Q    +FL K+++ 
Sbjct: 359 QQLAFLQRNLQTQMTQ----LFLNKQKQF 383


>gi|148263947|ref|YP_001230653.1| exodeoxyribonuclease VII large subunit [Geobacter uraniireducens
           Rf4]
 gi|189037846|sp|A5GF75|EX7L_GEOUR RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|146397447|gb|ABQ26080.1| Exodeoxyribonuclease VII large subunit [Geobacter uraniireducens
           Rf4]
          Length = 446

 Score =  245 bits (625), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 141/359 (39%), Positives = 219/359 (61%), Gaps = 13/359 (3%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M  F++K  L     +VS+L+  ++ ++E N   V V GEIS     HS GH YF+LKD 
Sbjct: 1   MELFAEKRIL-----TVSQLNGLIRGVLEENFEQVWVEGEISNLAMPHS-GHLYFTLKDA 54

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            +++  ++++ +   ++F P++G+  +V G+++ F    +YQ+I+E L P G G L  A 
Sbjct: 55  GAQVRCVMFRASSRALKFKPKDGMGLIVRGRVSVFEPRGEYQLIVEYLEPQGIGALQLAF 114

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPV 179
            + K++L +EGLF++ HK PIP +P+ I V+TS TGA I DIL  ++ RF  ++V+I PV
Sbjct: 115 IQLKERLAKEGLFAETHKKPIPKLPQRIGVVTSATGAAIHDILNVLNRRFANVQVLIRPV 174

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
           KVQG+    EIA AI   N  +E       D++I+ RGGGS+EDLW FN+E++ RAI  S
Sbjct: 175 KVQGEGAAGEIAAAIRDFNRYRE------IDVMIVGRGGGSLEDLWAFNEEVVARAIYES 228

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
            IP+ISA+GHE D+T+AD+ ADLRAPTP+ AAE+ V  K  L S L  L  RL   +   
Sbjct: 229 KIPVISAVGHEIDFTIADFVADLRAPTPSAAAELVVKSKAELASDLDALSHRLVLAMRHC 288

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIK 358
           ++     +N L +AL +    L     R+D L   ++H +++++ R+      + NR++
Sbjct: 289 LEDCWGDVNGLTRALKDPSLLLGHLAQRVDDLDERIKHAVQVMLLRRKEKAAFLQNRLR 347


>gi|187250465|ref|YP_001874947.1| exonuclease VII, large subunit [Elusimicrobium minutum Pei191]
 gi|186970625|gb|ACC97610.1| Exonuclease VII, large subunit [Elusimicrobium minutum Pei191]
          Length = 396

 Score =  245 bits (625), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 131/303 (43%), Positives = 193/303 (63%), Gaps = 19/303 (6%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
           ++V+E+S  +K ++E  L+ V V GEISG +   +SGH YF +KD ++ I A+++KG   
Sbjct: 9   FTVTEISSSIKEMLEGVLNDVRVEGEISGLKK-AASGHIYFDIKDENALISAVLFKGYAL 67

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
           +   L ++G++ LV G ++ +    +YQII++SL+P+  G L    E+ K+KL  EG+F 
Sbjct: 68  RTADL-KDGLKVLVRGDLSCYIKQGRYQIIVKSLVPTSVGDLYLEFERLKQKLAAEGIFD 126

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANA 193
           ++ K P+P     I V+TSPTGA ++DIL  +  R P L VII P  VQG E P +I  A
Sbjct: 127 EERKRPLPEFASRIGVVTSPTGAALQDILSVLKRRSPNLEVIISPSLVQGQEAPAQIVKA 186

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I +LN +      P PD+I++ RGGGS+EDLW FNDE + RAI  S IP++S +GHETD+
Sbjct: 187 IERLNKIN-----PAPDVILVGRGGGSMEDLWCFNDEAVARAIYKSKIPVVSCVGHETDF 241

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           T+AD+A+DLRAPTP+ AAE+        Q+S     A + N + +L+K  INT N L+  
Sbjct: 242 TIADFASDLRAPTPSAAAEIVA------QNS-----AGVANYVTQLVKRMINTQNLLISL 290

Query: 314 LPN 316
             N
Sbjct: 291 AQN 293


>gi|110596939|ref|ZP_01385229.1| exodeoxyribonuclease VII, large subunit [Chlorobium ferrooxidans
           DSM 13031]
 gi|110341626|gb|EAT60086.1| exodeoxyribonuclease VII, large subunit [Chlorobium ferrooxidans
           DSM 13031]
          Length = 401

 Score =  244 bits (624), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 140/342 (40%), Positives = 204/342 (59%), Gaps = 16/342 (4%)

Query: 16  SVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNK 75
           SVSEL+  +K  +E     V V+GEIS Y+  HSSGH+Y +LKD+ ++I A+IWK T  +
Sbjct: 7   SVSELTQQIKSELEMTFPAVKVKGEISNYKR-HSSGHSYLTLKDDGAQIPAVIWKNTGIR 65

Query: 76  IEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSD 135
           +     +GI  +  G++  +P S +YQ+I  ++  +G G L  A  +  +KL + G F+ 
Sbjct: 66  LAVELRDGINVVAEGRLEVYPPSGRYQLICTAVTAAGEGALQQAFAELLQKLAKAGYFAA 125

Query: 136 QHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANAI 194
           + K PIP IP+ IA+ITS TGAVI D+ + +  RFP  RV+++PVKVQG +  + +A  I
Sbjct: 126 ERKKPIPAIPETIALITSSTGAVIEDMSKVLERRFPAARVLLYPVKVQGTDAAESVAAGI 185

Query: 195 LQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWT 254
              N  K      RPD+II+ARGGGS+EDL  FN E++  A+ +SSIP+ISAIGHETD T
Sbjct: 186 AWFNETK--NPAHRPDVIIIARGGGSLEDLQAFNGEVVANALYHSSIPVISAIGHETDLT 243

Query: 255 LADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKAL 314
           +AD  ADLRA TP+ AAE+AVP    L   +  L+++ +    R ++ K+      + ++
Sbjct: 244 IADMTADLRAGTPSIAAELAVPDTGELLRRIETLQSKQD----RAVQNKVEGAERQIYSI 299

Query: 315 PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINR 356
                   CS Y  +R P ++E   E I     R    I NR
Sbjct: 300 --------CSSYAFNRPPLQMEQFEERITTLLDRTTTTIRNR 333


>gi|148544407|ref|YP_001271777.1| exodeoxyribonuclease VII large subunit [Lactobacillus reuteri DSM
           20016]
 gi|184153770|ref|YP_001842111.1| exodeoxyribonuclease VII large subunit [Lactobacillus reuteri JCM
           1112]
 gi|227363168|ref|ZP_03847302.1| exodeoxyribonuclease VII large subunit [Lactobacillus reuteri
           MM2-3]
 gi|325682727|ref|ZP_08162243.1| exodeoxyribonuclease VII large subunit [Lactobacillus reuteri
           MM4-1A]
 gi|226697592|sp|A5VKR6|EX7L_LACRD RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|226697593|sp|B2G849|EX7L_LACRJ RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|148531441|gb|ABQ83440.1| Exodeoxyribonuclease VII large subunit [Lactobacillus reuteri DSM
           20016]
 gi|183225114|dbj|BAG25631.1| exodeoxyribonuclease VII large subunit [Lactobacillus reuteri JCM
           1112]
 gi|227071774|gb|EEI10063.1| exodeoxyribonuclease VII large subunit [Lactobacillus reuteri
           MM2-3]
 gi|324977077|gb|EGC14028.1| exodeoxyribonuclease VII large subunit [Lactobacillus reuteri
           MM4-1A]
          Length = 445

 Score =  244 bits (624), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 153/404 (37%), Positives = 235/404 (58%), Gaps = 28/404 (6%)

Query: 10  LDHPEY-SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDA 66
           +D  +Y +VSEL+ +LK   + +  L  V + GE+S +R      H YFSLKD+++ IDA
Sbjct: 1   MDRSQYLTVSELTKYLKMKFDRDPYLHTVYLTGELSNFR--LRQKHQYFSLKDDNAVIDA 58

Query: 67  IIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKK 126
           ++++    KI+F PE+G++  V+G ++ +  S +YQI I+ + P G G+L  A E+ KKK
Sbjct: 59  VMFEHQFRKIKFTPEQGMKVCVVGHVSLYEKSGRYQIYIDRMEPDGLGSLYLAFEQLKKK 118

Query: 127 LLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDE 185
           L  EGLF +  K  IP  PK IAV+TS  GAVIRDI   +  R+P+ +V+++P  VQGD+
Sbjct: 119 LSAEGLF-NLPKKQIPMFPKRIAVVTSIDGAVIRDINTTVRRRYPIAQVVLYPTVVQGDK 177

Query: 186 CPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIIS 245
              +IA  I + N   +       D +I+ RGGGS+EDLW FN+E++ RAIANS IP+IS
Sbjct: 178 AAADIARQINRANDRGDF------DTLIIGRGGGSMEDLWPFNEEVVARAIANSKIPVIS 231

Query: 246 AIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINL---EARLNNIIIRLIKY 302
           ++GHETD T+AD  AD RA TPT AAE+A PVK  L  +L+ L   + RL N +   I +
Sbjct: 232 SVGHETDTTIADLVADQRAATPTAAAELATPVK--LNDALMTLKDDQNRLLNTMRTKINF 289

Query: 303 KINTLNSLLKALPNSDQTLSCSRY--RLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
               LN  L++      T     Y  ++D+L ++L    +  +     +   +  R+ + 
Sbjct: 290 DRQQLNKQLQSYIFQQPTRLYENYAQKVDQLTQQLGQAAQNKMQELQMNVERLSGRLTAA 349

Query: 361 FLIHNIQKNRQHI--LEKQQHIEQIVKQHLRYIFLEKKEKIAIL 402
             +H +Q+  Q +  L+KQ     +  Q+      EKK+++  L
Sbjct: 350 SPLHRVQQQEQLVDQLKKQLVTASLASQN------EKKQQVTTL 387


>gi|257086338|ref|ZP_05580699.1| exonuclease VII [Enterococcus faecalis D6]
 gi|256994368|gb|EEU81670.1| exonuclease VII [Enterococcus faecalis D6]
 gi|315026956|gb|EFT38888.1| exodeoxyribonuclease VII, large subunit [Enterococcus faecalis
           TX2137]
          Length = 448

 Score =  244 bits (624), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 137/389 (35%), Positives = 229/389 (58%), Gaps = 17/389 (4%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ +LK   +++  L  V + GEIS +R   ++ H YFSLKD+H++I AI++K   
Sbjct: 7   TVTALTKYLKRKFDADPYLGRVYLTGEISNFR-FRANAHQYFSLKDDHAKISAIMFKSAF 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            K++F P+EG++ +V+G+I+ +  S  YQI IE + P G G L  AL + ++KL +EGLF
Sbjct: 66  QKLKFQPKEGMKVMVVGRISLYENSGSYQIYIEHMEPDGVGALYQALAELREKLGKEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
            +  K  +P  PK IAV+TSP+GAVIRDI+  +  R+P+ ++++FP  VQG++   +I  
Sbjct: 126 -EGPKQQLPRYPKRIAVVTSPSGAVIRDIITTVKRRYPIAQLVLFPTLVQGEQAADDIVR 184

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
            I + +   +       D +I+ RGGGSIEDLW FN+E + RAI  ++ PIIS++GHETD
Sbjct: 185 NIQRADAQGDF------DTMIIGRGGGSIEDLWPFNEEKVARAIHAATTPIISSVGHETD 238

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            T+AD  AD+RA TPT AAE+AVPV       +    +RL    + L++ +      L  
Sbjct: 239 VTIADMVADVRAATPTAAAELAVPVLNEELLRISERRSRLEQSFLYLLQQRTERFQRLQN 298

Query: 313 A--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNR 370
           +      ++       +LDR+ + L   +  I  +K R    I  +++       +++++
Sbjct: 299 SYVFKQPERLYEGQTIKLDRMTQRLFQAMTTIHHQKQRQAQGITAQLQQQTPKGQLRESQ 358

Query: 371 QHILEKQQHIEQIVKQHLRYIFLEKKEKI 399
           Q +   Q++++  + Q    +FL K+++ 
Sbjct: 359 QQLAFLQRNLQTQMTQ----LFLNKQKQF 383


>gi|257081232|ref|ZP_05575593.1| exonuclease VII [Enterococcus faecalis E1Sol]
 gi|256989262|gb|EEU76564.1| exonuclease VII [Enterococcus faecalis E1Sol]
          Length = 448

 Score =  244 bits (624), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 137/389 (35%), Positives = 230/389 (59%), Gaps = 17/389 (4%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ +LK   +++  L  V + GEIS +R   ++ H YF+LKD+H++I AI++K   
Sbjct: 7   TVTALTKYLKRKFDADPYLGRVYLTGEISNFR-FRANAHQYFNLKDDHAKISAIMFKSAF 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            K++F P+EG++ +V+G+I+ +  S  YQI IE + P G G L  AL + ++KL +EGLF
Sbjct: 66  QKLKFQPKEGMKVMVVGRISLYENSGSYQIYIEHMEPDGVGALYQALAELREKLGKEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
            +  K  +P  PK IAV+TSP+GAVIRDI+  +  R+P+ ++++FP  VQG++   +I  
Sbjct: 126 -EGPKQQLPRYPKRIAVVTSPSGAVIRDIITTVKRRYPIAQLVLFPTLVQGEQAADDIVR 184

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
            I + +   +       D +I+ RGGGSIEDLW FN+E + RAI  ++ PIIS++GHETD
Sbjct: 185 NIQRADAQGDF------DTMIIGRGGGSIEDLWPFNEEKVARAIHAATTPIISSVGHETD 238

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            T+AD  AD+RA TPT AAE+AVPV       +    +RL    + L++ +      L  
Sbjct: 239 VTIADMVADVRAATPTAAAELAVPVLNEELLRISERRSRLEQSFLYLLQQRTERFQRLQN 298

Query: 313 A--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNR 370
           +      ++       +LDR+ + L   +  I  +K R    II +++       +++++
Sbjct: 299 SYVFKQPERLYEGQTIKLDRMTQRLFQAMTTIHHQKQRQAQGIIAQLQQQTPKGQLRESQ 358

Query: 371 QHILEKQQHIEQIVKQHLRYIFLEKKEKI 399
           Q +   Q++++  + Q    +FL K+++ 
Sbjct: 359 QQLAFLQRNLQTQMTQ----LFLNKQKQF 383


>gi|42526527|ref|NP_971625.1| exodeoxyribonuclease VII, large subunit [Treponema denticola ATCC
           35405]
 gi|41816720|gb|AAS11506.1| exodeoxyribonuclease VII, large subunit [Treponema denticola ATCC
           35405]
          Length = 398

 Score =  244 bits (624), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 127/302 (42%), Positives = 186/302 (61%), Gaps = 16/302 (5%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
           YSV E++  +K ++ES   +V + GEIS +R   ++GH YF LKD  + I A+++KG   
Sbjct: 5   YSVYEITLQIKELLESGFGYVSIEGEISNFRP-SAAGHLYFILKDEKASIQAVMFKGKTR 63

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
            + F+P++G+     G I+ +     YQIIIE +  +G G +L  LE+RKKKL  EG+F 
Sbjct: 64  SLSFVPKDGMTVKAEGAISVYEQRGSYQIIIEEMSLAGEGNILKMLEERKKKLAAEGIFD 123

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCR-FPLRVIIFPVKVQGDECPKEIANA 193
            + K P+P+ PK IAVITSPTGA +RDI+  +  R   + +++ P  VQG+E    +   
Sbjct: 124 SERKKPLPYFPKRIAVITSPTGAAVRDIINVVKRRNEKIGIVVLPAIVQGEEAAPVL--- 180

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I QL    E       D+II+ RGGGS+EDL  F+DE +VRAIA    P+ISA+GHE DW
Sbjct: 181 IRQLKIADEKNLG---DLIIIGRGGGSLEDLLPFSDEELVRAIAACKTPVISAVGHEIDW 237

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLI--------NLEARLNNIIIRLIKYKIN 305
            L+D+AAD+RAPTP+ AAE+A P+   +  S+         N+E R+  I + L  +K +
Sbjct: 238 ALSDFAADMRAPTPSAAAELAAPILNDIMYSIAVNREDLTQNIENRIERIRLMLNNFKPD 297

Query: 306 TL 307
           +L
Sbjct: 298 SL 299


>gi|119505206|ref|ZP_01627281.1| Exodeoxyribonuclease VII [marine gamma proteobacterium HTCC2080]
 gi|119458897|gb|EAW39997.1| Exodeoxyribonuclease VII [marine gamma proteobacterium HTCC2080]
          Length = 458

 Score =  244 bits (623), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 145/492 (29%), Positives = 247/492 (50%), Gaps = 50/492 (10%)

Query: 16  SVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNK 75
           SVSEL+   K ++E + + V V GEIS +    SSGH YF+LKD+ S++   +++    K
Sbjct: 12  SVSELTQRAKSLLEGHFARVDVEGEISDFTAA-SSGHWYFTLKDSESQVRCAMFRSANAK 70

Query: 76  IEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSD 135
           + F P  G    +  +++ +    ++Q+I + + P+G G L  A EK K KL EEGLF  
Sbjct: 71  LRFKPSRGDRVQIRARVSLYTNRGEFQLIAQHIQPAGDGALQQAFEKLKTKLFEEGLFGV 130

Query: 136 QHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIANAI 194
             K P+P   + I VITS +GA + DIL  +  R P+  + +FPV VQG + P  +  A+
Sbjct: 131 DRKQPVPNSARRIGVITSASGAALHDILAVLERRSPMTEIFLFPVPVQGTDAPGALVRAV 190

Query: 195 LQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWT 254
            Q N L +  T P  D++I+ RGGGS EDLW FNDE + RAIANS +P +SA+GHE D++
Sbjct: 191 DQANALHQQHTLPL-DVLIIGRGGGSAEDLWAFNDETLARAIANSDLPTVSAVGHEVDFS 249

Query: 255 LADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKAL 314
           ++D+ AD RA TP+ AAE+    +      L + +  L  +++R +K +   L      L
Sbjct: 250 ISDFVADQRAATPSAAAELVSLDQSEWSQRLDDAQRILQGLMVRRLKQERAVLGHWRARL 309

Query: 315 PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHIL 374
            +   TL   R  LD   ++L  +++  +  +     ++  +++S     +I+ +   + 
Sbjct: 310 RHPGTTLKQQRQLLDSRIQQLALSMQNRLKFQRSTLTNLAKQVESRHPGRSIEHHASLLA 369

Query: 375 EKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSHK 434
           ++++ ++Q+V+  +R                                             
Sbjct: 370 QRKRELQQLVQGSMRRF------------------------------------------- 386

Query: 435 IKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDGQA 494
                T+++   ++L+S   +NTL RGY  +   +   I   ++   K+ + I   +G+ 
Sbjct: 387 ----RTTLAQHEQLLRSLGPENTLARGYALVTGPDGQIIRNAKDAPAKSELRIRLAEGEL 442

Query: 495 NAIVINKAPPKE 506
            A VI+   PK+
Sbjct: 443 AAEVIDVDTPKD 454


>gi|257457306|ref|ZP_05622477.1| exodeoxyribonuclease VII, large subunit [Treponema vincentii ATCC
           35580]
 gi|257445228|gb|EEV20300.1| exodeoxyribonuclease VII, large subunit [Treponema vincentii ATCC
           35580]
          Length = 395

 Score =  244 bits (623), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 123/281 (43%), Positives = 181/281 (64%), Gaps = 9/281 (3%)

Query: 10  LDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIW 69
           +DH  YS+ E++  +K + E N + + + GEIS  R   S+GH YF+LKD  + + A+++
Sbjct: 1   MDHV-YSIQEITGIIKSLFEQNFTSLRIAGEISNCRP-SSTGHLYFTLKDEKAALQAVMF 58

Query: 70  KGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLE 129
           KG    + F P++G++ +V G ++ +     YQ+I+E++  +G G +L  LE+RK+KL  
Sbjct: 59  KGRTWTLGFEPKDGLKVIVSGSLSVYEQRGSYQVIVETMELAGEGAILKMLEERKQKLAR 118

Query: 130 EGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCR-FPLRVIIFPVKVQGDECPK 188
           EGLF    K P+PF P  IAVITSPTGA +RDIL  +S R   + V + P  VQG E   
Sbjct: 119 EGLFDQARKRPLPFFPLRIAVITSPTGAALRDILTVLSRRNSTVSVTVLPAPVQGAEAAP 178

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
            +A  +   N  K G      ++II+ RGGGS+EDL  F+DE +VRA+A S IP+ISA+G
Sbjct: 179 VLARQLETANRYKLG------ELIIIGRGGGSLEDLLPFSDEAVVRAVAASEIPVISAVG 232

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLE 289
           HE DW L D+AAD+RAPTP+ AAE+AVPV + +  ++  L+
Sbjct: 233 HEIDWALTDFAADVRAPTPSAAAELAVPVLDDITGTITQLQ 273


>gi|313619079|gb|EFR90885.1| exodeoxyribonuclease VII, large subunit [Listeria innocua FSL
           S4-378]
          Length = 451

 Score =  244 bits (623), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 132/365 (36%), Positives = 211/365 (57%), Gaps = 10/365 (2%)

Query: 28  VESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNKIEFLPEEGIEFL 87
           V+  +  V VRGEIS  +   +SGH YF++KD  + + +++++  + KI F+PE+G+  L
Sbjct: 23  VDPYMKQVFVRGEISNLKQ-PASGHLYFTVKDEFAMLRSVMFQKAVQKIGFVPEDGMNVL 81

Query: 88  VIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSDQHKNPIPFIPKI 147
           + G+I  F  + +YQ   E + P G G L   LE+ K +L +EGLF++ HK  +P  P  
Sbjct: 82  ITGRIGVFTKAGRYQFYAEHMEPDGVGALYIQLEQLKSQLEKEGLFAEAHKKVLPSFPSK 141

Query: 148 IAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANAILQLNTLKEGRTC 206
           +AV+TS TGA +RDIL  I  R P + VI++P  VQGD+  + I   I ++N   +    
Sbjct: 142 VAVVTSKTGAAVRDILTTIHRRMPSVEVIVYPTVVQGDKAAQRIVENIGRINQRND---- 197

Query: 207 PRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWTLADYAADLRAPT 266
              D++I+ RGGGS+E+LW FN+E +VRA+ +S +P+ISA+GHETD+ L+D++AD+RA T
Sbjct: 198 --IDVMIIGRGGGSLEELWAFNEEPVVRAVYDSDVPVISAVGHETDFALSDFSADVRAAT 255

Query: 267 PTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK--ALPNSDQTLSCS 324
           PT AAE+AVP    L+  L   + RL  +  +L++ K   L  L +   L      L   
Sbjct: 256 PTAAAELAVPDYRDLEERLAERKYRLLAVTRQLLERKERALEQLKQHLILNGPKHQLEQQ 315

Query: 325 RYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHILEKQQHIEQIV 384
             R D     L++     +  K   FN + +R+        I   ++ I  ++Q +++ +
Sbjct: 316 MERTDYFAERLKNAFSKQVLLKQTTFNRLNDRLHYYHPKKEIALQKEQITLRKQALDKAM 375

Query: 385 KQHLR 389
           KQ L+
Sbjct: 376 KQQLK 380


>gi|256823049|ref|YP_003147012.1| exodeoxyribonuclease VII large subunit [Kangiella koreensis DSM
           16069]
 gi|256796588|gb|ACV27244.1| exodeoxyribonuclease VII, large subunit [Kangiella koreensis DSM
           16069]
          Length = 451

 Score =  244 bits (622), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 150/483 (31%), Positives = 244/483 (50%), Gaps = 55/483 (11%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
           YSVSEL++ ++  +E  +  + + GEIS    + +SGH YF+LKDN +++   I+K    
Sbjct: 18  YSVSELAFKVRKQLEDAIGQIWITGEISNL-ALPASGHWYFTLKDNGAQLRCAIFKNRNR 76

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
              F PE+G + L+  K++ +      Q+I E + P+G G L  A  + K+KL  EGLF+
Sbjct: 77  SARFTPEDGQQVLLRAKLSLYEPRGDIQLIGEYIEPAGEGALQIAFNRLKEKLQAEGLFA 136

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANA 193
            + K PIP  P  I +ITSP+GA IRD+L  +  R P + VII+P +VQG++  K +   
Sbjct: 137 PELKRPIPKFPNKIGIITSPSGAAIRDVLTVLKRRMPQIPVIIYPSQVQGEKAAKSL--- 193

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I QL    +   C   D++++ RGGGS+ED+W FNDE + R I +S IP++SA+GHE D 
Sbjct: 194 IKQLEVANQHNQC---DVLLVTRGGGSLEDMWCFNDETLARNIRDSRIPVVSAVGHEVDT 250

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           +++D+ ADLRAPTP+ AAE+ VP +  LQ  L+ LE RL       ++   + L++L+  
Sbjct: 251 SISDWVADLRAPTPSAAAELLVPDQAELQHKLVQLERRLTGEFEHRLQVAQSKLDTLIAR 310

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           + +  Q L+  +  L  L + L    + ++  K   +  + +R+ S    +N +      
Sbjct: 311 IIHPKQQLNSYKVELQSLNKSLLGTQKYLLQSKQAEYKELDSRLHS----YNPKLQLSQA 366

Query: 374 LEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSH 433
               +   + + Q  +Y+  +K++ +A    L+ Q  N I  L                 
Sbjct: 367 KNSLKQTNKSLMQSWKYLLKQKQQMLA----LKAQKLNNISPLA---------------- 406

Query: 434 KIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDGQ 493
                                  TL+RGYT  +D     IT  +       +   F DG+
Sbjct: 407 -----------------------TLERGYTITEDETGKAITSMKQAQKSQELTTRFVDGK 443

Query: 494 ANA 496
             +
Sbjct: 444 VKS 446


>gi|297584558|ref|YP_003700338.1| exodeoxyribonuclease VII large subunit [Bacillus selenitireducens
           MLS10]
 gi|297143015|gb|ADH99772.1| exodeoxyribonuclease VII, large subunit [Bacillus selenitireducens
           MLS10]
          Length = 454

 Score =  244 bits (622), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 130/322 (40%), Positives = 202/322 (62%), Gaps = 12/322 (3%)

Query: 15  YSVSELSYHLKHIVES--NLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           +SV+EL+  +K   ++  +L +V +R EIS ++  HS GH YF+LKD  SRI ++++ G+
Sbjct: 6   WSVTELTKTIKEKFDTAPDLQNVWLRAEISNFKH-HSRGHMYFTLKDAGSRIQSVMFAGS 64

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
              ++F PE G+  L+ G+++ +    +YQ+ ++ + P G G L  A E+ K+KL  EGL
Sbjct: 65  NRYLKFTPENGMSVLIRGQVSVYEPYGQYQLYVKEMQPDGIGNLYLAFEELKEKLDREGL 124

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIA 191
           FS + K  IP  PK IAV+TSPTGA +RD++  ++ R+P+  V + PV+VQG+     I 
Sbjct: 125 FSQESKKRIPRTPKRIAVVTSPTGAAVRDMITTLNRRYPVASVTLLPVQVQGESAAPTIV 184

Query: 192 NAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHET 251
            AI Q    +EG      D++I+ RGGGS+E+LW FN+E + RAI + +IP+ISA+GHET
Sbjct: 185 KAIRQAE--EEGSF----DVLIVGRGGGSLEELWAFNEESVARAIFSCTIPVISAVGHET 238

Query: 252 DWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLL 311
           D T++D+ ADLRA TPT AAE+AVP ++ +   LI+ + RL +   +++  +   L  L+
Sbjct: 239 DVTISDFVADLRAATPTAAAELAVPDQQEMIDWLIDRKKRLRHSFNQMVTREQTRLQRLM 298

Query: 312 K--ALPNSDQTLSCSRYRLDRL 331
              A     Q +      LDRL
Sbjct: 299 ASYAFRYPKQLIEQKEQDLDRL 320


>gi|225174883|ref|ZP_03728880.1| exodeoxyribonuclease VII, large subunit [Dethiobacter alkaliphilus
           AHT 1]
 gi|225169523|gb|EEG78320.1| exodeoxyribonuclease VII, large subunit [Dethiobacter alkaliphilus
           AHT 1]
          Length = 407

 Score =  243 bits (621), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 120/289 (41%), Positives = 192/289 (66%), Gaps = 15/289 (5%)

Query: 11  DHPEYSVSELSYHLKHI--VESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAII 68
           D P  +V++L+ ++K++   +S L+ + V GEIS ++  HSSGH YF+LKD  + +  ++
Sbjct: 6   DGP-VTVAQLTQYIKNLFAADSQLNSLRVSGEISNFKH-HSSGHMYFTLKDAKASLRCVM 63

Query: 69  WKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLL 128
           ++    ++ F P +G+  +V G+I+ +    +YQ+ +E+++P G G+L  A E  KK+L 
Sbjct: 64  FRSYNARLTFKPTQGMNVVVSGRISVYERDGQYQMYVENMLPEGVGSLFAAFEALKKRLA 123

Query: 129 EEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECP 187
            EGLF+ + K  +P +P  I V+TSPTGA IRDIL  +  RFP   V++ PV VQG + P
Sbjct: 124 AEGLFAPEKKKQLPKLPTRIGVVTSPTGAAIRDILTTLKRRFPQAEVLVMPVLVQGPDAP 183

Query: 188 KEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAI 247
           ++IA AI  LN + +       D++I+ RGGG+IE+LW FN+E++ RA+  S IP++SA+
Sbjct: 184 EQIAEAIEFLNNIDD------VDVMIIGRGGGAIEELWAFNEEVVARAVYASDIPVVSAV 237

Query: 248 GHETDWTLADYAADLRAPTPTGAAEMAVP----VKEHLQSSLINLEARL 292
           GHETD+T+AD+ AD+RA TPT AAE+ VP    + ++L S+   + A+L
Sbjct: 238 GHETDFTIADFVADVRAATPTAAAEIVVPDQREIMQYLDSAKQRMAAKL 286


>gi|259503555|ref|ZP_05746457.1| exodeoxyribonuclease VII [Lactobacillus antri DSM 16041]
 gi|259168468|gb|EEW52963.1| exodeoxyribonuclease VII [Lactobacillus antri DSM 16041]
          Length = 449

 Score =  243 bits (621), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 133/308 (43%), Positives = 196/308 (63%), Gaps = 18/308 (5%)

Query: 10  LDHPEY-SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDA 66
           +D  +Y +VS+L+ +LK   + +  L  V + GE+S +R    SGH YFSLKD+H+ IDA
Sbjct: 1   MDRSKYLTVSQLTKYLKLKFDRDPYLQTVYLTGELSNFR--LRSGHQYFSLKDDHAVIDA 58

Query: 67  IIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKK 126
           ++++G  +K++F PEEG++  V G +  +  S +YQI I+++ P G G+L  A E+ KKK
Sbjct: 59  VMFRGQFSKVKFTPEEGMKLCVTGHVGLYERSGRYQIYIDTMEPDGIGSLYLAFEQLKKK 118

Query: 127 LLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDE 185
           L  EGLFS + K P+P  P+ IAV+TS  GAVIRDI   +  R+P+ +V++FP  VQG++
Sbjct: 119 LSAEGLFS-RPKKPVPLFPRRIAVVTSLNGAVIRDINTTVRRRYPIAQVVLFPTVVQGEK 177

Query: 186 CPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIIS 245
              +IA  I      K        D +I+ RGGGSIEDLW FN+E++ RAIA+  +P+IS
Sbjct: 178 AAADIARQI------KRAGERGDFDTLIIGRGGGSIEDLWPFNEEVVARAIADCPLPVIS 231

Query: 246 AIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLI---NLEARLNNIIIRLIKY 302
           ++GHETD T+AD  AD RA TPT AAE+A P  + L ++L+   + + RL N +   I +
Sbjct: 232 SVGHETDTTIADLVADQRAATPTAAAELATP--QRLDNTLMLIGDFQRRLYNTLRAQIDF 289

Query: 303 KINTLNSL 310
               L  L
Sbjct: 290 DRKQLAKL 297


>gi|321311914|ref|YP_004204201.1| exodeoxyribonuclease VII large subunit [Bacillus subtilis BSn5]
 gi|320018188|gb|ADV93174.1| exodeoxyribonuclease VII large subunit [Bacillus subtilis BSn5]
          Length = 448

 Score =  243 bits (621), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 133/350 (38%), Positives = 208/350 (59%), Gaps = 14/350 (4%)

Query: 16  SVSELSYHLKH--IVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +VS L+ ++K    V+ +L ++ ++GE+S  + IH+ GH YF+LKD ++R+ ++++    
Sbjct: 8   TVSALTKYIKRKFDVDPHLENIWIKGELSNVK-IHTRGHIYFTLKDENARMQSVMFARQS 66

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            ++ F PE G++ LV G I+ +  S  YQ+  + + P G G L  A E+ KKKL  EGLF
Sbjct: 67  ERLPFKPENGMKVLVRGGISVYEPSGNYQLYAKEMQPDGVGALYLAYEELKKKLAGEGLF 126

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
            D++K  IP  P  I V+TSPTGA +RD++  +  R+PL +VI+ P  VQG+   + I  
Sbjct: 127 DDRYKKQIPAFPATIGVVTSPTGAAVRDVITTLKRRYPLVKVIVLPALVQGENASRSIVT 186

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
            I + N   E   C   D++I+ RGGGSIE+LW FN+E++ RAI  S+IPIISA+GHETD
Sbjct: 187 RIEEAN---EKEIC---DVLIVGRGGGSIEELWAFNEEIVARAIFASNIPIISAVGHETD 240

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI---KYKINTLNS 309
           +T++D+ AD+RA TPTGAAE+AVP    L       E R+   + + +   K +I TL S
Sbjct: 241 FTISDFVADIRAATPTGAAEIAVPHTTDLIERTKTAEVRMTRAMQQHLGQKKERIQTLQS 300

Query: 310 LLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
              A     +  +    + D   ++ +  L  ++ RK R       R+++
Sbjct: 301 SY-AFRFPKRLYAQKEQQFDLAYQQFQAQLTALLDRKSRQLERETYRLEA 349


>gi|227544391|ref|ZP_03974440.1| exodeoxyribonuclease VII large subunit [Lactobacillus reuteri
           CF48-3A]
 gi|300909748|ref|ZP_07127209.1| exodeoxyribonuclease VII large subunit [Lactobacillus reuteri
           SD2112]
 gi|227185654|gb|EEI65725.1| exodeoxyribonuclease VII large subunit [Lactobacillus reuteri
           CF48-3A]
 gi|300893613|gb|EFK86972.1| exodeoxyribonuclease VII large subunit [Lactobacillus reuteri
           SD2112]
          Length = 445

 Score =  243 bits (621), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 153/404 (37%), Positives = 234/404 (57%), Gaps = 28/404 (6%)

Query: 10  LDHPEY-SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDA 66
           +D  +Y +VSEL+ +LK   + +  L  V + GE+S +R      H YFSLKD+++ IDA
Sbjct: 1   MDRSQYLTVSELTKYLKMKFDRDPYLHTVYLTGELSNFR--LRQKHQYFSLKDDNAVIDA 58

Query: 67  IIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKK 126
           ++++    KI+F PE+G++  V+G ++ +  S +YQI I+ + P G G+L  A E+ KKK
Sbjct: 59  VMFEHQFRKIKFTPEQGMKVCVVGHVSLYEKSGRYQIYIDRMEPDGLGSLYLAFEQLKKK 118

Query: 127 LLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDE 185
           L  EGLF +  K  IP  PK IAV+TS  GAVIRDI   +  R+P+ +V+++P  VQGD+
Sbjct: 119 LSAEGLF-NLPKKQIPMFPKRIAVVTSIDGAVIRDINTTVRRRYPIAQVVLYPTVVQGDK 177

Query: 186 CPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIIS 245
              +IA  I + N   +       D +I+ RGGGS+EDLW FN+E++ RAIANS IP+IS
Sbjct: 178 AAADIARQINRANDRGDF------DTLIIGRGGGSMEDLWPFNEEVVARAIANSKIPVIS 231

Query: 246 AIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINL---EARLNNIIIRLIKY 302
           ++GHETD T+AD  AD RA TPT AAE+A PVK  L   L+ L   + RL N +   I +
Sbjct: 232 SVGHETDTTIADLVADQRAATPTAAAELATPVK--LNDVLMTLKDDQNRLLNTMRTKINF 289

Query: 303 KINTLNSLLKALPNSDQTLSCSRY--RLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
               LN  L++      T     Y  ++D+L ++L    +  +     +   +  R+ + 
Sbjct: 290 DRQQLNKQLQSYIFQQPTRLYENYAQKVDQLTQQLGQAAQNKMQEMRMNVERLSGRLTAI 349

Query: 361 FLIHNIQKNRQHI--LEKQQHIEQIVKQHLRYIFLEKKEKIAIL 402
             +H +Q+  Q +  L+KQ     +  Q+      EKK+++  L
Sbjct: 350 SPLHRVQQQEQLVNQLQKQLVTASLASQN------EKKQQVTTL 387


>gi|221314677|ref|ZP_03596482.1| exodeoxyribonuclease VII large subunit [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|255767540|ref|NP_390310.2| exodeoxyribonuclease VII large subunit [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|251757275|sp|P54521|EX7L_BACSU RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|225185168|emb|CAB14361.2| exodeoxyribonuclease VII (large subunit) [Bacillus subtilis subsp.
           subtilis str. 168]
          Length = 448

 Score =  243 bits (621), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 133/350 (38%), Positives = 208/350 (59%), Gaps = 14/350 (4%)

Query: 16  SVSELSYHLKHI--VESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +VS L+ ++K    V+ +L ++ ++GE+S  + IH+ GH YF+LKD ++R+ ++++    
Sbjct: 8   TVSALTKYIKRKFDVDPHLENIWIKGELSNVK-IHTRGHIYFTLKDENARMQSVMFARQS 66

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            ++ F PE G++ LV G I+ +  S  YQ+  + + P G G L  A E+ KKKL  EGLF
Sbjct: 67  ERLPFKPENGMKVLVRGGISVYEPSGNYQLYAKEMQPDGVGALYLAYEELKKKLAGEGLF 126

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
            D++K  IP  P  I V+TSPTGA +RD++  +  R+PL +VI+ P  VQG+   + I  
Sbjct: 127 DDRYKKQIPAFPATIGVVTSPTGAAVRDVITTLKRRYPLVKVIVLPALVQGENASRSIVT 186

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
            I + N   E   C   D++I+ RGGGSIE+LW FN+E++ RAI  S+IPIISA+GHETD
Sbjct: 187 RIEEAN---EKEIC---DVLIVGRGGGSIEELWAFNEEIVARAIFASNIPIISAVGHETD 240

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI---KYKINTLNS 309
           +T++D+ AD+RA TPTGAAE+AVP    L       E R+   + + +   K +I TL S
Sbjct: 241 FTISDFVADIRAATPTGAAEIAVPHTTDLIERTKTAEVRMTRAMQQHLGQKKERIQTLQS 300

Query: 310 LLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
              A     +  +    + D   ++ +  L  ++ RK R       R+++
Sbjct: 301 SY-AFRFPKRLYAQKEQQFDLAYQQFQAQLTALLDRKSRQLERETYRLEA 349


>gi|253576319|ref|ZP_04853649.1| exodeoxyribonuclease VII, large subunit [Paenibacillus sp. oral
           taxon 786 str. D14]
 gi|251844212|gb|EES72230.1| exodeoxyribonuclease VII, large subunit [Paenibacillus sp. oral
           taxon 786 str. D14]
          Length = 317

 Score =  243 bits (621), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 124/273 (45%), Positives = 176/273 (64%), Gaps = 10/273 (3%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V EL+ +++  +ES+  L+ V +RGEIS +   HSSGH YF+LKD  SRI +I++    
Sbjct: 52  TVKELNRYIRMKLESDQVLTDVWIRGEISNFTH-HSSGHMYFTLKDADSRIKSIMFASYN 110

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            ++ F P+EG   +  G ++ +    +YQ  +  + P G G+L  A E+ K+KL  EGLF
Sbjct: 111 QRLPFRPKEGTRVIARGNVSVYERDGQYQFYVTHMQPDGVGSLYLAFEQLKQKLEAEGLF 170

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIAN 192
           +   K P+P  PK I V+TSPTGA +RDIL  +  R+P   VI++PV VQG      I  
Sbjct: 171 APGRKRPLPRFPKTIGVVTSPTGAAVRDILTTLGRRYPQAAVILYPVLVQGKGAAPSIVK 230

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI  LN + E       D++I+ RGGGS+E+LW FN+E + RAI  S+IP+ISA+GHETD
Sbjct: 231 AIRTLNAMGEA------DVLIVGRGGGSLEELWAFNEEQVARAIYESAIPVISAVGHETD 284

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSL 285
           +T+AD+ ADLRA TPT AAE+AVP    L++ L
Sbjct: 285 FTIADFVADLRAATPTAAAELAVPHTAELRALL 317


>gi|291484872|dbj|BAI85947.1| exodeoxyribonuclease VII large subunit [Bacillus subtilis subsp.
           natto BEST195]
          Length = 460

 Score =  243 bits (621), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 133/350 (38%), Positives = 208/350 (59%), Gaps = 14/350 (4%)

Query: 16  SVSELSYHLKH--IVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +VS L+ ++K    V+ +L ++ ++GE+S  + IH+ GH YF+LKD ++R+ ++++    
Sbjct: 20  TVSALTKYIKRKFDVDPHLENIWIKGELSNVK-IHTRGHIYFTLKDENARMQSVMFARQS 78

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            ++ F PE G++ LV G I+ +  S  YQ+  + + P G G L  A E+ KKKL  EGLF
Sbjct: 79  ERLPFKPENGMKVLVRGGISVYEPSGNYQLYAKEMQPDGVGALYLAYEELKKKLAGEGLF 138

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
            D++K  IP  P  I V+TSPTGA +RD++  +  R+PL +VI+ P  VQG+   + I  
Sbjct: 139 DDRYKKQIPAFPATIGVVTSPTGAAVRDVITTLKRRYPLVKVIVLPALVQGENASRSIVT 198

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
            I + N   E   C   D++I+ RGGGSIE+LW FN+E++ RAI  S+IPIISA+GHETD
Sbjct: 199 RIEEAN---EKEIC---DVLIVGRGGGSIEELWAFNEEIVARAIFASNIPIISAVGHETD 252

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI---KYKINTLNS 309
           +T++D+ AD+RA TPTGAAE+AVP    L       E R+   + + +   K +I TL S
Sbjct: 253 FTISDFVADIRAATPTGAAEIAVPHTTDLIERAKTAEVRMTRAMQQHLGQKKERIQTLQS 312

Query: 310 LLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
              A     +  +    + D   ++ +  L  ++ RK R       R+++
Sbjct: 313 SY-AFRFPKRLYAQKEQQFDLAYQQFQAQLTALLDRKSRQLERETYRLEA 361


>gi|51892984|ref|YP_075675.1| exodeoxyribonuclease VII large subunit [Symbiobacterium
           thermophilum IAM 14863]
 gi|51856673|dbj|BAD40831.1| exodeoxyribonuclease VII large subunit [Symbiobacterium
           thermophilum IAM 14863]
          Length = 415

 Score =  243 bits (620), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 127/349 (36%), Positives = 208/349 (59%), Gaps = 12/349 (3%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V EL+ ++K +++ +  L  V V+GEIS ++  H SGH YF+LKD  +++  ++++   
Sbjct: 15  TVRELTRYVKDLLDEDPLLRSVWVQGEISNFK-WHHSGHIYFTLKDEVAQVKVVMFRSYA 73

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
           N++ F PE G++ +V G +T F     YQ+   ++ P G G L    E+ K++L  EGLF
Sbjct: 74  NRLRFRPENGMQVIVQGNVTVFERDGVYQLYAAAMEPYGLGALHLEFEQLKRRLAAEGLF 133

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIAN 192
            +  K PIP +P+ + ++T+PTGA IRD++     RFP +R+++ P  VQG + P+ +  
Sbjct: 134 DEALKRPIPSLPRAVGLVTAPTGAAIRDMITVARRRFPGMRLVLAPALVQGPDAPESLIR 193

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           A+  +  +      P  D++I+ RGGGS+EDLW FNDE + RAI    +P++SA+GHETD
Sbjct: 194 ALGLVARV------PEVDVVIIGRGGGSLEDLWAFNDERLARAIRACPVPVVSAVGHETD 247

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+AADLRAPTP+ AAE+ VP +  L   +  L  RL+    R ++ +   L +L +
Sbjct: 248 YTIADFAADLRAPTPSAAAELVVPSRSELLGVVDGLRIRLSTAARRSVERRRIRLRALTE 307

Query: 313 --ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
              L      +   R RLD L R LE+    ++  + R    +  R+++
Sbjct: 308 RPVLQRPQGRVLQDRQRLDGLVRRLEYLGGSLLAARRRELGGLAGRLEA 356


>gi|298675638|ref|YP_003727388.1| exodeoxyribonuclease VII large subunit [Methanohalobium evestigatum
           Z-7303]
 gi|298288626|gb|ADI74592.1| exodeoxyribonuclease VII, large subunit [Methanohalobium
           evestigatum Z-7303]
          Length = 406

 Score =  243 bits (620), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 184/295 (62%), Gaps = 10/295 (3%)

Query: 15  YSVSELSYHLKHIVESNLS--HVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           Y+VSEL+ H+K ++++ LS   + VRGEIS ++  H+SGH YF+LKD +++I  + ++ T
Sbjct: 3   YTVSELNTHIKQLLKNELSINQIWVRGEISNFKK-HTSGHYYFTLKDRNNQISCVSFRST 61

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
              I+F PE+ ++ L+ G I  +    +YQ+ +  + P G G L  A E+ K +L  EG 
Sbjct: 62  NRNIKFEPEDSMQVLIFGSIDVYKVRGQYQLNVFDIRPDGIGELYKAYEQLKNQLDSEGF 121

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F D +K  IP  P  I V TS  GA I DI+  +  RFP+ ++I P  VQG++    I +
Sbjct: 122 FKDTNKKSIPEFPHRIGVATSTKGAAIHDIMNVVKRRFPVDILISPTIVQGEQSASSIVD 181

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           +I +LN       C   D+IIL RGGGS+EDLW FN+E++ RAI +S  P+ISA+GHETD
Sbjct: 182 SIEKLN------QCS-VDVIILGRGGGSLEDLWSFNEEIVARAIYSSQKPVISAVGHETD 234

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTL 307
           +T+AD+ AD+RAPTP+ AAE+ VP    +   + NL +R+ N I   I  K   L
Sbjct: 235 YTIADFTADMRAPTPSAAAELVVPDYMDIIRRINNLSSRMENAITNKITEKSTQL 289


>gi|315282226|ref|ZP_07870680.1| exodeoxyribonuclease VII, large subunit [Listeria marthii FSL
           S4-120]
 gi|313614128|gb|EFR87818.1| exodeoxyribonuclease VII, large subunit [Listeria marthii FSL
           S4-120]
          Length = 451

 Score =  243 bits (620), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 132/365 (36%), Positives = 211/365 (57%), Gaps = 10/365 (2%)

Query: 28  VESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNKIEFLPEEGIEFL 87
           V+  +  V VRGEIS  +   +SGH YF++KD  + + ++++   + KI F+PE+G+  L
Sbjct: 23  VDPYMKQVFVRGEISNLKQ-PASGHLYFTVKDEFAMLRSVMFHKAVQKIGFVPEDGMNVL 81

Query: 88  VIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSDQHKNPIPFIPKI 147
           + G+I  F  + +YQ   E + P G G L    E+ K +L +EGLF++ HK  +P  P  
Sbjct: 82  ITGRIGVFNKAGRYQFYAEHMEPDGVGALYIQFEQLKAQLEKEGLFAETHKKVLPSFPSK 141

Query: 148 IAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANAILQLNTLKEGRTC 206
           +AV+TS TGA +RDIL  I  R P + VI++P  VQG++  ++I   I ++N   +    
Sbjct: 142 VAVVTSKTGAAVRDILTTIHRRMPSVEVIVYPTIVQGEKAAQKIVENIGRINQRND---- 197

Query: 207 PRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWTLADYAADLRAPT 266
              D++I+ RGGGS+E+LW FN+E +VRA+ +S +P+ISA+GHETD+ L+D++AD+RA T
Sbjct: 198 --IDVMIIGRGGGSLEELWAFNEEPVVRAVYDSDVPVISAVGHETDFALSDFSADVRAAT 255

Query: 267 PTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK--ALPNSDQTLSCS 324
           PT AAE+AVP    L+  L   + RL  +  +L++ K  +L  L +   L      L   
Sbjct: 256 PTAAAELAVPDYRDLEERLAERKYRLRAVTRQLLERKERSLEQLKQHLMLNGPKHQLEQQ 315

Query: 325 RYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHILEKQQHIEQIV 384
             R D     L +     IF K   F  + +R+        I+  ++ I  +QQ +++ +
Sbjct: 316 MERTDYFAERLNNAFSKQIFVKQTAFQRLNDRLHYYHPKKEIELQKEQIALRQQTLDKAM 375

Query: 385 KQHLR 389
           KQ L+
Sbjct: 376 KQLLK 380


>gi|296133206|ref|YP_003640453.1| exodeoxyribonuclease VII, large subunit [Thermincola sp. JR]
 gi|296031784|gb|ADG82552.1| exodeoxyribonuclease VII, large subunit [Thermincola potens JR]
          Length = 402

 Score =  243 bits (620), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 119/280 (42%), Positives = 185/280 (66%), Gaps = 10/280 (3%)

Query: 16  SVSELSYHLKHIVESNL--SHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+EL+ ++K  +E +L  +++ ++GEIS ++  H SGH YF+LKD  + I  ++++   
Sbjct: 5   TVAELNNYIKEKLEGDLFLNNIWLKGEISNFK-FHYSGHMYFTLKDAQATIKCVMFRSRC 63

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
           + ++FLPE G+  +  G++  +    +YQ+ IE + P G GTL  A ++ K+KL +EGLF
Sbjct: 64  SNLKFLPENGMGVVARGRVGVYERDGQYQLYIEEMQPDGIGTLYIAFQQLKEKLEKEGLF 123

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIAN 192
             + K  +P +PK +AV+TSPTGA +RDI+  +  R P + +++ PV VQG+  P EIA 
Sbjct: 124 DQKLKKKLPRLPKRVAVVTSPTGAAVRDIITVLHRRCPHIEILLIPVAVQGENAPPEIAR 183

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI  +N   +       D+II+ RGGGS+E+LW FN E++ R+I  SSIP++SA+GHETD
Sbjct: 184 AIEMVNAYGQA------DVIIVGRGGGSLEELWAFNTEIVARSIFASSIPVVSAVGHETD 237

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARL 292
           +T+AD+ ADLRAPTP+ AAE+  P    L   L  L+ RL
Sbjct: 238 FTIADFVADLRAPTPSAAAELVAPNYLELVQRLAELQERL 277


>gi|126653063|ref|ZP_01725198.1| exodeoxyribonuclease VII large subunit [Bacillus sp. B14905]
 gi|126590164|gb|EAZ84288.1| exodeoxyribonuclease VII large subunit [Bacillus sp. B14905]
          Length = 452

 Score =  243 bits (620), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 125/305 (40%), Positives = 192/305 (62%), Gaps = 10/305 (3%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V  L+ ++K   +++  L  V V+GE+S  + IH SGH YF+LKD+ +RI A ++K   
Sbjct: 8   TVKALTKYIKRKFDADPHLREVYVKGELSNVK-IHQSGHIYFTLKDDGARIAATMFKTAA 66

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            K+ F P+EG++  + G +  + G   YQ+ ++ + P G G+L  A  + K++L +EGLF
Sbjct: 67  TKLAFEPKEGMQVFIRGDVNVYEGYGTYQLYVQEMQPDGIGSLFVAFNQLKEQLQKEGLF 126

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
             + K  IP  P+ I V+TS TGA IRDI   +  R+PL  ++I+P  VQG +    I  
Sbjct: 127 KLEWKQSIPKFPEKIGVLTSTTGAAIRDICTTLKRRYPLAEILIYPTLVQGAQAAPNIVQ 186

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
            I + N   +  TC    ++I+ RGGGSIEDLW FN+E++ RAI +S IPIISA+GHETD
Sbjct: 187 NIQRAN---QEATC---QVLIVGRGGGSIEDLWAFNEEIVARAIFDSRIPIISAVGHETD 240

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            T+ADY +DLRAPTPT AAEMAVP +  L   +++ +++++ ++   +  +   LN L +
Sbjct: 241 TTIADYVSDLRAPTPTAAAEMAVPDQAELFQRVLSQKSQIHQMVRSQLMAERQRLNKLQQ 300

Query: 313 ALPNS 317
           + P S
Sbjct: 301 SYPLS 305


>gi|296333413|ref|ZP_06875866.1| exodeoxyribonuclease VII large subunit [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305675081|ref|YP_003866753.1| exodeoxyribonuclease VII large subunit [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|296149611|gb|EFG90507.1| exodeoxyribonuclease VII large subunit [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305413325|gb|ADM38444.1| exodeoxyribonuclease VII large subunit [Bacillus subtilis subsp.
           spizizenii str. W23]
          Length = 448

 Score =  243 bits (620), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 133/350 (38%), Positives = 208/350 (59%), Gaps = 14/350 (4%)

Query: 16  SVSELSYHLKH--IVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +VS L+ ++K    V+ +L ++ ++GE+S  + IH+ GH YF+LKD ++R+ ++++    
Sbjct: 8   TVSALTKYIKRKFDVDPHLENIWIKGELSNVK-IHTRGHIYFTLKDENARMQSVMFARQS 66

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            ++ F PE G++ LV G I+ +  S  YQ+  + + P G G L  A E+ KKKL  EGLF
Sbjct: 67  ERLPFKPENGMKVLVRGGISVYEPSGNYQLYAKEMQPDGVGALYLAYEELKKKLAGEGLF 126

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
            D++K  IP  P  I V+TSPTGA +RD++  +  R+PL +VI+ P  VQG+   + I +
Sbjct: 127 DDRYKKQIPAFPATIGVVTSPTGAAVRDVITTLKRRYPLVKVIVLPALVQGENASRSIVS 186

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
            I + N   E   C   D++I+ RGGGSIE+LW FN+E++ RAI  S IPIISA+GHETD
Sbjct: 187 RIEEAN---EKEVC---DVLIVGRGGGSIEELWAFNEEIVARAIFASHIPIISAVGHETD 240

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI---KYKINTLNS 309
           +T++D+ AD+RA TPTGAAE+AVP    L       E R+   + + +   K +I TL S
Sbjct: 241 FTISDFVADIRAATPTGAAEIAVPHTTDLIERTKTAEVRMTRAMQQHLGQKKERIQTLQS 300

Query: 310 LLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
              A     +  +    + D   ++ +  L  ++ RK R       R+++
Sbjct: 301 SY-AFRFPKRLYAQKEQQFDLAYQQFQAQLTALLDRKNRQLERETYRLEA 349


>gi|311069031|ref|YP_003973954.1| exodeoxyribonuclease VII large subunit [Bacillus atrophaeus 1942]
 gi|310869548|gb|ADP33023.1| exodeoxyribonuclease VII large subunit [Bacillus atrophaeus 1942]
          Length = 448

 Score =  243 bits (620), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 125/300 (41%), Positives = 191/300 (63%), Gaps = 13/300 (4%)

Query: 16  SVSELSYHLKH--IVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +VS L+ ++K    V+ +L  + ++GE+S  + IH+ GH YF+LKD ++R+ ++++    
Sbjct: 8   TVSALTKYIKRKFDVDPHLEDIWIKGELSNVK-IHTRGHIYFTLKDENARMQSVMFARQS 66

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            ++ F PE G++ LV G I+ +  S  YQ+  + + P G G L  A E+ KKKL  EGLF
Sbjct: 67  ARLPFKPESGMKVLVRGGISVYEPSGNYQLYAKEMQPDGVGALYLAYEELKKKLANEGLF 126

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
            ++HK  IP  P  I V+TSPTGA +RD++  +  R+PL ++I+ P  VQG+   + I  
Sbjct: 127 DERHKKTIPAFPATIGVVTSPTGAAVRDVITTLKRRYPLVKIIVLPALVQGENASRSIVK 186

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
            I + N   E + C   D++I+ RGGGSIE+LW FN+E++ R+I +S IPIISA+GHETD
Sbjct: 187 RIEEAN---EKQMC---DVLIVGRGGGSIEELWAFNEEIVARSIFSSRIPIISAVGHETD 240

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI---KYKINTLNS 309
           +T++D+ AD+RA TPTGAAE+AVP    L   +   E R+   + + I   K +I TL S
Sbjct: 241 FTISDFVADIRAATPTGAAEIAVPHTTDLIERIKTAEVRITRAMQQHISQKKERIQTLQS 300


>gi|289434642|ref|YP_003464514.1| exodeoxyribonuclease VII, large subunit [Listeria seeligeri serovar
           1/2b str. SLCC3954]
 gi|289170886|emb|CBH27428.1| exodeoxyribonuclease VII, large subunit [Listeria seeligeri serovar
           1/2b str. SLCC3954]
          Length = 450

 Score =  243 bits (620), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 133/368 (36%), Positives = 213/368 (57%), Gaps = 10/368 (2%)

Query: 25  KHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNKIEFLPEEGI 84
           K  V+  +  V VRGEIS  +   +SGH YF++KD  + + +++++  + KI F+PE+G+
Sbjct: 19  KFEVDPYMKQVFVRGEISNLKQ-PASGHLYFTVKDEFAMLRSVMFQKAVQKIGFVPEDGM 77

Query: 85  EFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSDQHKNPIPFI 144
             L+ G+I  F  + +YQ   E + P G G L   LE+ K +L +EGLF++ HK  +P  
Sbjct: 78  NVLITGRIGVFTKAGRYQFYAEHMEPDGVGALYIQLEQLKSQLEKEGLFAEAHKKVLPSF 137

Query: 145 PKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANAILQLNTLKEG 203
           P  +AV+TS TGA +RDIL  I  R P + VI++P  VQGD+  ++I   I ++N   + 
Sbjct: 138 PSKVAVVTSKTGAAVRDILTTIHRRMPSVEVIVYPTVVQGDKAAQKIVENIGRINQRND- 196

Query: 204 RTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWTLADYAADLR 263
                 D++I+ RGGGS+E+LW FN+E +VRA+ +S +P+ISA+GHETD+ L+D+++D+R
Sbjct: 197 -----IDVMIIGRGGGSLEELWAFNEEPVVRAVYDSDVPVISAVGHETDFALSDFSSDIR 251

Query: 264 APTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK--ALPNSDQTL 321
           A TPT AAE+AVP    L+  L   + RL     +L++ K  TL  L +   L      L
Sbjct: 252 AATPTAAAELAVPDYRDLEERLAERKYRLLAGTRQLLERKERTLEQLKQHLILNGPKHQL 311

Query: 322 SCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHILEKQQHIE 381
                R D     L       +F K   FN + +R+        I+  ++ +L ++  ++
Sbjct: 312 EQQIERTDYFSERLNSAFAKQLFLKQTTFNRLNDRLNYYHPKKEIELQKEQLLLRKSALD 371

Query: 382 QIVKQHLR 389
           + +KQ L+
Sbjct: 372 KAMKQQLK 379


>gi|169828972|ref|YP_001699130.1| exodeoxyribonuclease 7 large subunit [Lysinibacillus sphaericus
           C3-41]
 gi|226697594|sp|B1HRX7|EX7L_LYSSC RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|168993460|gb|ACA41000.1| Exodeoxyribonuclease 7 large subunit [Lysinibacillus sphaericus
           C3-41]
          Length = 452

 Score =  243 bits (619), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 130/343 (37%), Positives = 205/343 (59%), Gaps = 12/343 (3%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V  L+ ++K   +++  L  V V+GE+S  + IH SGH YF+LKD+ +RI A ++K   
Sbjct: 8   TVKALTKYIKRKFDADPHLREVYVKGELSNVK-IHQSGHIYFTLKDDGARIAATMFKAAA 66

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            K+ F P+EG++  + G +  + G   YQ+ ++ + P G G+L  A  + K++L +EGLF
Sbjct: 67  TKLAFEPKEGMQVFIRGDVNVYEGYGTYQLYVQEMQPDGIGSLFVAFNQLKEQLQKEGLF 126

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
               K  IP  P+ I V+TS TGA IRDI   +  R+PL  ++I+P  VQG +    I  
Sbjct: 127 KLDWKQSIPKFPEKIGVLTSTTGAAIRDICTTLKRRYPLAEILIYPTLVQGAQAAPNIVQ 186

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
            I + N   +  TC    ++I+ RGGGSIEDLW FN+E++ RAI  S IPIISA+GHETD
Sbjct: 187 NIQRAN---QDATC---QVLIVGRGGGSIEDLWAFNEEIVARAIFESRIPIISAVGHETD 240

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            T+ADY +DLRAPTPT AAEMAVP +  L   +++ +++++ ++   +  +   LN L +
Sbjct: 241 TTIADYVSDLRAPTPTAAAEMAVPDQMELFQRVLSQKSQIHQMVRSQLMAERQRLNKLQQ 300

Query: 313 ALPNS--DQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHI 353
           + P S  ++       RL +L   L+  +++ + +K      +
Sbjct: 301 SYPLSMPERLYRPFTERLAQLESGLQTAMQVDLMKKSAQLQQL 343


>gi|192362513|ref|YP_001982570.1| exodeoxyribonuclease VII large subunit [Cellvibrio japonicus
           Ueda107]
 gi|190688678|gb|ACE86356.1| exodeoxyribonuclease VII, large subunit [Cellvibrio japonicus
           Ueda107]
          Length = 460

 Score =  243 bits (619), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 153/480 (31%), Positives = 244/480 (50%), Gaps = 56/480 (11%)

Query: 16  SVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNK 75
           SVS+L+   + ++E+    + V GE+S    I SSGH YF+LKD+ +++   +++     
Sbjct: 25  SVSQLNRRARQLLETQFPLLWVEGELSNV-SIPSSGHWYFTLKDDQAQVRCAMFRNRNML 83

Query: 76  IEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSD 135
           + F P++G + L+  +++ + G   YQII+E +  +G+G L  A E+ K +L +EGLF  
Sbjct: 84  VRFKPQQGQQVLIRARVSLYEGRGDYQIIVEHMEEAGTGALQRAFEQLKARLGQEGLFDP 143

Query: 136 QHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANAI 194
            +K P+P +P  I VITSPTGA IRDIL  +  RFP + V + PV VQG E   +I  A+
Sbjct: 144 AYKKPLPGLPGRIGVITSPTGAAIRDILSVLERRFPAIPVTLIPVAVQGKEAAPQIVRAL 203

Query: 195 LQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWT 254
              N  + G      D++I+ARGGGS+EDLW FN+E++ RAI  S +P+IS +GHE D+T
Sbjct: 204 ELAN--RSGLF----DVLIVARGGGSLEDLWPFNEEIVARAIFASRVPVISGVGHEVDFT 257

Query: 255 LADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKAL 314
           +AD+ ADLRAPTP+ AAE+ VP         I  E  L   ++R +++    L  L + L
Sbjct: 258 IADFVADLRAPTPSAAAELVVPDGNDWLDKFIGFEVLLEEAMLRKLRHWQQRLTWLRQRL 317

Query: 315 PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHIL 374
            +  + L     RLD        NLE+   R   H  H +   +     H +++ R   L
Sbjct: 318 RHPRERLEQQGQRLD--------NLEL---RLKAHIQHQLGNYR-----HKLEQLR---L 358

Query: 375 EKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSHK 434
             Q H  Q+                            RI  LH  + +   R+  +   +
Sbjct: 359 RLQPHHPQV----------------------------RIVRLHEKLAQQQQRLVSLQKQQ 390

Query: 435 IKSCHTSVSITTRILQSFAYKNTLKRGYT-SIQDTNNNFITQKRNLATKTRILINFFDGQ 493
           ++      +   R+L +    NTL+RGY+ +    +   I+  + + T   +     +G+
Sbjct: 391 LQGYKQRFNAALRLLNTLNPLNTLERGYSLTSHAESGQLISSSKQIVTGELVKTRLAEGE 450


>gi|308069600|ref|YP_003871205.1| exodeoxyribonuclease VII large subunit (exonuclease VII large
           subunit) [Paenibacillus polymyxa E681]
 gi|305858879|gb|ADM70667.1| Probable exodeoxyribonuclease VII large subunit (Exonuclease VII
           large subunit) [Paenibacillus polymyxa E681]
          Length = 454

 Score =  243 bits (619), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 132/322 (40%), Positives = 191/322 (59%), Gaps = 14/322 (4%)

Query: 15  YSVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           YS+ +L+ +++  +ES+  LS V +RGEIS +   HSSGH YF+LKD  SRI +I++   
Sbjct: 7   YSIKDLNRYIRMKLESDQVLSDVWIRGEISNFTH-HSSGHMYFTLKDEGSRIRSIMFATH 65

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
             ++ F+P+EG   +  G ++ +    +YQ     + P G G+L  A E+ K+KL  EGL
Sbjct: 66  NQRLPFVPKEGTRVIARGNVSVYERDGQYQFYATQMQPDGIGSLYLAYEQLKQKLDAEGL 125

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIA 191
           F    K  +P  P  I VITSPTGA +RDI+  +  R+P   ++++PV VQG      I 
Sbjct: 126 FDTARKRNLPAHPATIGVITSPTGAAVRDIITTLQRRYPQAGIVLYPVLVQGKGAAPSII 185

Query: 192 NAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHET 251
            AI  +N ++E        ++I+ RGGGS+E+LW FN+E + RAI  S IP+ISA+GHET
Sbjct: 186 KAIEAMNRMQE------VQVMIVGRGGGSLEELWAFNEEAVARAIYASVIPVISAVGHET 239

Query: 252 DWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLL 311
           D+T+AD+ ADLRA TPT AAE+AVP +  L+  L+  E RL N     ++ ++ T    L
Sbjct: 240 DFTIADFVADLRAATPTAAAELAVPNQAELRDQLLQREQRLRNA----LRQRLETSRERL 295

Query: 312 KALPNSDQTLSCSRYRLDRLPR 333
             L  S   L   RY L    R
Sbjct: 296 ARLQRSPVLLHPRRYMLQHAER 317


>gi|323352719|ref|ZP_08087689.1| exodeoxyribonuclease VII large subunit [Streptococcus sanguinis
           VMC66]
 gi|322121755|gb|EFX93501.1| exodeoxyribonuclease VII large subunit [Streptococcus sanguinis
           VMC66]
          Length = 446

 Score =  243 bits (619), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 139/311 (44%), Positives = 187/311 (60%), Gaps = 21/311 (6%)

Query: 13  PEY-SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIW 69
           PEY SVS L+ +LK   E +  L  V + G++S +R      H YFSLKD  + I   IW
Sbjct: 2   PEYLSVSTLTKYLKMKFERDPYLERVYLTGQVSNFR--RRPNHQYFSLKDEKAVIQVTIW 59

Query: 70  KGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLE 129
            G   K+ F  EEG++  VIG++  +  S  Y IIIE   P G G L    E+ KKKL E
Sbjct: 60  SGVYQKLGFELEEGMKINVIGRVQLYEPSGSYSIIIEKAEPDGIGALAIQFEQLKKKLGE 119

Query: 130 EGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPK 188
           EGLF D+ K  +P  PK I V+TSP+GAVIRDI+  +S RFP + ++++P KVQGD    
Sbjct: 120 EGLFQDKFKQALPQFPKKIGVVTSPSGAVIRDIITTVSRRFPGVEIVLYPTKVQGDGAAA 179

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           ++A+ I   N   +       D++I+ RGGGSIEDLW FN+E  VRAI  S IP+IS++G
Sbjct: 180 QVADHIRLANERSD------LDVLIIGRGGGSIEDLWAFNEEKTVRAIFESRIPVISSVG 233

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKE-----HLQSSLINLEARLNNIIIRLIKYK 303
           HETD TLAD+ AD RA TPT AAE+A  V +     HLQ    ++   ++N   RL  Y+
Sbjct: 234 HETDTTLADFVADHRAATPTAAAELATLVTKLDLLGHLQQQENHMSRAMSN---RLSYYR 290

Query: 304 INTLNSLLKAL 314
              LN L +++
Sbjct: 291 -ERLNKLTQSV 300


>gi|284048212|ref|YP_003398551.1| exodeoxyribonuclease VII, large subunit [Acidaminococcus fermentans
           DSM 20731]
 gi|283952433|gb|ADB47236.1| exodeoxyribonuclease VII, large subunit [Acidaminococcus fermentans
           DSM 20731]
          Length = 404

 Score =  243 bits (619), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 121/285 (42%), Positives = 184/285 (64%), Gaps = 10/285 (3%)

Query: 15  YSVSELSYHLKHIV--ESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           Y+VSE++  +K +   E   +++ ++GE+S +R  + SGH YF+LKD  + + A+++ G 
Sbjct: 7   YTVSEVTRIVKGLFRKEPEFANLQIQGEVSNFR-QYPSGHCYFNLKDGKTLLKAVMFAGA 65

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
             +++ LP+ G + L +G+I  +     YQ  ++ ++P G+G L+ A E+ K+KL  EGL
Sbjct: 66  ARRLKQLPKNGDQVLGVGRIDLYERDGVYQFYVDMMMPLGAGNLMIAYEQLKEKLTAEGL 125

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIA 191
           F    K P+P  PK++ ++TSP GA +RDI+     R P +++ ++PVKVQG E P EI 
Sbjct: 126 FDPGRKRPLPAYPKVVGIVTSPAGAAVRDIINVAGRRDPSVKLRLYPVKVQGTEAPPEII 185

Query: 192 NAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHET 251
             I  +N  K        D++I+ RGGGS+EDLW FNDE +VRAIA S IP+ISA+GHE 
Sbjct: 186 RGIRFMNRHKLA------DVLIVGRGGGSMEDLWAFNDEGVVRAIAASEIPVISAVGHEI 239

Query: 252 DWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNII 296
           D+TL+D+AADLRAPTP+ AAE+AVP +   +  L  L  RL   +
Sbjct: 240 DFTLSDFAADLRAPTPSAAAELAVPERSGDREILAKLVRRLERTM 284


>gi|237749550|ref|ZP_04580030.1| exodeoxyribonuclease VII large subunit [Oxalobacter formigenes
           OXCC13]
 gi|229380912|gb|EEO31003.1| exodeoxyribonuclease VII large subunit [Oxalobacter formigenes
           OXCC13]
          Length = 444

 Score =  243 bits (619), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 152/494 (30%), Positives = 250/494 (50%), Gaps = 58/494 (11%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           P  +VSEL+     I+E +   + V GEIS      +SGH YF+LKDN++++ +++++G 
Sbjct: 6   PVLTVSELNSTAAKILEHSFPLLWVSGEISNLTKA-ASGHWYFTLKDNNAQVRSVMFRGK 64

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
              + F+P++G +  V   +T +    ++Q+ +E++  +G G+L  A  + K KL +EGL
Sbjct: 65  AQSVGFIPKDGDKVEVRAVVTLYTARGEFQLNVEAMRHAGLGSLYEAFLRLKAKLGDEGL 124

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIA 191
           F ++ K  +P   + I ++TSP  A +RDIL  +S R P + VI++P  VQG++   +IA
Sbjct: 125 FDEERKRNLPVFARTIGIVTSPQAAALRDILTTLSRRAPHVNVILYPTPVQGEDAAGKIA 184

Query: 192 NAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHET 251
           +A+   +   E   C   D++++ RGGGSIEDLW FN+E++ RAIA  SIP IS +GHET
Sbjct: 185 SAVTLASVRAE---C---DVLLICRGGGSIEDLWSFNEEVVARAIATCSIPTISGVGHET 238

Query: 252 DWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLL 311
           D+T+AD+AAD+RAPTPTGAAEMA    +    +L  L   L   + RL++      + L 
Sbjct: 239 DFTIADFAADVRAPTPTGAAEMASRAHQDWMDNLETLADDLRMAMERLLRNAFQNTDLLA 298

Query: 312 KALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQ 371
           + L +    +   + RL  L  +L H  + I+   +   NH+  R+K+            
Sbjct: 299 RRLISPSSYIEREKIRLQSLAAKLTHTNDTILASSHYRLNHLGTRLKAQ----------- 347

Query: 372 HILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFIL 431
             L   +H   +                                L T + K+ T I+   
Sbjct: 348 --LPDTRHYRSL--------------------------------LETGLHKMKTGID--- 370

Query: 432 SHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFD 491
             ++K     +S   + L+  + K TL+RGY  I + N   +     L  +  + +   +
Sbjct: 371 -TQLKQRKQEISSLAQQLELLSTKRTLERGYAIITNRNGQIVRSPSQLPVRKPLSVQLAE 429

Query: 492 GQANAIVINKAPPK 505
           G A  I I    P+
Sbjct: 430 GSAQ-ISIETVQPE 442


>gi|90416233|ref|ZP_01224165.1| exodeoxyribonuclease VII large subunit [marine gamma
           proteobacterium HTCC2207]
 gi|90331958|gb|EAS47172.1| exodeoxyribonuclease VII large subunit [marine gamma
           proteobacterium HTCC2207]
          Length = 449

 Score =  242 bits (618), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 154/494 (31%), Positives = 255/494 (51%), Gaps = 59/494 (11%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           MNP    N  +   +SVS+L+  ++H++E+ L  + V GEIS +    +SGH Y +LKD+
Sbjct: 1   MNP----NPSERQVFSVSQLNRSVRHLIETQLPLLWVEGEISNF-ARPASGHWYLTLKDD 55

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            +++   +++    ++ F P  G + LV  +   + G  +YQ++IE +  +G G L    
Sbjct: 56  QAQVRCAMFRNANQRVGFKPANGTQVLVRCRAGLYEGRGEYQLVIEHMEEAGFGALQRQF 115

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPV 179
           E+ K+KL +EGLF +QHK P+P     I VITS TGA ++D+L  ++ RFP ++V IFP 
Sbjct: 116 EQLKQKLSDEGLFDNQHKRPMPDSVSHIGVITSATGAAVKDVLSVLARRFPSIKVSIFPT 175

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
            VQG++  K+I  AI   N L +   C   D +I+ RGGGS+EDLW FN+E++ RAI  S
Sbjct: 176 AVQGEQAAKQIVEAINNANQLGQ---C---DALIVGRGGGSLEDLWPFNEEVVARAIFAS 229

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
           +IPI+SA+GHE D+T+AD+ ADLRAPTP+ AAE+  P  E + +     E  L   + R 
Sbjct: 230 AIPIVSAVGHEVDFTIADFVADLRAPTPSAAAELLSPDGEDILNQFEGFEILLTEAVGR- 288

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
              KI+ L                 R R + L + L H    +   + +H +H+  R++ 
Sbjct: 289 ---KISQL-----------------RQRTEYLKKRLRHPGHKLQ-EQSQHLDHLDIRLRR 327

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH 419
             + + +++ RQ I   Q  + ++             E I   H L              
Sbjct: 328 -AIDNKLEQRRQQINRVQAQLARV----------HPGEAIGDYHQL-------------- 362

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
           + + + ++   +  +++   +       +L + +   TL RGY+ I+DT+N  +    +L
Sbjct: 363 VARYVKQMSRTVRQQLEVRRSKTGQAMHLLDTVSPLKTLGRGYSIIRDTDNAVVKSVASL 422

Query: 480 ATKTRILINFFDGQ 493
                +     DG+
Sbjct: 423 NKGDMLRGQLEDGE 436


>gi|149190082|ref|ZP_01868359.1| exodeoxyribonuclease VII large subunit [Vibrio shilonii AK1]
 gi|148836112|gb|EDL53072.1| exodeoxyribonuclease VII large subunit [Vibrio shilonii AK1]
          Length = 437

 Score =  242 bits (618), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 157/460 (34%), Positives = 236/460 (51%), Gaps = 55/460 (11%)

Query: 17  VSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNKI 76
           +S L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++   +++G   ++
Sbjct: 1   MSRLNSEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSRAQVKCAMFRGNNRRV 59

Query: 77  EFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSDQ 136
            F P  G + LV  +++ +     YQ+IIES+ P G G L    EK K  L  EGLF+  
Sbjct: 60  TFKPANGNQVLVKARLSLYEPRGDYQLIIESMQPEGDGRLQQEFEKLKMSLAAEGLFAQT 119

Query: 137 HKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANAIL 195
            K P+P  PK + +ITS TGA + DIL  +  R P L V+I+P  VQGD    EIA AI 
Sbjct: 120 LKQPLPSHPKRVGIITSKTGAALFDILDVLKRRDPSLPVVIYPTTVQGDNAAIEIAQAIG 179

Query: 196 QLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWTL 255
           + N+  E   C   D++I+ RGGGS+EDLW FN E++ R IA S IPIISA+GHE D T+
Sbjct: 180 RANSRNE---C---DVLIVGRGGGSLEDLWCFNHEIVARTIAASQIPIISAVGHEIDVTI 233

Query: 256 ADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKALP 315
           ADY AD+RAPTP+ AAE+      H + SLI  E RL NII   +  +   L+SL++ L 
Sbjct: 234 ADYVADVRAPTPSAAAELVSNDTSHKRESLITREQRLRNIIRLYLSEQKQRLSSLMQDLS 293

Query: 316 NSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHILE 375
           N               P+                              H++Q+  Q + E
Sbjct: 294 NQH-------------PK------------------------------HHLQRQSQRLDE 310

Query: 376 KQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH-IKKLITRIEFILSHK 434
            +  +   +KQ L    L    K   LH L+ Q+        +H + +  +R+E  +  +
Sbjct: 311 FEYRLNAAMKQRLSQETLRLTNK---LHRLKLQSPVTRLAQQSHRLTQFESRLEQAMQRQ 367

Query: 435 IKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFIT 474
           + S     ++T   L + +   TLKRGY+  QD +   I+
Sbjct: 368 LSSTKHKFALTVGKLDTVSPLATLKRGYSITQDEDGKVIS 407


>gi|296104183|ref|YP_003614329.1| exodeoxyribonuclease VII large subunit [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295058642|gb|ADF63380.1| exodeoxyribonuclease VII large subunit [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 457

 Score =  242 bits (618), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 155/486 (31%), Positives = 247/486 (50%), Gaps = 67/486 (13%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
           Y+VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   +++ +  
Sbjct: 10  YTVSRLNQTVRLLLEQEMGQVWISGEISNFTQ-PASGHWYFTLKDDTAQVRCAMFRNSNR 68

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
           ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K  L +EGLF 
Sbjct: 69  RVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAALSQEGLFD 128

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANA 193
            Q+K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ P +I  A
Sbjct: 129 QQYKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDAPGQIVRA 188

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N  +E   C   D++I+ RGGGS+EDLW FNDE + RAI  S+IPI+SA+GHETD 
Sbjct: 189 IELANARQE---C---DVLIVGRGGGSLEDLWSFNDERVARAIFASAIPIVSAVGHETDV 242

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           T+AD+ ADLRAPTP+ AAE+          S   LE                    LL+ 
Sbjct: 243 TIADFVADLRAPTPSAAAEVV---------SRNQLE--------------------LLRQ 273

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           + N  Q               LE  ++  +  + R F  + +R++        Q++ Q  
Sbjct: 274 IQNCQQ--------------RLEMAMDYFLANRTRRFTQLHHRLQ--------QQHPQLR 311

Query: 374 LEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLR-------EQTKNRIFYLHTHIKKLITR 426
           L +QQ + + ++Q + +  L+ + K A+    R       +  + RI+   T I++L  R
Sbjct: 312 LARQQTVLERLRQRMNFA-LDNQLKRAMSRQQRVTQRLNQQNPQPRIYRAQTRIQQLEYR 370

Query: 427 IEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRIL 486
           +   +  ++ +           L++ +  +TL RGY+    T+   + Q + +     + 
Sbjct: 371 LAETVRARLSTTRERFGNAVTHLEAVSPLSTLARGYSVTTATDGKVLKQTKQVKAGDVLT 430

Query: 487 INFFDG 492
               DG
Sbjct: 431 TRLSDG 436


>gi|227499082|ref|ZP_03929219.1| exodeoxyribonuclease VII large subunit [Acidaminococcus sp. D21]
 gi|226904531|gb|EEH90449.1| exodeoxyribonuclease VII large subunit [Acidaminococcus sp. D21]
          Length = 447

 Score =  242 bits (618), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 143/397 (36%), Positives = 223/397 (56%), Gaps = 30/397 (7%)

Query: 15  YSVSELSYHLKHIV--ESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           ++VSE++  LK ++  +   +++ ++GE+S +R  ++SGH YF+LKD+   I  +++KG 
Sbjct: 7   FTVSEVNLSLKELIHKDPTFANLQIQGEVSNFRR-YASGHCYFNLKDSKGLIKCVMFKGA 65

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
             +++ LP +G + + IG+I  +     YQ  ++ L+P G+G L+ A E  K+KL  EGL
Sbjct: 66  AQRLKKLPRDGDQVVGIGRIDVYERDGVYQFYVDMLMPVGTGDLMAAYEALKQKLSAEGL 125

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCR-FPLRVIIFPVKVQGDECPKEIA 191
           F +  K PIP  P+I+ V+TS  GA IRDI++    R   +++ ++PVKVQG E P EIA
Sbjct: 126 FDETRKQPIPVSPRIVGVVTSADGAAIRDIIKVAGRRDSSVKIRLYPVKVQGKEAPPEIA 185

Query: 192 NAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHET 251
             I  +N       C   D++I+ RGGGS+EDLW FNDE +VRAIA S IPIISA+GHE 
Sbjct: 186 AGIHFMN---RHNLC---DVLIVGRGGGSMEDLWAFNDEKVVRAIAASRIPIISAVGHEI 239

Query: 252 DWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLL 311
           D+TL+D+AAD RA TP+ AAE AVP +    +S   L  RL   +   +  +   L+ +L
Sbjct: 240 DFTLSDFAADKRAATPSQAAEFAVPDRSKDIASYEKLNLRLKKAVADRLAMERQCLDGVL 299

Query: 312 K--ALPNSDQTLSCSRYRLDRLPREL----EHNLEIIIFRKYRHFNHIINRIKSDFLIHN 365
           +       ++       RLD+L + L       LE    R  +  +H   R    F+  +
Sbjct: 300 QRPVFRYPERLTEGQSQRLDQLGQSLSTSFSRRLERETMRLMKLRDHWFFRHPEVFVARH 359

Query: 366 IQKNRQHILEKQQHIEQIVKQ---HLRYIFLEKKEKI 399
                      Q H+ ++ K    H RY   E ++++
Sbjct: 360 -----------QDHLTRLTKDLDLHFRYTLSETQQRL 385


>gi|166154539|ref|YP_001654657.1| exodeoxyribonuclease VII large subunit [Chlamydia trachomatis
           434/Bu]
 gi|166155414|ref|YP_001653669.1| exodeoxyribonuclease VII large subunit [Chlamydia trachomatis
           L2b/UCH-1/proctitis]
 gi|301335801|ref|ZP_07224045.1| exodeoxyribonuclease VII large subunit [Chlamydia trachomatis
           L2tet1]
 gi|226694640|sp|B0B7P6|EX7L_CHLT2 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|226694641|sp|B0BBW1|EX7L_CHLTB RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|165930527|emb|CAP04022.1| exodeoxyribonuclease VII large subunit [Chlamydia trachomatis
           434/Bu]
 gi|165931402|emb|CAP06976.1| exodeoxyribonuclease VII large subunit [Chlamydia trachomatis
           L2b/UCH-1/proctitis]
          Length = 516

 Score =  242 bits (617), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 171/521 (32%), Positives = 266/521 (51%), Gaps = 56/521 (10%)

Query: 9   SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAII 68
           S+  P   VS L+  +K+++E N   V V+GE+S    + +SGH YF++KD+ + ++   
Sbjct: 2   SITSPPIEVSVLTDSIKNLLEKNFLRVVVKGELSNV-SLQTSGHLYFAIKDSKAVLNGAF 60

Query: 69  WKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLL 128
           +       +  P++G   ++ GK+T +    +YQI+  +L  SG G LL   E+RK++L 
Sbjct: 61  FHFRSKYFDRKPKDGDYVILHGKLTVYAPRGQYQIVAYALTFSGEGNLLQQFEERKQRLA 120

Query: 129 EEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRF-PLRVIIFPVKVQGDECP 187
            EG F  + K P+P   ++I VITSPTGAVI+DIL+ +S R    +VI++PV VQG    
Sbjct: 121 AEGYFDPKRKKPLPSGARVIGVITSPTGAVIQDILRVLSRRCHQFQVILYPVTVQGATAA 180

Query: 188 KEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAI 247
           +EI+ AI   N     +   R   +I+ARGGGSIEDLW FN+E +V++I  SSIPIISA+
Sbjct: 181 QEISQAIQFFN-----QNSMRVHALIIARGGGSIEDLWAFNEEELVKSIVASSIPIISAV 235

Query: 248 GHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTL 307
           GHETD+TL D+A+D+RAPTP+ AAE+     +  +  L NL   +++   + I  K N L
Sbjct: 236 GHETDFTLCDFASDVRAPTPSAAAEIVCKSSDQYRQELQNLRRYVSSHARQFIAAKKNLL 295

Query: 308 NSLLKALPNSD------QTLSCSRYRLDR-LPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
               + L + D      QTL  +R  L+R +  +LE+  +   F +YR +      +KSD
Sbjct: 296 THWQRHLASVDFYHTAQQTLDYTRAALERGIETKLEYYKQ--RFAQYRRW------LKSD 347

Query: 361 FLIHNIQKN------------RQHILEKQQHIEQIV--------------KQHLRYIFLE 394
            LI  I+K+            +  I  K+  + Q+                QH R I  +
Sbjct: 348 VLI-RIEKHLADLNQSLMLSIKNKIYTKKTSLNQLYTSCLKNELLNLQHRTQHSRNILSQ 406

Query: 395 KKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAY 454
              ++ I     +QT          + +L   + F + H +               S   
Sbjct: 407 LSRRLHIAIASSQQTHQEC------LVRLQNELSFTIQHLLTKAKERCQAIQEQASSLNP 460

Query: 455 KNTLKRGYTSIQDTNNNF-ITQKRNLATKTRILINFFDGQA 494
           KN LKRG+  + D N +F I    +L     + +   DG+A
Sbjct: 461 KNVLKRGFAQLFDFNKHFVIISAESLKQSDLVRVCLQDGEA 501


>gi|326201954|ref|ZP_08191824.1| exodeoxyribonuclease VII, large subunit [Clostridium papyrosolvens
           DSM 2782]
 gi|325987749|gb|EGD48575.1| exodeoxyribonuclease VII, large subunit [Clostridium papyrosolvens
           DSM 2782]
          Length = 404

 Score =  242 bits (617), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 137/381 (35%), Positives = 224/381 (58%), Gaps = 20/381 (5%)

Query: 15  YSVSELSYHLKHIVESNL--SHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           YSVS+++ ++K +V  +L  S V +RGEIS ++  H +GH YF++KD +S +  +++K  
Sbjct: 5   YSVSDINNYIKQLVSRDLILSDVSIRGEISNFKH-HYTGHMYFTIKDENSLLKCVMFKSQ 63

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
              + F PE G++ +V G I+ F    +YQ+   ++ P G G L  A E+ K+KL +EGL
Sbjct: 64  AIALRFAPENGMKVIVSGYISVFERDGQYQLYASNMQPDGVGALHVAFEQLKEKLQQEGL 123

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCR-FPLRVIIFPVKVQGDECPKEIA 191
           F  + K  IP +P  I ++TS TGAVIRDI+     R   ++++++PV VQG +   +I+
Sbjct: 124 FDLEKKKSIPLLPGSIGIVTSSTGAVIRDIINVTYRRNSKMKLVLYPVAVQGPQAAGQIS 183

Query: 192 NAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHET 251
            AI +LN         + D+II+ARGGGS+E+LW FN+E++ R+I  S+IP+ISA+GHET
Sbjct: 184 EAIKRLNEHN------KVDVIIVARGGGSLEELWAFNEEIVARSIYASNIPVISAVGHET 237

Query: 252 DWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKY------KIN 305
           D+T++D+ +D+RAPTP+ AAE+AVP  E L   L +   R+ N +++ +        KIN
Sbjct: 238 DFTISDFVSDMRAPTPSAAAELAVPDIEVLLYKLESYNMRMKNSLVKKVTALQNQLQKIN 297

Query: 306 TLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHN 365
           +  S  +     +Q     R  +D L + L    + II  K   F  +  ++ +   +  
Sbjct: 298 SRPSFTQPYDRVNQ----QRQAIDNLVKNLVRENQAIIKDKKSQFGILAGKLDALSPLKI 353

Query: 366 IQKNRQHILEKQQHIEQIVKQ 386
           +++    +   Q H+   VKQ
Sbjct: 354 MERGYGVVKNSQGHVVNSVKQ 374


>gi|157144558|ref|YP_001451877.1| exodeoxyribonuclease VII large subunit [Citrobacter koseri ATCC
           BAA-895]
 gi|166232350|sp|A8AD78|EX7L_CITK8 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|157081763|gb|ABV11441.1| hypothetical protein CKO_00278 [Citrobacter koseri ATCC BAA-895]
          Length = 457

 Score =  242 bits (617), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 157/505 (31%), Positives = 253/505 (50%), Gaps = 65/505 (12%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
           ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   +++ +  
Sbjct: 10  FTVSRLNQTVRLLLEQEMGQVWISGEISNFTQ-PASGHWYFTLKDDTAQVRCAMFRNSNR 68

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
           ++ F P+ G + LV   IT +     YQIIIES+ P+G G L    E  K KL  EGLF 
Sbjct: 69  RVTFRPQHGQQVLVRANITLYEPRGDYQIIIESMQPAGEGLLQQKYELLKAKLQAEGLFD 128

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANA 193
            Q+K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ P +I  A
Sbjct: 129 QQYKQPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDAPGQIVRA 188

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I + N   E   C   D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA+GHETD 
Sbjct: 189 IERANARNE---C---DVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSAVGHETDV 242

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           T+AD+ ADLRAPTP+ AAE+   V  + Q                           LL+ 
Sbjct: 243 TIADFVADLRAPTPSAAAEI---VSRNQQ--------------------------ELLRQ 273

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           + ++ Q L  +              ++  +  + R F  + +R++        Q++ Q  
Sbjct: 274 IQSAQQRLGMA--------------MDYYLANRNRRFTQLFHRLQ--------QQHPQLR 311

Query: 374 LEKQQHIEQIVKQHLRYIFLEKKEKIA-----ILHMLREQT-KNRIFYLHTHIKKLITRI 427
           L +QQ + + ++Q + +    + ++ A     +L  L +Q  + RI+   T I++L  R+
Sbjct: 312 LARQQTMLERLRQRMNFALDNQLKRAASRQQRVLQRLNQQNPQPRIYRAQTRIQQLEYRL 371

Query: 428 EFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILI 487
              +  ++ +           L++ +  +TL RGY+    T+   + Q R +     +  
Sbjct: 372 AENVRARLSATRERFGNAVTHLEAVSPLSTLARGYSVTTATDGKVLKQTRQVKAGDVLTT 431

Query: 488 NFFDGQANAIVINKAPPKEQPTKKC 512
              DG   + V      K+   KK 
Sbjct: 432 RLSDGWVESEVKGVTTAKKTRRKKT 456


>gi|152971366|ref|YP_001336475.1| exodeoxyribonuclease VII large subunit [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|166232356|sp|A6TCC4|EX7L_KLEP7 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|150956215|gb|ABR78245.1| exodeoxyribonuclease VII large subunit [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
          Length = 463

 Score =  242 bits (617), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 157/504 (31%), Positives = 250/504 (49%), Gaps = 65/504 (12%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
           ++VS L+  ++ ++E  +  V + GEIS +    SSGH YF+LKD+++++   +++ +  
Sbjct: 10  FTVSRLNQTVRLLLEREMGQVWISGEISNF-SQPSSGHWYFTLKDDNAQVRCAMFRNSNR 68

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
           ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K +L  EGLF 
Sbjct: 69  RVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAQLTAEGLFE 128

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANA 193
            +HK  +P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ P +I  A
Sbjct: 129 QKHKQALPSPAHCVGVITSKTGAALHDILHVLRRRDPGLPVIIYPTSVQGDDAPGQIVRA 188

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N  +E   C   D++I+ RGGGS+EDLW FNDE + RAI  S IPI+SA+GHETD 
Sbjct: 189 IALANARQE---C---DVLIVGRGGGSLEDLWSFNDERVARAIFASQIPIVSAVGHETDV 242

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           T+AD+ ADLRAPTP+ AAE                      I+ R           LL+ 
Sbjct: 243 TIADFVADLRAPTPSAAAE----------------------IVSR-------NQQELLRQ 273

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           L +  Q               LE  ++  +  + R F  + +R++        Q++ Q  
Sbjct: 274 LQSGQQ--------------RLEMAMDYFLASRQRRFTQLFHRLQ--------QQHPQLR 311

Query: 374 LEKQQHIEQIVKQHLRYIF------LEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRI 427
           L +QQ   + ++Q +R          E+++K  +  +     + RI    + I++L  R+
Sbjct: 312 LARQQTALERLRQRMRIAVESQLKRAEQRQKRTVQRLNHYNPQPRIHRAQSRIQQLEYRL 371

Query: 428 EFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILI 487
             I+  ++             L++ +   TL RGY+    ++   + Q + + T   +  
Sbjct: 372 AEIMRGRLSERRERFGNAVTHLEAVSPLATLARGYSVTSVSDGTVLKQTKQVKTGDLLTT 431

Query: 488 NFFDGQANAIVINKAPPKEQPTKK 511
              DG   + V   AP K+   +K
Sbjct: 432 RLKDGWVESEVKQIAPVKKTRARK 455


>gi|110834713|ref|YP_693572.1| exodeoxyribonuclease VII large subunit [Alcanivorax borkumensis
           SK2]
 gi|122959393|sp|Q0VNE8|EX7L_ALCBS RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|110647824|emb|CAL17300.1| Exodeoxyribonuclease VII, large subunit [Alcanivorax borkumensis
           SK2]
          Length = 448

 Score =  242 bits (617), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 134/336 (39%), Positives = 198/336 (58%), Gaps = 14/336 (4%)

Query: 16  SVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNK 75
           S+S+L+   + ++ES+   + ++GE+S +    +SGH YFSLKD  ++I+  +++     
Sbjct: 11  SISQLNLDAQGLLESSFPLIWLQGELSNF-SRPASGHWYFSLKDTRAQINGAMFRNRNRL 69

Query: 76  IEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSD 135
           + F P+ G + LV  KIT +     +QI++E + P+G G L    +  K +L  EGLF+ 
Sbjct: 70  LNFAPQNGEQVLVRAKITLYVPRGNFQIVVEHMEPAGQGALKAQFDALKAQLQSEGLFAQ 129

Query: 136 QHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANAI 194
           +HK  +P  P  I VITSP+GA IRDILQ +  R P + V+I+P  VQG E P ++  A+
Sbjct: 130 EHKRTLPAWPNQIGVITSPSGAAIRDILQVLQRRCPSIPVLIYPAAVQGAEAPAQLRQAL 189

Query: 195 LQLNTLKEGRT-CPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
                L   R  C   D++IL RGGGS+EDLW FNDE + RA+AN  IPI+SA+GHE D 
Sbjct: 190 ----ALAVARNEC---DVLILGRGGGSLEDLWAFNDEGLARAVANCPIPIVSAVGHEVDT 242

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
            L D+AADLRAPTP+ AAE+  P    +   L  L  RL  ++ + ++     L  L + 
Sbjct: 243 GLTDFAADLRAPTPSAAAELVSPDLSIVSQRLAGLHRRLRWVMAQELRTVQERLRHLSQR 302

Query: 314 LPNSDQTLSCSRYRLD----RLPRELEHNLEIIIFR 345
           L +  Q L  S  RLD    RL R+++H L ++  R
Sbjct: 303 LRSPRQHLEQSSQRLDELQNRLQRQMQHRLTLLQGR 338


>gi|238895963|ref|YP_002920699.1| exodeoxyribonuclease VII large subunit [Klebsiella pneumoniae
           NTUH-K2044]
 gi|330007829|ref|ZP_08306087.1| exodeoxyribonuclease VII, large subunit [Klebsiella sp. MS 92-3]
 gi|238548281|dbj|BAH64632.1| exodeoxyribonuclease VII large subunit [Klebsiella pneumoniae
           subsp. pneumoniae NTUH-K2044]
 gi|328535317|gb|EGF61803.1| exodeoxyribonuclease VII, large subunit [Klebsiella sp. MS 92-3]
          Length = 463

 Score =  242 bits (617), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 157/504 (31%), Positives = 250/504 (49%), Gaps = 65/504 (12%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
           ++VS L+  ++ ++E  +  V + GEIS +    SSGH YF+LKD+++++   +++ +  
Sbjct: 10  FTVSRLNQTVRLLLEREMGQVWISGEISNF-SQPSSGHWYFTLKDDNAQVRCAMFRNSNR 68

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
           ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K +L  EGLF 
Sbjct: 69  RVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAQLTAEGLFE 128

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANA 193
            +HK  +P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ P +I  A
Sbjct: 129 QKHKQALPSPAHCVGVITSKTGAALHDILHVLRRRDPGLPVIIYPTAVQGDDAPGQIVRA 188

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N  +E   C   D++I+ RGGGS+EDLW FNDE + RAI  S IPI+SA+GHETD 
Sbjct: 189 IALANARQE---C---DVLIVGRGGGSLEDLWSFNDERVARAIFASQIPIVSAVGHETDV 242

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           T+AD+ ADLRAPTP+ AAE                      I+ R           LL+ 
Sbjct: 243 TIADFVADLRAPTPSAAAE----------------------IVSR-------NQQELLRQ 273

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           L +  Q               LE  ++  +  + R F  + +R++        Q++ Q  
Sbjct: 274 LQSGQQ--------------RLEMAMDYFLASRQRRFTQLFHRLQ--------QQHPQLR 311

Query: 374 LEKQQHIEQIVKQHLRYIF------LEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRI 427
           L +QQ   + ++Q +R          E+++K  +  +     + RI    + I++L  R+
Sbjct: 312 LARQQTALERLRQRMRIAVESQLKRAEQRQKRTVQRLNHYNPQPRIHRAQSRIQQLEYRL 371

Query: 428 EFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILI 487
             I+  ++             L++ +   TL RGY+    ++   + Q + + T   +  
Sbjct: 372 AEIMRGRLSERRERFGNAVTHLEAVSPLATLARGYSVTSVSDGTVLKQTKQVKTGDLLTT 431

Query: 488 NFFDGQANAIVINKAPPKEQPTKK 511
              DG   + V   AP K+   +K
Sbjct: 432 RLKDGWVESEVKQIAPVKKTRARK 455


>gi|255263778|ref|ZP_05343120.1| exodeoxyribonuclease VII, large subunit [Thalassiobium sp. R2A62]
 gi|255106113|gb|EET48787.1| exodeoxyribonuclease VII, large subunit [Thalassiobium sp. R2A62]
          Length = 424

 Score =  242 bits (617), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 137/371 (36%), Positives = 201/371 (54%), Gaps = 8/371 (2%)

Query: 99  SKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAV 158
           SK+ +  + L  +G G  +  LEKRKK L  EGLF +  K P+P++P II V+TS  G V
Sbjct: 8   SKFSLNAQRLSVAGEGAFMALLEKRKKMLAAEGLFDEGRKKPLPYLPDIIGVVTSTQGVV 67

Query: 159 IRDILQRISCRFPLRVIIFPVKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGG 218
           IRDIL R+  RFP +V+++PV VQG     ++A AI   N L  G   PRPD+II+ARGG
Sbjct: 68  IRDILHRLRDRFPRKVLVWPVAVQGQSSKDQVAAAIAGFNALTPGGALPRPDLIIVARGG 127

Query: 219 GSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVK 278
           GSIEDLW FN+E++ RA A S IP+ISA+GHETD TL D+ +D RAPTPT AAE+AVPV+
Sbjct: 128 GSIEDLWSFNEEVVARAAAASDIPLISAVGHETDTTLIDFVSDKRAPTPTAAAELAVPVR 187

Query: 279 EHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHN 338
             L + +   EARL   + + +  +   L  L +ALPN +  L+  R R D   + +   
Sbjct: 188 LDLLAWVSEQEARLKRALSQGVAQREQRLRDLARALPNLESLLANPRQRYDITSQRMTDA 247

Query: 339 LEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEK 398
           L      K +        ++   L +  Q  R+ +      + + +   L        ++
Sbjct: 248 LLRAAQLKRQKLTETSGALRPSVLTNRTQNERRRV----NDLGRQLAPSLARTLTRPTDR 303

Query: 399 IAILHMLREQTKNRIFYL---HTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYK 455
           ++ L   R  T+N    L      + +L  R      +++++    +    R+  S  YK
Sbjct: 304 LSNLAA-RLTTRNPSAQLDRQRADLDRLSQRFATRGQNQLETARQKLDALERVRNSVGYK 362

Query: 456 NTLKRGYTSIQ 466
            TLKRGY  ++
Sbjct: 363 QTLKRGYAVVR 373


>gi|302337858|ref|YP_003803064.1| exodeoxyribonuclease VII large subunit [Spirochaeta smaragdinae DSM
           11293]
 gi|301635043|gb|ADK80470.1| exodeoxyribonuclease VII, large subunit [Spirochaeta smaragdinae
           DSM 11293]
          Length = 407

 Score =  241 bits (616), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 123/268 (45%), Positives = 174/268 (64%), Gaps = 8/268 (2%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
           Y+VS L+  +K  +ES  S V V GEIS +R   ++GH YFSLKD  + I A++++G   
Sbjct: 11  YTVSGLTALIKERLESGFSSVAVEGEISNFR-PSAAGHWYFSLKDQDAVISAVMFRGKSA 69

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
           +++F PE+GI   + G ++ +     YQII ++++ SG G +L  LE+RK++L  EGLF 
Sbjct: 70  RVDFYPEDGITVKISGNLSVYEKRGNYQIICDTMVRSGEGAILAMLEERKRRLAAEGLFD 129

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANA 193
            + K PIP  P  +AVITSPTGA +RDILQ +  R   + + I P  VQGD   ++IA  
Sbjct: 130 LEKKKPIPPFPARVAVITSPTGAALRDILQVLGRRGAGVDITILPTLVQGDGAAEQIAAQ 189

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I + N    G      ++II+ RGGGS+EDL  F++E + RA+A S+IPIISA+GHETD 
Sbjct: 190 IRRANRYNMG------EVIIIGRGGGSLEDLLPFSEEAVARAVAESTIPIISAVGHETDT 243

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHL 281
            L+D AADLRAPTP+ AAE+    +E L
Sbjct: 244 ALSDLAADLRAPTPSAAAELVCEEREAL 271


>gi|116872792|ref|YP_849573.1| exodeoxyribonuclease VII large subunit [Listeria welshimeri serovar
           6b str. SLCC5334]
 gi|123466251|sp|A0AIG2|EX7L_LISW6 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|116741670|emb|CAK20794.1| exodeoxyribonuclease VII, large subunit [Listeria welshimeri
           serovar 6b str. SLCC5334]
          Length = 450

 Score =  241 bits (616), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 132/368 (35%), Positives = 214/368 (58%), Gaps = 10/368 (2%)

Query: 25  KHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNKIEFLPEEGI 84
           K  V+  +  V VRGEIS  +   +SGH YF++KD  + + +++++  + KI F+PE+G+
Sbjct: 19  KFDVDPYMKQVFVRGEISNLKQ-PASGHLYFTVKDEFAMLRSVMFQKAVQKIGFVPEDGM 77

Query: 85  EFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSDQHKNPIPFI 144
             L+ G+I  F  + +YQ   E + P G G L   LE+ K +L +EGLF++ HK  +P  
Sbjct: 78  NVLITGRIGVFTKAGRYQFYAEHMEPDGVGALYIQLEQLKTQLEKEGLFAETHKKVLPSF 137

Query: 145 PKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANAILQLNTLKEG 203
           P  +AV+TS TGA +RDIL  I  R P + VI++P  VQG++  ++I   I ++N   + 
Sbjct: 138 PSKVAVVTSKTGAAVRDILTTIHRRMPSVEVIVYPTIVQGEKSAQKIVENIGRINQRND- 196

Query: 204 RTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWTLADYAADLR 263
                 D++I+ RGGGS+E+LW FN+E +VRA+ +S +P+ISA+GHETD+ L+D++AD+R
Sbjct: 197 -----IDVMIIGRGGGSLEELWAFNEEPVVRAVYDSDVPVISAVGHETDFALSDFSADVR 251

Query: 264 APTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK--ALPNSDQTL 321
           A TPT AAE+AVP    L+  L   + RL  +  +L++ K  TL  L +   L      L
Sbjct: 252 AATPTAAAELAVPDYRDLEERLAERKYRLLTVTRQLLERKERTLEQLKQHLILNGPKHQL 311

Query: 322 SCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHILEKQQHIE 381
                R D     L++     +  K   FN + +R+        I+   + +  ++Q +E
Sbjct: 312 EQQIERTDYFSERLKNAFSKQVLLKQTMFNRLNDRLHYYHPRKEIELQNEQLAVRKQALE 371

Query: 382 QIVKQHLR 389
           + +K+ L+
Sbjct: 372 KAMKRQLK 379


>gi|28211244|ref|NP_782188.1| exodeoxyribonuclease VII large subunit [Clostridium tetani E88]
 gi|31563102|sp|Q894G7|EX7L_CLOTE RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|28203684|gb|AAO36125.1| exodeoxyribonuclease VII large subunit [Clostridium tetani E88]
          Length = 396

 Score =  241 bits (616), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 136/348 (39%), Positives = 207/348 (59%), Gaps = 32/348 (9%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           SV++++ ++K+ ++++  L++  +RGEIS ++ IHSSGH YFS+KD  S+I+ ++++   
Sbjct: 7   SVTDINNYIKNTMDNDFILNNASIRGEISNFK-IHSSGHVYFSMKDQWSKINCVMFRSAA 65

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             ++FLPE+G++ +  G+I+ +     YQ+  + L   G G L  A EK K KL +EGLF
Sbjct: 66  KGLKFLPEDGMKIIANGRISAYVKDGSYQLYCDKLELEGLGELYIAFEKLKNKLEKEGLF 125

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIAN 192
            ++ K  +P   K I VITS TGA IRDI+   + R     ++I+P  VQG     +I  
Sbjct: 126 KEECKKSLPQYAKKIGVITSETGAAIRDIINVATRRNKNCEILIYPSLVQGTNASSDIIK 185

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
            I +LN +K+       D+IILARGGGSIE+LW FNDE + R I  S +PII+ +GHETD
Sbjct: 186 GIKELNKVKD------LDVIILARGGGSIEELWVFNDEELAREIFKSKVPIITGVGHETD 239

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ +D RAPTP+ AAE+A+   + L S L N +  LN  ++  +K K N       
Sbjct: 240 FTIADFVSDKRAPTPSAAAEIAIKDLQELNSRLENYKNALNYYVLNNLKEKYN------- 292

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNL-EIIIFRKYRHFNHIINRIKS 359
                         +LDRL   +E N  E II  +Y   + IIN++ S
Sbjct: 293 --------------KLDRLKLSMEGNSPERIIINEYNKIDFIINKLNS 326


>gi|332981366|ref|YP_004462807.1| exodeoxyribonuclease VII, large subunit [Mahella australiensis 50-1
           BON]
 gi|332699044|gb|AEE95985.1| exodeoxyribonuclease VII, large subunit [Mahella australiensis 50-1
           BON]
          Length = 409

 Score =  241 bits (616), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 135/336 (40%), Positives = 205/336 (61%), Gaps = 16/336 (4%)

Query: 15  YSVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           +SVS+L+ ++K +  S+  L  V VRGEIS Y+ +HSSGH+YF+LKD +S+I  ++++  
Sbjct: 6   FSVSQLTAYIKGMFSSDPLLHSVYVRGEISNYK-LHSSGHSYFTLKDQNSKIRCVMFRQY 64

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
              I F  ++G++ LV G +  +    +YQ+  E + P G G+L  A E+ K KL ++GL
Sbjct: 65  GQPI-FAMQDGMDVLVQGYVNVYDRDGQYQLYAERIEPFGVGSLHLAFEQLKAKLEQDGL 123

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIA 191
           F   HK P+P  PK I V+TS TGA +RDI+     R+P + ++I PV VQG     +I+
Sbjct: 124 FDRAHKKPLPLFPKRIGVVTSDTGAAVRDIINVAHRRYPNIDLLIVPVAVQGKAAAIQIS 183

Query: 192 NAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHET 251
            AI  LN + E       D+II+ RGGGSIE+LW FN+E++ R+I  S IP++SA+GHET
Sbjct: 184 EAIDALNVMDES-----VDVIIVGRGGGSIEELWPFNEEIVARSIYRSHIPVVSAVGHET 238

Query: 252 DWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLL 311
           D+T++D+ AD+RAPTP+ AAE+ VP+K  L+  +  L       +  L++ +   L  L 
Sbjct: 239 DFTISDFVADMRAPTPSAAAELVVPLKTELEQRIAGLCLNAKRAVDMLVEEQRRCLYKLQ 298

Query: 312 KALPNSD--QTLSCSRYRLDRLPREL----EHNLEI 341
            +    D  Q L   + +LD+  R L     H +EI
Sbjct: 299 GSRIMRDPMQLLKDKQQQLDQAERYLLINMHHRMEI 334


>gi|220929323|ref|YP_002506232.1| exodeoxyribonuclease VII large subunit [Clostridium cellulolyticum
           H10]
 gi|254783696|sp|B8I3A9|EX7L_CLOCE RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|219999651|gb|ACL76252.1| exodeoxyribonuclease VII, large subunit [Clostridium cellulolyticum
           H10]
          Length = 404

 Score =  241 bits (616), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 139/381 (36%), Positives = 225/381 (59%), Gaps = 20/381 (5%)

Query: 15  YSVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           YSVS+++ ++K +V ++  LS V +RGEIS ++  H +GH YF++KD +S +  ++++  
Sbjct: 5   YSVSDINNYIKQLVSNDIILSDVSIRGEISNFKH-HYTGHMYFTIKDKNSLLKCVMFRSQ 63

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
              + F PE G++ +V G I+ F    +YQ+   S+ P G G L  A E+ K+KL  EGL
Sbjct: 64  AVSLRFSPENGMKVIVSGYISVFERDGQYQLYASSMQPDGVGALHIAFEQLKEKLQREGL 123

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCR-FPLRVIIFPVKVQGDECPKEIA 191
           F  ++K  IP +P  I V+TS TGAVIRDI+     R   ++++++PV VQG +   +IA
Sbjct: 124 FDPENKKKIPVLPGSIGVVTSSTGAVIRDIINVTYRRNSKMKLVLYPVAVQGQQAAGQIA 183

Query: 192 NAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHET 251
            AI  LN         + D+II+ARGGGS+E+LW FN+E++ R+I  S+IP+ISA+GHET
Sbjct: 184 EAIKCLNEQN------KVDVIIVARGGGSLEELWAFNEEIVARSIYASNIPVISAVGHET 237

Query: 252 DWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLL 311
           D+T+ D+ +D+RAPTP+ AAE+AVP  E L   L +   R+ + + +    K+ TL + L
Sbjct: 238 DFTICDFVSDMRAPTPSAAAELAVPDMEVLLYKLESYNMRMKSSLAK----KVTTLKNQL 293

Query: 312 KAL---PNSDQT---LSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHN 365
           + L   P   Q    ++  R  LD L + +    + II  K   F  +  ++ +   +  
Sbjct: 294 QKLNARPFFAQPYDRVNQQRQTLDNLTKSMVRENQTIIKDKKSQFGMLAGKLDALSPLKI 353

Query: 366 IQKNRQHILEKQQHIEQIVKQ 386
           +++    +   Q ++   VKQ
Sbjct: 354 LERGYSLVKNPQGYVVNNVKQ 374


>gi|226940029|ref|YP_002795102.1| exodeoxyribonuclease VII large subunit [Laribacter hongkongensis
           HLHK9]
 gi|226714955|gb|ACO74093.1| XseA [Laribacter hongkongensis HLHK9]
          Length = 568

 Score =  241 bits (615), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 152/493 (30%), Positives = 255/493 (51%), Gaps = 61/493 (12%)

Query: 16  SVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNK 75
           SVSEL+   + ++E+ +  V + GEIS    + +SGHAYFSLKD  ++I A++++  L++
Sbjct: 130 SVSELNRIARELLETAIPPVWISGEISNL-TLAASGHAYFSLKDERAQIRAVMFRNRLSQ 188

Query: 76  IEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSD 135
           + F P+EG+   V G ++ +     YQI +  +  +G G L  A E  K +L  EGLF +
Sbjct: 189 LGFRPKEGLRVEVRGTVSLYEARGDYQINVSQMQEAGLGALYAAFEALKTRLAAEGLFDN 248

Query: 136 QHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANAI 194
           Q K P+P  PK+I ++TS   A +RD+L  +  R P + V+++P +VQGD  P +I  AI
Sbjct: 249 QLKRPLPAHPKVIGIVTSLQAAALRDVLTTLRRRAPQIPVVLYPTQVQGDTAPAQILAAI 308

Query: 195 LQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWT 254
              +  ++       D++I+ RGGGSIEDLW FNDE + RAI    +P+IS +GHETD+T
Sbjct: 309 EAASRRQDA------DVLIVCRGGGSIEDLWAFNDEQVARAIRACRLPVISGVGHETDFT 362

Query: 255 LADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKAL 314
           +AD+AAD+RAPTPT AAE+  P ++ L + L  L+ RL     R + ++++  +      
Sbjct: 363 IADFAADVRAPTPTAAAELVSPDRDALLARLAELDFRLG----RAMHHRLDRASQ----- 413

Query: 315 PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHIL 374
                       +LDRL   L H  E I  ++ R         ++++ +H     RQ + 
Sbjct: 414 ------------QLDRLALRLTHPGERIARQRERL-------AQAEYRLHQHWARRQEL- 453

Query: 375 EKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQ-TKNRIFYLHTHIKKLITRIEFILSH 433
                        LR + L+ +       +LR + ++ R   L    ++ + R    +S 
Sbjct: 454 -----------ARLRVVHLQTR-------LLRARPSQERQQALLASNRQQLAR---AIST 492

Query: 434 KIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDGQ 493
           +++  H  ++  +  L +   +  L RGY  +++     +     LA   R+ +    G 
Sbjct: 493 QLERQHHRLAALSARLDALDPQAVLARGYAIVENARGQAVLDPAALAQNERVTLRLALGN 552

Query: 494 ANAIVINKAPPKE 506
             A +    PP++
Sbjct: 553 TGARI--DRPPQQ 563


>gi|309389166|gb|ADO77046.1| exodeoxyribonuclease VII, large subunit [Halanaerobium praevalens
           DSM 2228]
          Length = 419

 Score =  241 bits (615), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 139/346 (40%), Positives = 205/346 (59%), Gaps = 19/346 (5%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKD 59
           N FS+K   D   YSV+E++ +LK++++ +  L+   + GEIS +   HSSGH Y +LKD
Sbjct: 8   NLFSEK---DKKIYSVAEITKYLKNLIKEDPFLNDFWLSGEISNFYH-HSSGHMYLTLKD 63

Query: 60  NHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTA 119
            +S++  +++KG  +K++F PE+G++    G +  +    +YQ     +  +G G L   
Sbjct: 64  KNSQLKTVMFKGDNSKLDFEPEDGMQVEAKGNLDIYSQRGEYQFYARQMKKAGKGKLYEK 123

Query: 120 LEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDIL---QRISCRFPLRVII 176
            +K K +L +EGLF+   K  IPF+   I ++TSPTGA +RDIL   +R S  F   V+I
Sbjct: 124 YQKLKSELEKEGLFAVSKKQEIPFLANKIGIVTSPTGAAVRDILSVMKRRSSNFS--VLI 181

Query: 177 FPVKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAI 236
            P  VQG     EI+  I  LN+  +       D+II++RGGGSIEDLW FN+E + RAI
Sbjct: 182 VPAHVQGKLAQAEISAGIRYLNSRND------IDLIIVSRGGGSIEDLWPFNEEKVARAI 235

Query: 237 ANSSIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNII 296
            NS +P+IS +GHETD+T+AD+ ADLRAPTP+ AAE+A   +E + + L NL  RL N  
Sbjct: 236 YNSKLPVISGVGHETDFTIADFVADLRAPTPSAAAELATANREEVLTRLDNLTKRLLNSS 295

Query: 297 IRLIKYKINTLNSL--LKALPNSDQTLSCSRYRLDRLPRELEHNLE 340
           +  IK   N LNS+   K   +  +        LD L  +L H +E
Sbjct: 296 LTKIKESKNKLNSIEARKIFSSPAELFRDYEQELDNLETQLVHQIE 341


>gi|194334664|ref|YP_002016524.1| exodeoxyribonuclease VII large subunit [Prosthecochloris aestuarii
           DSM 271]
 gi|194312482|gb|ACF46877.1| exodeoxyribonuclease VII, large subunit [Prosthecochloris aestuarii
           DSM 271]
          Length = 411

 Score =  241 bits (615), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 150/407 (36%), Positives = 233/407 (57%), Gaps = 32/407 (7%)

Query: 16  SVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNK 75
           SVSEL+ ++K+ +ES    V VRGEIS +R + +SGH Y +LKD  ++I A+IWK    +
Sbjct: 6   SVSELTLNIKNRLESAFPTVTVRGEISNFR-LPASGHIYMTLKDEDAQIPAVIWKNVRLR 64

Query: 76  IEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSD 135
           +     +G+E +  G++  +P S +YQ+I  SL  +G G L  A     +KL   G F+ 
Sbjct: 65  LPAELRDGMEIIAAGRLEVYPPSGRYQLICTSLTLAGEGMLQQAFAMLLQKLAAAGYFNV 124

Query: 136 QHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANAI 194
           +HK P+P  P+ IA++TSPTGAVI+D+   +S RFP   ++++PVKVQG+     I +A+
Sbjct: 125 EHKKPLPAYPETIALVTSPTGAVIKDMGDVLSRRFPAASLLLYPVKVQGEGAVNNIIDAL 184

Query: 195 LQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWT 254
              NT    +   RPD+II+ARGGGS+EDL  FN+E +  AI +SSIP+ISA+GHETD+T
Sbjct: 185 EYFNTTTVDQH--RPDLIIVARGGGSLEDLQAFNEERVAMAIFHSSIPVISAVGHETDFT 242

Query: 255 LADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKAL 314
           +AD  AD+RA TP+ AAE+AVP KE L   +  L  R           ++++LN+ +   
Sbjct: 243 IADMVADVRAGTPSIAAEIAVPDKEELLQKINTLAQR-----------QLSSLNTRIDGA 291

Query: 315 PNSDQTLSCSRYRLDR---LPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQ 371
                +L+ S Y  +R   L ++L+  +  II    R     I  I+  F   +  + R 
Sbjct: 292 EREIDSLTGS-YAFNRPKVLCKQLDAEITTIIGFMSRSLKGRIEHIEQRF---SAAEGRL 347

Query: 372 HILEKQQHIEQ---IVKQHLRYIFLEKKEKIAILHMLREQTKNRIFY 415
            +L+ +  + +   ++K    YI   +        M R++  + +FY
Sbjct: 348 SLLDYRNVLRRGFALIKTESGYITTSR-------DMARKKRASAVFY 387


>gi|313884670|ref|ZP_07818426.1| exodeoxyribonuclease VII, large subunit [Eremococcus coleocola
           ACS-139-V-Col8]
 gi|312620038|gb|EFR31471.1| exodeoxyribonuclease VII, large subunit [Eremococcus coleocola
           ACS-139-V-Col8]
          Length = 465

 Score =  241 bits (614), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 138/369 (37%), Positives = 211/369 (57%), Gaps = 17/369 (4%)

Query: 7   KNSLDHPEY-SVSELSYHLKH--IVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSR 63
           K  LD  ++ +VS L+ +LK   + +  L  V + GE+S +R +  +GH YF LKD+ + 
Sbjct: 4   KQKLDSQKFLTVSALTAYLKQKFVRDPYLQEVYLVGEVSNFR-LRPNGHQYFRLKDDRAT 62

Query: 64  IDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKR 123
           I  +++K    K+ F  EEG++  V G ++ +  S  YQ+ +E + P G G L  ALE+ 
Sbjct: 63  ISVVMYKSQFAKVPFKLEEGMKVFVKGYVSLYESSGSYQMYLEDIQPDGVGALYQALEQL 122

Query: 124 KKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQ 182
           K++  + GLF +Q + PI   P+ IAVITSP+GAVIRDI+  I  R+P+  V++FP +VQ
Sbjct: 123 KEEFRKSGLF-EQRQGPIKRFPERIAVITSPSGAVIRDIITTIKRRYPIVDVVVFPSRVQ 181

Query: 183 GDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIP 242
           G E   EI  A   +      +     D IILARGGGSIEDLW FN++++  AI  S +P
Sbjct: 182 GKEAAGEIVAAFEAIR-----QQAQDFDTIILARGGGSIEDLWPFNEKVVAHAILASPLP 236

Query: 243 IISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKY 302
           +IS++GHETD T+AD  ADLRAPTPT AAE+AVPV   +   L   + RL   +   I+ 
Sbjct: 237 VISSVGHETDTTIADLVADLRAPTPTAAAELAVPVLNEVLMRLDEQQLRLGQAMTMAIQG 296

Query: 303 KINTLNSLLKA--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           + + L  +  +      D+        LD L + L+  ++ ++ +  + F      I+  
Sbjct: 297 RQDYLKRITDSYIFKQPDRLYQAYSQNLDLLDQSLQVTMQTVLNKADQAFQKTSQAIQ-- 354

Query: 361 FLIHNIQKN 369
             I N+Q++
Sbjct: 355 --IKNLQQS 361


>gi|310642664|ref|YP_003947422.1| exodeoxyribonuclease 7 large subunit [Paenibacillus polymyxa SC2]
 gi|309247614|gb|ADO57181.1| Exodeoxyribonuclease 7 large subunit [Paenibacillus polymyxa SC2]
          Length = 455

 Score =  241 bits (614), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 123/285 (43%), Positives = 179/285 (62%), Gaps = 10/285 (3%)

Query: 15  YSVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           YS+ +L+ +++  +ES+  LS V +RGEIS +   HSSGH YF+LKD  SRI +I++   
Sbjct: 8   YSIKDLNRYIRMKLESDQVLSDVWIRGEISNFTH-HSSGHMYFTLKDEGSRIRSIMFATH 66

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
             ++ F+P+EG   +  G ++ +    +YQ     + P G G+L  A E+ K+KL  EGL
Sbjct: 67  NRRLPFVPKEGTRVIARGNVSVYERDGQYQFYATQMQPDGIGSLYLAYEQLKQKLDAEGL 126

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIA 191
           F    K  +P  P  I VITSPTGA +RDI+  +  R+P   ++++PV VQG      I 
Sbjct: 127 FDTARKRNLPAHPATIGVITSPTGAAVRDIITTLQRRYPQAGIVLYPVLVQGKGAAPSIV 186

Query: 192 NAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHET 251
            AI  +N ++E        ++I+ RGGGS+E+LW FN+E + RAI  S IP+ISA+GHET
Sbjct: 187 KAIEAMNRMQE------VQVMIVGRGGGSLEELWAFNEEAVARAIYASVIPVISAVGHET 240

Query: 252 DWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNII 296
           D+T+AD+ ADLRA TPT AAE+AVP +  L+  L+  E RL N +
Sbjct: 241 DFTIADFVADLRAATPTAAAELAVPHQGELRDQLLQREQRLRNAL 285


>gi|322392011|ref|ZP_08065474.1| exodeoxyribonuclease VII large subunit [Streptococcus peroris ATCC
           700780]
 gi|321145109|gb|EFX40507.1| exodeoxyribonuclease VII large subunit [Streptococcus peroris ATCC
           700780]
          Length = 317

 Score =  241 bits (614), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 130/285 (45%), Positives = 178/285 (62%), Gaps = 12/285 (4%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           SV+ L+ +LK   + +  L  V + G++S +R      H YFSLKD+ + I A IW G  
Sbjct: 31  SVTTLTKYLKMKFDKDPYLERVYLTGQVSNFR--KRPTHQYFSLKDDRAVIQATIWSGIY 88

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            K+ F  EEG++  V+G++  +  S  Y IIIE   P G G L    E+ KKKL EEGLF
Sbjct: 89  QKLGFDLEEGMKVNVVGRVQVYEPSGSYSIIIEKAEPDGVGALAIQFEQLKKKLSEEGLF 148

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIAN 192
            D+ K  IP   K I V+TS +GAVI+DI+  +  RFP + +I++P KVQGD   +EIA 
Sbjct: 149 QDRFKQAIPQFSKRIGVVTSRSGAVIQDIITTVGRRFPGVEIILYPTKVQGDGAAEEIAR 208

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
            I + N  ++       D++I+ RGGGSIEDLW FN+E++VRAI  S +P+IS++GHETD
Sbjct: 209 NIARANERED------LDVLIIGRGGGSIEDLWAFNEEIVVRAIFESRLPVISSVGHETD 262

Query: 253 WTLADYAADLRAPTPTGAAEMAVPV-KEHLQSSLINLEARLNNII 296
            TLAD+ AD RA TPT AAE+A PV K  L + L N E R+   +
Sbjct: 263 VTLADFVADKRAATPTAAAELATPVSKFDLLTYLKNQEKRMATAV 307


>gi|221310353|ref|ZP_03592200.1| exodeoxyribonuclease VII large subunit [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221319600|ref|ZP_03600894.1| exodeoxyribonuclease VII large subunit [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221323876|ref|ZP_03605170.1| exodeoxyribonuclease VII large subunit [Bacillus subtilis subsp.
           subtilis str. SMY]
          Length = 448

 Score =  240 bits (613), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 132/350 (37%), Positives = 206/350 (58%), Gaps = 14/350 (4%)

Query: 16  SVSELSYHLKHI--VESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +VS L+ ++K    V+ +L ++ ++GE+S  + IH+ GH YF+LK+   R+ ++++    
Sbjct: 8   TVSALTKYIKRKFDVDPHLENIWIKGELSNVK-IHTRGHIYFTLKERKGRMQSVMFARQS 66

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            ++ F PE G++ LV G I+ +  S  YQ+  + + P G G L  A E+ KKKL  EGLF
Sbjct: 67  ERLPFKPENGMKVLVRGGISVYEPSGNYQLYAKEMQPDGVGALYLAYEELKKKLAGEGLF 126

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
            D++K  IP  P  I V+TSPTGA +RD++  +  R+PL +VI+ P  VQG+   + I  
Sbjct: 127 DDRYKKQIPAFPATIGVVTSPTGAAVRDVITTLKRRYPLVKVIVLPALVQGENASRSIVT 186

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
            I + N   E   C   D++I+ RGGGSIE+LW FN+E++ RAI  S+IPIISA+GHETD
Sbjct: 187 RIEEAN---EKEIC---DVLIVGRGGGSIEELWAFNEEIVARAIFASNIPIISAVGHETD 240

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI---KYKINTLNS 309
           +T++D+ AD+RA TPTGAAE+AVP    L       E R+   + + +   K +I TL S
Sbjct: 241 FTISDFVADIRAATPTGAAEIAVPHTTDLIERTKTAEVRMTRAMQQHLGQKKERIQTLQS 300

Query: 310 LLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
              A     +  +    + D   ++ +  L  ++ RK R       R+++
Sbjct: 301 SY-AFRFPKRLYAQKEQQFDLAYQQFQAQLTALLDRKSRQLERETYRLEA 349


>gi|323488927|ref|ZP_08094164.1| exodeoxyribonuclease 7 large subunit [Planococcus donghaensis
           MPA1U2]
 gi|323397319|gb|EGA90128.1| exodeoxyribonuclease 7 large subunit [Planococcus donghaensis
           MPA1U2]
          Length = 453

 Score =  240 bits (613), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 134/382 (35%), Positives = 219/382 (57%), Gaps = 13/382 (3%)

Query: 13  PEYSVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           P  SV  L+ ++K   +++  L  V V+GE+S  + IH+SGH YF+LKDN +R+  +++ 
Sbjct: 5   PYLSVKALTKYIKKKFDADPHLRDVYVKGELSNVK-IHTSGHIYFTLKDNSARLPGVMFS 63

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
            +   ++F PE G+  L+ G +T +  S +YQ+  +S+   G G    A E+ K+KL +E
Sbjct: 64  ASAKSVKFKPESGMTVLIRGDVTVYEASGQYQLYAQSMQVDGIGDYYLAFEQLKEKLAKE 123

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKE 189
           G+F   HK  +P  PK IAV+T+ TGA +RDI+  +  R+PL  V+++P  VQG    + 
Sbjct: 124 GVFDASHKKRLPRFPKRIAVVTAQTGAAVRDIIITLHRRYPLANVVLYPALVQGSGAVQS 183

Query: 190 IANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGH 249
           I  +I   N           D++I+ RGGGSIEDLW FN+E + RAI +S IPIISAIGH
Sbjct: 184 IVQSIQAANK-------DDFDVLIVGRGGGSIEDLWAFNEEAVARAIFSSEIPIISAIGH 236

Query: 250 ETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNS 309
           ETD T+AD+ +DLRAPTPT AAE+AVP +  L   + +  +++   +   +  +   L+ 
Sbjct: 237 ETDTTIADFVSDLRAPTPTAAAELAVPSQAELLERISSYRSQMYRNVSSAVSQQKQALHR 296

Query: 310 LLKALPNS--DQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQ 367
           L  + P +  ++       R++R    L+      + R   ++  +  R+KS   +  I+
Sbjct: 297 LTSSYPLAYPERLYRPFIERVERATDSLQRESLQHLNRSKEYYRTLDQRLKSRMPLQQIR 356

Query: 368 KNRQHILEKQQHIEQIVKQHLR 389
           ++   + E  + ++  +KQ L+
Sbjct: 357 QSETDVTELARRLDYQIKQLLK 378


>gi|262040241|ref|ZP_06013492.1| exodeoxyribonuclease 7 large subunit [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259042350|gb|EEW43370.1| exodeoxyribonuclease 7 large subunit [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 463

 Score =  240 bits (613), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 156/499 (31%), Positives = 248/499 (49%), Gaps = 65/499 (13%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
           ++VS L+  ++ ++E  +  V + GEIS +    SSGH YF+LKD+++++   +++ +  
Sbjct: 10  FTVSRLNQTVRLLLEREMGQVWISGEISNF-SQPSSGHWYFTLKDDNAQVRCAMFRNSNR 68

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
           ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K +L  EGLF 
Sbjct: 69  RVTFHPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAQLTAEGLFE 128

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANA 193
            +HK  +P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ P +I  A
Sbjct: 129 QKHKQALPSPAHCVGVITSKTGAALHDILHVLRRRDPGLPVIIYPTAVQGDDAPGQIVRA 188

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N  +E   C   D++I+ RGGGS+EDLW FNDE + RAI  S IPI+SA+GHETD 
Sbjct: 189 IALANARQE---C---DVLIVGRGGGSLEDLWSFNDERVARAIFASQIPIVSAVGHETDV 242

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           T+AD+ ADLRAPTP+ AAE                      I+ R           LL+ 
Sbjct: 243 TIADFVADLRAPTPSAAAE----------------------IVSR-------NQQELLRQ 273

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           L +  Q               LE  ++  +  + R F  + +R++        Q++ Q  
Sbjct: 274 LQSGQQ--------------RLEMAMDYFLASRQRRFTQLFHRLQ--------QQHPQLR 311

Query: 374 LEKQQHIEQIVKQHLRYIF------LEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRI 427
           L +QQ   + ++Q +R          E+++K  +  +     + RI    + I++L  R+
Sbjct: 312 LARQQTALERLRQRMRIAVESQLKRAEQRQKRTVQRLNHYNPQPRIHRAQSRIQQLEYRL 371

Query: 428 EFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILI 487
             I+  ++             L++ +   TL RGY+    ++   + Q + + T   +  
Sbjct: 372 AEIMRGRLSERRERFGNAVTHLEAVSPLATLARGYSVTSVSDGTVLKQTKQVKTGDLLTT 431

Query: 488 NFFDGQANAIVINKAPPKE 506
              DG   + V   AP K+
Sbjct: 432 RLKDGWVESEVKQIAPVKK 450


>gi|251796320|ref|YP_003011051.1| exodeoxyribonuclease VII large subunit [Paenibacillus sp. JDR-2]
 gi|247543946|gb|ACT00965.1| exodeoxyribonuclease VII, large subunit [Paenibacillus sp. JDR-2]
          Length = 457

 Score =  240 bits (613), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 121/270 (44%), Positives = 174/270 (64%), Gaps = 11/270 (4%)

Query: 11  DHPE-YSVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           D P  YS+ +++ +++  +ES+  LS V +RGEIS +   HSSGH YF+LKD  SR+  I
Sbjct: 3   DQPRIYSIKDINRYIRMKLESDVLLSDVWLRGEISNFTH-HSSGHMYFTLKDKDSRLKCI 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           ++     ++ F+P EG + +  G ++ +     YQ  + ++ P G G+L  A E+ K KL
Sbjct: 62  MFASHNQRLPFIPREGTKVMARGNVSVYERDGNYQFYVTAMQPDGIGSLYLAYEQLKSKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF++  K PIP  P+ I VITSPTGA +RDI+  +  R P + + +FPV VQG + 
Sbjct: 122 ETEGLFAESRKRPIPRFPRAIGVITSPTGAAVRDIITTLQRRHPSIPIYVFPVLVQGTQA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
              I  AI  +N   E       D++I+ RGGGS+E+LW FN+E + R+IA S IP+ISA
Sbjct: 182 APSIVKAIESMNRFGE------VDVLIVGRGGGSLEELWAFNEEPVARSIAASQIPVISA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVP 276
           +GHETD+T+AD+ ADLRA TPT AAE+AVP
Sbjct: 236 VGHETDFTIADFVADLRAATPTAAAELAVP 265


>gi|126668435|ref|ZP_01739392.1| exodeoxyribonuclease VII, large subunit [Marinobacter sp. ELB17]
 gi|126627144|gb|EAZ97784.1| exodeoxyribonuclease VII, large subunit [Marinobacter sp. ELB17]
          Length = 449

 Score =  240 bits (613), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 141/377 (37%), Positives = 204/377 (54%), Gaps = 12/377 (3%)

Query: 16  SVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNK 75
           SVSEL++  +H++E++   V V GE+SG+    SSGH YFSLKD + +I   +++G   +
Sbjct: 14  SVSELNHQARHLLETSFMQVWVEGELSGF-SRPSSGHWYFSLKDRNCQIRCAMFRGANQR 72

Query: 76  IEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSD 135
           +   P+EG    + GK+T +     +QII+E L P+G+G L  A E  K KL  EGLFS 
Sbjct: 73  VRPAPKEGELVRIRGKVTLYENRGDFQIIVEHLEPAGAGALQQAFEALKLKLFNEGLFST 132

Query: 136 QHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANAI 194
           + K PIP +P+ I V+TSPTGA I DIL  ++ R P + V ++P  VQG     +I  AI
Sbjct: 133 ERKKPIPALPRHIGVVTSPTGAAIHDILTVLARRCPGIPVTLYPTAVQGQAATADIVAAI 192

Query: 195 LQLNTLKEGRTCP--RPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
                   GR     R D++I+ RGGGS+EDLW FN+E + RAIA   I  +SA+GHE D
Sbjct: 193 --------GRAVAHNRADVLIIGRGGGSLEDLWCFNEEAVARAIAACPIATVSAVGHEVD 244

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            T+ADY ADLRAPTP+ AAE   P +      L  +  RL   + R      N L  L  
Sbjct: 245 TTIADYVADLRAPTPSAAAEKISPDQSIWLRQLQAISERLQAAMGRQHTALENRLLQLST 304

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
            L +  ++L     RLD L   L   +  +  R +   +H+  R+        +    + 
Sbjct: 305 RLKDPRRSLQEKAQRLDGLDLRLSRAMAQLTQRLHMRTDHLQQRLAMQSPNRQLASAGER 364

Query: 373 ILEKQQHIEQIVKQHLR 389
           +L     +   ++Q L+
Sbjct: 365 VLRATTGLNLAIQQALK 381


>gi|76789053|ref|YP_328139.1| exodeoxyribonuclease VII large subunit [Chlamydia trachomatis
           A/HAR-13]
 gi|237802752|ref|YP_002887946.1| exodeoxyribonuclease VII large subunit [Chlamydia trachomatis
           B/Jali20/OT]
 gi|237804674|ref|YP_002888828.1| exodeoxyribonuclease VII large subunit [Chlamydia trachomatis
           B/TZ1A828/OT]
 gi|255348691|ref|ZP_05380698.1| exodeoxyribonuclease VII large subunit [Chlamydia trachomatis 70]
 gi|255503231|ref|ZP_05381621.1| exodeoxyribonuclease VII large subunit [Chlamydia trachomatis 70s]
 gi|123772407|sp|Q3KM31|EX7L_CHLTA RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|76167583|gb|AAX50591.1| exodeoxyribonuclease VII large subunit [Chlamydia trachomatis
           A/HAR-13]
 gi|231272974|emb|CAX09886.1| exodeoxyribonuclease VII large subunit [Chlamydia trachomatis
           B/TZ1A828/OT]
 gi|231273986|emb|CAX10779.1| exodeoxyribonuclease VII large subunit [Chlamydia trachomatis
           B/Jali20/OT]
 gi|296435846|gb|ADH18020.1| exodeoxyribonuclease VII large subunit [Chlamydia trachomatis
           G/9768]
 gi|296437706|gb|ADH19867.1| exodeoxyribonuclease VII large subunit [Chlamydia trachomatis
           G/11074]
 gi|297140205|gb|ADH96963.1| exodeoxyribonuclease VII large subunit [Chlamydia trachomatis
           G/9301]
          Length = 516

 Score =  240 bits (613), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 171/521 (32%), Positives = 265/521 (50%), Gaps = 56/521 (10%)

Query: 9   SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAII 68
           S+  P   VS L+  +K+++E N   V V+GE+S    + +SGH YF++KD+ + ++   
Sbjct: 2   SITSPPIEVSVLTDSIKNLLEKNFLRVVVKGELSNV-SLQTSGHLYFAIKDSKAVLNGAF 60

Query: 69  WKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLL 128
           +       +  P++G   ++ GK+T +    +YQI+  +L  SG G LL   E+RK++L 
Sbjct: 61  FHFRSKYFDRKPKDGDYVILHGKLTVYAPRGQYQIVAYALTFSGEGNLLQQFEERKQRLA 120

Query: 129 EEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRF-PLRVIIFPVKVQGDECP 187
            EG F  + K P+P   ++I VITSPTGAVI+DIL+ +S R    +VI++PV VQG    
Sbjct: 121 AEGYFDPKRKKPLPSGARVIGVITSPTGAVIQDILRVLSRRCHQFQVILYPVTVQGATAA 180

Query: 188 KEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAI 247
           +EI+ AI   N    G        +I+ARGGGSIEDLW FN+E +V++I  SSIPIISA+
Sbjct: 181 QEISQAIQFFNQNSMG-----VHALIIARGGGSIEDLWAFNEEELVKSIVASSIPIISAV 235

Query: 248 GHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTL 307
           GHETD+TL D+A+D+RAPTP+ AAE+     +  +  L NL   +++   + I  K N L
Sbjct: 236 GHETDFTLCDFASDVRAPTPSAAAEIVCKSSDQYRQELQNLRRYVSSHARQFIAAKKNLL 295

Query: 308 NSLLKALPNSD------QTLSCSRYRLDR-LPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
               + L + D      QTL  +R  L+R +  +LE+  +   F +YR +      +KSD
Sbjct: 296 THWQRHLASVDFYHTAQQTLDYTRAALERGIETKLEYYKQ--RFAQYRRW------LKSD 347

Query: 361 FLIHNIQKN------------RQHILEKQQHIEQIV--------------KQHLRYIFLE 394
            LI  I+K+            +  I  K+  + Q+                QH R I  +
Sbjct: 348 VLIR-IEKHLADLNQSLMLSIKNKIYTKKTSLNQLYTSCLKNELLNLQHRTQHSRNILSQ 406

Query: 395 KKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAY 454
              ++ I     +QT          + +L   + F + H +               S   
Sbjct: 407 LSRRLHIAIASSQQTHQEC------LVRLQNELSFTIQHLLTKAKERCQAIQEQASSLNP 460

Query: 455 KNTLKRGYTSIQDTNNNF-ITQKRNLATKTRILINFFDGQA 494
           KN LKRG+  + D N +F I    +L     + +   DG+A
Sbjct: 461 KNVLKRGFAQLFDFNKHFVIISAESLKQSDLVRVCLQDGEA 501


>gi|300717943|ref|YP_003742746.1| exodeoxyribonuclease VII large subunit [Erwinia billingiae Eb661]
 gi|299063779|emb|CAX60899.1| Exodeoxyribonuclease VII large subunit [Erwinia billingiae Eb661]
          Length = 459

 Score =  240 bits (613), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 149/496 (30%), Positives = 247/496 (49%), Gaps = 57/496 (11%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
           ++VS L+  ++ ++E  +  V +  EIS +    SSGH YF+LKD+ +++   +++ +  
Sbjct: 10  FTVSRLNTTVRKLLEMEMGQVWLSAEISNF-SQPSSGHWYFTLKDDGAQVRCAMFRNSNR 68

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
           ++ F P+ G + LV   IT +     YQ+I ES+ P+G G L    E+ K+KL+ EGLF 
Sbjct: 69  RVTFRPQNGQQVLVRATITLYEPRGDYQLIAESMQPAGEGLLQQQFEQLKQKLMSEGLFE 128

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANA 193
             HK P+P   + + VITS TGA + D+L+ +  R P L V+I+P  VQG + P  I  A
Sbjct: 129 QSHKQPLPDPARQVGVITSSTGAALHDVLRVLHRRDPSLPVVIYPTPVQGVDAPASIVRA 188

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N   E   C   D++I+ RGGGS+EDLW FNDE + RAI  S IPI+SA+GHETD 
Sbjct: 189 IETANARAE---C---DVLIVGRGGGSLEDLWSFNDERVARAIYASRIPIVSAVGHETDV 242

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           T+AD+ ADLRAPTP+ AAE+                         + + +I  L  L   
Sbjct: 243 TIADFVADLRAPTPSAAAEL-------------------------VSRNQIELLRQL--- 274

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
              S QT              LE  ++  + +K R F  I +R++       + + +  +
Sbjct: 275 --QSQQT-------------RLEMAMDYYLAQKSRTFTRIQHRLQQQHPQLRLARQQTAL 319

Query: 374 LEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSH 433
           +  Q+ ++  ++  +R    +++     L   + Q   RI     ++++   R++  +  
Sbjct: 320 MRLQRRLDDAMQLRVRQAGRQQERAKQRLSAFQPQA--RIHRAQQNLQQWQYRLQQAMQQ 377

Query: 434 KIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLAT----KTRILINF 489
           ++       S  T  L+  +   TL RG++     +   + + R + T    KTR+   +
Sbjct: 378 QLNGGKQRFSTLTAQLEGVSPLATLARGFSVTTAQDGQVVKKTRQVQTGDTLKTRLDDGW 437

Query: 490 FDGQANAIVINKAPPK 505
            + +  A+   K P K
Sbjct: 438 VESEVTAVTPTKKPRK 453


>gi|145219220|ref|YP_001129929.1| exodeoxyribonuclease VII large subunit [Prosthecochloris
           vibrioformis DSM 265]
 gi|145205384|gb|ABP36427.1| Exodeoxyribonuclease VII large subunit [Chlorobium phaeovibrioides
           DSM 265]
          Length = 402

 Score =  240 bits (613), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 138/333 (41%), Positives = 195/333 (58%), Gaps = 23/333 (6%)

Query: 16  SVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNK 75
           SVSEL+  +K  +E     + V+GEIS ++  HSSGH Y +LKD  ++I A+IWK   ++
Sbjct: 7   SVSELTQQIKQELEILFPKIQVKGEISNFKH-HSSGHIYMTLKDEGAQIPAVIWKHAASR 65

Query: 76  IEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSD 135
           +   P +G+  +  G+I  +P S +YQ I  S+   G G L  A  K  +KL   G FSD
Sbjct: 66  LTCRPADGMNVIAEGRIEVYPPSGRYQFICTSITQEGEGALQQAFAKLLQKLAAAGWFSD 125

Query: 136 QHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRF-PLRVIIFPVKVQGDECPKEIANAI 194
           + K PIP IP+ I ++TSPTGAVI D+ + +  RF P  ++++P KVQG +    + + I
Sbjct: 126 ERKKPIPKIPQTIGLVTSPTGAVIEDMGKVLQRRFPPATILLYPAKVQGRDAVDSLISGI 185

Query: 195 LQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWT 254
              N    G+   RPD+II+ARGGGS+EDL  FN+E +  AI NS IPIISA+GHETD+T
Sbjct: 186 SWFNAQTSGQN--RPDVIIVARGGGSLEDLQAFNEERVAEAIFNSPIPIISAVGHETDFT 243

Query: 255 LADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKAL 314
           +AD  ADLRA TP+ AAE+AVP    L   + +L A   +    L+K KI+     + +L
Sbjct: 244 IADMVADLRAGTPSIAAELAVPDSLELLRHITSLGATRES----LLKAKIDGAEREIDSL 299

Query: 315 PNSDQTLSCSRYRLDR-------LPRELEHNLE 340
                   CS Y  +R       L  EL+  +E
Sbjct: 300 --------CSSYAFNRPVLQMQQLSEELDSTVE 324


>gi|1303917|dbj|BAA12573.1| YqiB [Bacillus subtilis]
          Length = 448

 Score =  240 bits (612), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 132/350 (37%), Positives = 206/350 (58%), Gaps = 14/350 (4%)

Query: 16  SVSELSYHLKHI--VESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +VS L+ ++K    V+ +L ++ ++GE+S  + IH+ GH YF+LK+   R+ ++++    
Sbjct: 8   TVSALTKYIKRKFDVDPHLENIWIKGELSNVK-IHTRGHIYFTLKERKGRMQSVMFARQS 66

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            ++ F PE G++ LV G I+ +  S  YQ+  + + P G G L  A E+ KKKL  EGLF
Sbjct: 67  ERLPFKPENGMKVLVRGGISVYEPSGNYQLYAKEMQPDGVGALYLAYEELKKKLAGEGLF 126

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
            D++K  IP  P  I V+TSPTGA +RD++  +  R+PL +VI+ P  VQG+   + I  
Sbjct: 127 DDRYKKQIPAFPATIGVVTSPTGAAVRDVITTLKRRYPLVKVIVLPALVQGENASRSIVT 186

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
            I + N   E   C   D++I+ RGGGSIE+LW FN+E++ RAI  S+IPIISA+GHETD
Sbjct: 187 RIEEAN---EKEIC---DVLIVGRGGGSIEELWAFNEEIVARAIFASNIPIISAVGHETD 240

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI---KYKINTLNS 309
           +T++D+ AD+RA TPTGAAE+AVP    L       E R+   + + +   K +I TL S
Sbjct: 241 FTISDFVADIRAATPTGAAEIAVPHTTDLIERTKTAEVRMTRAMQQHLGQEKGRIQTLQS 300

Query: 310 LLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
              A     +  +    + D   ++ +  L  ++ RK R       R+++
Sbjct: 301 SY-AFRFPKRLYAQKEQQFDLAYQQFQAQLTALLDRKSRQLERETYRLEA 349


>gi|237808918|ref|YP_002893358.1| exodeoxyribonuclease VII, large subunit [Tolumonas auensis DSM
           9187]
 gi|259646301|sp|C4L8C6|EX7L_TOLAT RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|237501179|gb|ACQ93772.1| exodeoxyribonuclease VII, large subunit [Tolumonas auensis DSM
           9187]
          Length = 448

 Score =  240 bits (612), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 125/283 (44%), Positives = 177/283 (62%), Gaps = 8/283 (2%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
           Y+VS L+  ++ ++E  +  V +  EIS     HSSGH YF+LKD  ++I A ++KG   
Sbjct: 9   YTVSRLNNVVRLLLEQEMGLVWLTAEISNLVQ-HSSGHWYFTLKDQQAQIRAAMFKGQNR 67

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
           ++ F P+ G + LV G+++ +     YQ+I+E + P+G G L   LE  K +L+ EGLF 
Sbjct: 68  RVSFRPQNGQQILVQGQLSLYEARGDYQLIVEKMQPAGDGLLQMKLEALKARLMAEGLFD 127

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANA 193
            + K  +P  PK I +ITSPTGA I D+L  ++ R P L VI++P  VQG+     + NA
Sbjct: 128 PRRKRALPTQPKQIGIITSPTGAAIHDMLTILARRDPALPVILYPSAVQGESAVPALLNA 187

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
              L T      C   D++I+ RGGGS+EDLW FNDE++VRAIANS IPI+SA+GHETD 
Sbjct: 188 ---LETAWRRNEC---DLLIIGRGGGSLEDLWCFNDELVVRAIANSPIPIVSAVGHETDV 241

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNII 296
           TL+D+AADLRAPTP+ AAE+    ++     L   + RL   I
Sbjct: 242 TLSDFAADLRAPTPSAAAELVSRDQQQQLHRLAQYQHRLQQAI 284


>gi|255506909|ref|ZP_05382548.1| exodeoxyribonuclease VII large subunit [Chlamydia trachomatis
           D(s)2923]
          Length = 516

 Score =  240 bits (612), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 171/521 (32%), Positives = 265/521 (50%), Gaps = 56/521 (10%)

Query: 9   SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAII 68
           S+  P   VS L+  +K+++E N   V V+GE+S    + +SGH YF++KD+ + ++   
Sbjct: 2   SITSPPIEVSVLTDSIKNLLEKNFLRVVVKGELSNV-SLQTSGHLYFAIKDSKAVLNGAF 60

Query: 69  WKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLL 128
           +       +  P++G   ++ GK+T +    +YQI+  +L  SG G LL   E+RK++L 
Sbjct: 61  FHFRSKYFDRKPKDGDYVILHGKLTVYAPRGQYQIVAYALTFSGEGNLLQQFEERKQRLA 120

Query: 129 EEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRF-PLRVIIFPVKVQGDECP 187
            EG F  + K P+P   ++I VITSPTGAVI+DIL+ +S R    +VI++PV VQG    
Sbjct: 121 AEGYFDPKRKKPLPSGARVIGVITSPTGAVIQDILRVLSRRCHQFQVILYPVTVQGATAA 180

Query: 188 KEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAI 247
           +EI+ AI   N    G        +I+ARGGGSIEDLW FN+E +V++I  SSIPIISA+
Sbjct: 181 QEISQAIQFFNQNSMG-----VHALIIARGGGSIEDLWAFNEEELVKSIVASSIPIISAV 235

Query: 248 GHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTL 307
           GHETD+TL D+A+D+RAPTP+ AAE+     +  +  L NL   +++   + I  K N L
Sbjct: 236 GHETDFTLCDFASDVRAPTPSAAAEIVCKSSDQYRQELQNLRRYVSSHARQFIAAKKNLL 295

Query: 308 NSLLKALPNSD------QTLSCSRYRLDR-LPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
               + L + D      QTL  +R  L+R +  +LE+  +   F +YR +      +KSD
Sbjct: 296 THWQRHLASVDFYHTAQQTLDYTRSALERGIETKLEYYKQ--RFAQYRRW------LKSD 347

Query: 361 FLIHNIQKN------------RQHILEKQQHIEQIV--------------KQHLRYIFLE 394
            LI  I+K+            +  I  K+  + Q+                QH R I  +
Sbjct: 348 VLIR-IEKHLADLNQSLMLSIKNKIYTKKTSLNQLYTSCLKNELLNLQHRTQHSRNILSQ 406

Query: 395 KKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAY 454
              ++ I     +QT          + +L   + F + H +               S   
Sbjct: 407 LSRRLHIAIASSQQTHQEC------LVRLQNELSFTIQHLLTKAKERCQAIQEQASSLNP 460

Query: 455 KNTLKRGYTSIQDTNNNF-ITQKRNLATKTRILINFFDGQA 494
           KN LKRG+  + D N +F I    +L     + +   DG+A
Sbjct: 461 KNVLKRGFAQLFDFNKHFVIISAESLKQSDLVRVCLQDGEA 501


>gi|332977567|gb|EGK14337.1| exodeoxyribonuclease VII large subunit [Desmospora sp. 8437]
          Length = 456

 Score =  240 bits (612), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 143/401 (35%), Positives = 226/401 (56%), Gaps = 31/401 (7%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L   L  ++E +  LS + V+GEIS ++  H  GH YF+LKD+ +RI A+++ G  
Sbjct: 10  TVTGLVQRLTQVIEEDPGLSRIWVQGEISNFKH-HGRGHMYFTLKDDQTRIRAVMFAGNN 68

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            ++ F+P++G + L+ G++  F    + Q+ +  + P+G G L  A ++ K+KL EEGLF
Sbjct: 69  RRLRFMPKDGDDVLIRGRVGVFERDGQTQLYVTHMQPNGVGELYVAFQQLKEKLNEEGLF 128

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRF-PLRVIIFPVKVQGDECPKEIAN 192
           S   K  +PF P+ + V+TS  GA +RDI+  I  R   + ++++PV VQG + P EIA 
Sbjct: 129 SPTLKKGLPFFPRCVGVVTSAHGAAVRDIITTIRRRSRGVDILLYPVPVQGPQAPLEIAQ 188

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           A+ QLN   E       D+II+ RGGGS+E+LW FN+E++ R+I  S IP++SA+GHETD
Sbjct: 189 ALDQLNQAGE------VDVIIVGRGGGSLEELWAFNEEVVARSIHQSRIPVVSAVGHETD 242

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            T+AD+ AD+RA TPT AAEM VP  E LQ  L  ++ RL   + + +      LN  L 
Sbjct: 243 TTIADFVADVRAATPTAAAEMIVPRLEELQIGLKAVQERLTKGMKQCLTDGRVRLNRSLD 302

Query: 313 --ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRH-FNHIINRIKSDFLIHNIQKN 369
              L      L  +  RLD L  +L         R  R  F  + +R++S          
Sbjct: 303 RPVLRRPATGLEQAEQRLDILTGDL--------VRAAREGFAPVRSRLES---------- 344

Query: 370 RQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTK 410
           R + L+      ++ +   R + L+++ K+ +  +LRE  +
Sbjct: 345 RTYRLKGHHPALRVPRLKERLVRLQRQSKVGMTRLLREHRR 385


>gi|291532855|emb|CBL05968.1| exodeoxyribonuclease VII, large subunit [Megamonas hypermegale
           ART12/1]
          Length = 400

 Score =  240 bits (612), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 133/326 (40%), Positives = 196/326 (60%), Gaps = 12/326 (3%)

Query: 15  YSVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           Y+VS+L+ +L+   + +  L ++ ++GEIS ++ +HSSGH YF+LKDN + I  + ++  
Sbjct: 6   YTVSQLNKYLRQQFDDDIILQNIMLKGEISNFK-VHSSGHCYFTLKDNLASIKCVAFRFN 64

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
             K  F P+ G++ +  G I+ +     YQ+ ++SL P G G L  A E+ K KL +EGL
Sbjct: 65  AMKFRFAPQNGMKVIASGYISIYEKDGLYQLYVQSLAPEGIGELALAFEQLKNKLNDEGL 124

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIA 191
           F  ++K  +PF PK I V+TS TGAVI+DI      R PL +++++ V VQG+   KEI 
Sbjct: 125 FDSKYKKQLPFYPKRIGVVTSRTGAVIKDICHVAKRRNPLVKILLYSVLVQGENASKEIV 184

Query: 192 NAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHET 251
             I   N     + CP  D+II+ RGGGS+EDLW FN+E ++RAI  S IPIISA+GHET
Sbjct: 185 QGIEFFN-----KKCP-VDVIIIGRGGGSLEDLWAFNEENVIRAIFASKIPIISAVGHET 238

Query: 252 DWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLL 311
           D+TL+D  +D+RA TP+ AAE+AV  KE L + + +L+         L   K N  N L 
Sbjct: 239 DYTLSDLTSDVRAATPSQAAELAVVEKEALVNYIESLKRDCRYKAYNLFSIKENKFNLLW 298

Query: 312 K--ALPNSDQTLSCSRYRLDRLPREL 335
           K     + ++ L   +  LD L   L
Sbjct: 299 KHSIFSDKERLLQSRQQELDFLNERL 324


>gi|224476634|ref|YP_002634240.1| exodeoxyribonuclease VII large subunit [Staphylococcus carnosus
           subsp. carnosus TM300]
 gi|254783709|sp|B9DNP9|EX7L_STACT RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|222421241|emb|CAL28055.1| putative exonuclease VII, large subunit [Staphylococcus carnosus
           subsp. carnosus TM300]
          Length = 446

 Score =  240 bits (612), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 165/491 (33%), Positives = 249/491 (50%), Gaps = 67/491 (13%)

Query: 16  SVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           SV+ L+ ++K+  + +  L  V ++GE+S ++  HSSGH YF+LKDN+S ++A+++K   
Sbjct: 6   SVTALTKYIKYKFDQDPHLQSVLLKGELSNFKK-HSSGHLYFNLKDNNSVVNAMMFKAQA 64

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
           NK++F P+EG E L+  +++ +     YQI +  +   G G L   LE  KK+L ++GLF
Sbjct: 65  NKLDFNPKEGDEVLIEARVSVYERQGNYQIYVNKMHLDGIGNLYQKLEALKKELKKQGLF 124

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
             +HK  IP  PK IAV+T+ TGA IRDI   I+ R+PL   I     VQG +   +I N
Sbjct: 125 DTKHKKEIPRFPKKIAVLTASTGAAIRDIYSTINSRYPLVEQIQISTLVQGKQAKDDIVN 184

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
            I   +TL         D++I+ RGGGSIEDLW+FN+E +VRAI  +  P+ISA+GHETD
Sbjct: 185 KIKYADTLD-------ADVMIVGRGGGSIEDLWNFNEEEVVRAIFEAKTPVISAVGHETD 237

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +TL+D+ AD+RA TPT AA +A P +  L   +   E  L+  II+              
Sbjct: 238 FTLSDFVADVRAATPTQAAVIATPDQVELSQYIKQTELNLSRHIIQ-------------- 283

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIIN--RIKSDFLIHNIQKNR 370
                                        II  K +H  H+ +  + K   L+++ Q  +
Sbjct: 284 -----------------------------IINNKKKHLEHVASYYKFKQPSLLYDQQIQK 314

Query: 371 QHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRI---FYLHTHIKKLITRI 427
           +   E+Q ++    K +     +E       L  L++QT   I     LH  + K I  I
Sbjct: 315 KDDFERQLNLSITTKLNNALQKVELLTNRINLKDLKQQTLQGIQSRLQLHDSLNKSIINI 374

Query: 428 EFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILI 487
                  I +    +S     L S +  NT+ RGYT I + N   IT  ++L     I +
Sbjct: 375 -------IDNSKKRLSQRIENLNSLSPSNTMLRGYT-IVNKNEQVITSTQSLEKNDEINL 426

Query: 488 NFFDGQANAIV 498
              DG  +AIV
Sbjct: 427 QMKDGTVDAIV 437


>gi|296532674|ref|ZP_06895369.1| exodeoxyribonuclease VII large subunit [Roseomonas cervicalis ATCC
           49957]
 gi|296266996|gb|EFH12926.1| exodeoxyribonuclease VII large subunit [Roseomonas cervicalis ATCC
           49957]
          Length = 294

 Score =  240 bits (612), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 127/280 (45%), Positives = 185/280 (66%), Gaps = 3/280 (1%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           PE++VSE+S  +K  +E     V VRGEI+  +  + SGH Y +LKD  ++I  IIW+  
Sbjct: 14  PEFTVSEISGAIKRTLEGEFGRVRVRGEITELKA-YPSGHIYLALKDEGAKIRGIIWRFA 72

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
           + ++   PE G+E +  GK++++   S YQ+II+ +  +G G LL  +E+ +KKL  EGL
Sbjct: 73  VPRLSLRPENGMEVIATGKVSSYGERSDYQLIIDRIEFAGEGALLARIEQLRKKLGAEGL 132

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F +  K P+P +P+++ V+TS  GAVI+DI   I+ RFP  ++++PV VQG    ++IA 
Sbjct: 133 FDEARKKPLPLLPRLVGVVTSEKGAVIQDIRTTIARRFPRPILLWPVPVQGQGAAQQIAA 192

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   + L  G    RPD++I+ARGGGS+EDL  FNDE ++RA A   IP+ISA+GHETD
Sbjct: 193 AIDGFSRLPPG--IERPDVLIVARGGGSLEDLMAFNDEAVLRAAAACPIPLISAVGHETD 250

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARL 292
            TL D+ +D RAPTPT AAE+AVP +  L + L +  ARL
Sbjct: 251 TTLIDFVSDRRAPTPTAAAELAVPARAELLAGLAHSAARL 290


>gi|289525368|emb|CBJ14845.1| exodeoxyribonuclease VII large subunit [Chlamydia trachomatis
           Sweden2]
 gi|296434920|gb|ADH17098.1| exodeoxyribonuclease VII large subunit [Chlamydia trachomatis
           E/150]
 gi|296438640|gb|ADH20793.1| exodeoxyribonuclease VII large subunit [Chlamydia trachomatis
           E/11023]
          Length = 516

 Score =  239 bits (611), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 171/521 (32%), Positives = 264/521 (50%), Gaps = 56/521 (10%)

Query: 9   SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAII 68
           S+  P   VS L+  +K+++E N   V V+GE+S    + +SGH YF++KD+ + ++   
Sbjct: 2   SITSPPIEVSVLTDSIKNLLEKNFLRVVVKGELSNV-SLQTSGHLYFAIKDSKAVLNGAF 60

Query: 69  WKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLL 128
           +       +  P++G   ++ GK+T +    +YQI+  +L  SG G LL   E+RK++L 
Sbjct: 61  FHFRSKYFDRKPKDGDYVILHGKLTVYAPRGQYQIVAYALTFSGEGNLLQQFEERKQRLA 120

Query: 129 EEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRF-PLRVIIFPVKVQGDECP 187
            EG F  + K P+P   ++I VITSPTGAVI+DIL+  S R    +VI++PV VQG    
Sbjct: 121 AEGYFDPKRKKPLPSGARVIGVITSPTGAVIQDILRVFSRRCHQFQVILYPVTVQGATAA 180

Query: 188 KEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAI 247
           +EI+ AI   N    G        +I+ARGGGSIEDLW FN+E +V++I  SSIPIISA+
Sbjct: 181 QEISQAIQFFNQNSMG-----VHALIIARGGGSIEDLWAFNEEELVKSIVASSIPIISAV 235

Query: 248 GHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTL 307
           GHETD+TL D+A+D+RAPTP+ AAE+     +  +  L NL   +++   + I  K N L
Sbjct: 236 GHETDFTLCDFASDVRAPTPSAAAEIVCKSSDQYRQELQNLRRYVSSHARQFIAAKKNLL 295

Query: 308 NSLLKALPNSD------QTLSCSRYRLDR-LPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
               + L + D      QTL  +R  L+R +  +LE+  +   F +YR +      +KSD
Sbjct: 296 THWQRHLASVDFYHTAQQTLDYTRSALERGIETKLEYYKQ--RFAQYRRW------LKSD 347

Query: 361 FLIHNIQKN------------RQHILEKQQHIEQIV--------------KQHLRYIFLE 394
            LI  I+K+            +  I  K+  + Q+                QH R I  +
Sbjct: 348 VLIR-IEKHLADLNQSLMLSIKNKIYTKKTSLNQLYTSCLKNELLNLQHRTQHSRNILSQ 406

Query: 395 KKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAY 454
              ++ I     +QT          + +L   + F + H +               S   
Sbjct: 407 LSRRLHIAIASSQQTHQEC------LVRLQNELSFTIQHLLTKAKERCQAIQEQASSLNP 460

Query: 455 KNTLKRGYTSIQDTNNNF-ITQKRNLATKTRILINFFDGQA 494
           KN LKRG+  + D N +F I    +L     + +   DG+A
Sbjct: 461 KNVLKRGFAQLFDFNKHFVIISAESLKQSDLVRVCLQDGEA 501


>gi|329297574|ref|ZP_08254910.1| exodeoxyribonuclease VII large subunit [Plautia stali symbiont]
          Length = 455

 Score =  239 bits (611), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 150/498 (30%), Positives = 249/498 (50%), Gaps = 55/498 (11%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
           ++VS L+  ++ ++E+ +  V +  EIS +    +SGH YF+LKD+ +++   +++ +  
Sbjct: 10  FTVSRLNTTVRQLLENEMGLVWLSAEISNFTQ-PASGHWYFTLKDDGAQVRCAMFRNSNR 68

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
           ++ F P+ G + LV   IT +     YQ+IIES+ P+G G L    E+ K +L  EGLF 
Sbjct: 69  RVSFRPQHGQQVLVRASITLYEPRGDYQLIIESMHPAGEGLLQQQFEQLKARLAAEGLFD 128

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANA 193
            Q K P+P   + +AVITS TGA + D+L+ +  R P L V+I+P  VQG + P  I  A
Sbjct: 129 QQFKQPLPEPARQVAVITSATGAALHDVLRVLHRRDPSLPVVIYPTAVQGVDAPAAIVRA 188

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N   E   C   D++I+ RGGGS+EDLW FNDE + RAI  S +PI+SA+GHETD 
Sbjct: 189 IELANQRDE---C---DVLIVGRGGGSLEDLWSFNDERVARAIFASRLPIVSAVGHETDV 242

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           T+AD+ ADLRAPTP+ AAE+                   N I              LL+ 
Sbjct: 243 TIADFVADLRAPTPSAAAELVS----------------RNQI-------------ELLRR 273

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           L +  Q               +E  ++  + ++ R F  + +R++       + + +  +
Sbjct: 274 LQSQQQ--------------RMEMAMDYYVAQQQRRFTRLQHRLQQQHPQLRLARQQTTL 319

Query: 374 LEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLR-EQTKNRIFYLHTHIKKLITRIEFILS 432
           L+ Q+ +++ V Q LR   L  +++  +L  L+ +Q + RI      +++   R++  + 
Sbjct: 320 LQLQRRLQEAVDQRLR---LANRQQDRLLQRLQSQQPQERILRAQQQLQQWHYRLQQGME 376

Query: 433 HKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDG 492
            ++             L+  +   TL RG++   D+    + + R L T   +     DG
Sbjct: 377 KQLNHSRQRFGALAAQLEGVSPLATLARGFSVTTDSQGQVVKKTRQLHTGDLLRTRLDDG 436

Query: 493 QANAIVINKAPPKEQPTK 510
              + V    P K +  K
Sbjct: 437 WVESQVTALQPQKTRSRK 454


>gi|290508299|ref|ZP_06547670.1| exodeoxyribonuclease VII, large subunit [Klebsiella sp. 1_1_55]
 gi|289777693|gb|EFD85690.1| exodeoxyribonuclease VII, large subunit [Klebsiella sp. 1_1_55]
          Length = 463

 Score =  239 bits (611), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 156/504 (30%), Positives = 249/504 (49%), Gaps = 65/504 (12%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
           ++VS L+  ++ ++E  +  V + GEIS +    SSGH YF+LKD+++++   +++ +  
Sbjct: 10  FTVSRLNQTVRLLLEREMGQVWISGEISNF-SQPSSGHWYFTLKDDNAQVRCAMFRNSNR 68

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
           ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K +L  EGLF 
Sbjct: 69  RVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAQLTAEGLFE 128

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANA 193
            +HK  +P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ P +I  A
Sbjct: 129 QKHKQALPSPAHCVGVITSKTGAALHDILHVLRRRDPGLPVIIYPTAVQGDDAPGQIVRA 188

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N  +E   C   D++I+ RGGGS+EDLW FNDE + RAI  S IPI+SA+GHETD 
Sbjct: 189 IALANARQE---C---DVLIVGRGGGSLEDLWSFNDERVARAIFASQIPIVSAVGHETDV 242

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           T+AD+ ADLRAPTP+ AAE                      I+ R           LL+ 
Sbjct: 243 TIADFVADLRAPTPSAAAE----------------------IVSR-------NQQELLRQ 273

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           L +  Q               LE  ++  +  + R F  + +R++        Q++ Q  
Sbjct: 274 LQSGQQ--------------RLEMAMDYFLASRQRRFTQLFHRLQ--------QQHPQLR 311

Query: 374 LEKQQHIEQIVKQHLRYIF------LEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRI 427
           L +QQ   + ++Q +R          E+++K  +  +     + RI    + I++L  R+
Sbjct: 312 LARQQTALERLRQRMRIAVESQLKRAEQRQKRTVQRLDHYNPQPRIHRAQSRIQQLEYRL 371

Query: 428 EFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILI 487
              +  ++             L++ +   TL RGY+    ++   + Q + + T   +  
Sbjct: 372 AENMRGRLSERRERFGNAVTHLEAVSPLATLARGYSVTSVSDGTVLKQTKQVKTGDLLTT 431

Query: 488 NFFDGQANAIVINKAPPKEQPTKK 511
              DG   + V   AP K+   +K
Sbjct: 432 RLKDGWVESEVKQIAPVKKTRARK 455


>gi|296436772|gb|ADH18942.1| exodeoxyribonuclease VII large subunit [Chlamydia trachomatis
           G/11222]
          Length = 516

 Score =  239 bits (611), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 171/521 (32%), Positives = 265/521 (50%), Gaps = 56/521 (10%)

Query: 9   SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAII 68
           S+  P   VS L+  +K+++E N   V V+GE+S    + +SGH YF++KD+ + ++   
Sbjct: 2   SITSPPIEVSVLTDSIKNLLEKNFLRVVVKGELSNV-SLQTSGHLYFAIKDSKAVLNGAF 60

Query: 69  WKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLL 128
           +       +  P++G   ++ GK+T +    +YQI+  +L  SG G LL   E+RK++L 
Sbjct: 61  FHFRSKYFDRKPKDGDYVILHGKLTVYAPRGQYQIVAYALTFSGEGNLLQQFEERKQRLA 120

Query: 129 EEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCR-FPLRVIIFPVKVQGDECP 187
            EG F  + K P+P   ++I VITSPTGAVI+DIL+ +S R    +VI++PV VQG    
Sbjct: 121 AEGYFDPKRKKPLPSGARVIGVITSPTGAVIQDILRVLSRRCHQFQVILYPVTVQGATAA 180

Query: 188 KEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAI 247
           +EI+ AI   N    G        +I+ARGGGSIEDLW FN+E +V++I  SSIPIISA+
Sbjct: 181 QEISQAIQFFNQNSMG-----VHALIIARGGGSIEDLWAFNEEELVKSIVASSIPIISAV 235

Query: 248 GHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTL 307
           GHETD+TL D+A+D+RAPTP+ AAE+     +  +  L NL   +++   + I  K N L
Sbjct: 236 GHETDFTLCDFASDVRAPTPSAAAEIVCKSSDQYRQELQNLRRYVSSHARQFIAAKKNLL 295

Query: 308 NSLLKALPNSD------QTLSCSRYRLDR-LPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
               + L + D      QTL  +R  L+R +  +LE+  +   F +YR +      +KSD
Sbjct: 296 THWQRHLASVDFYHTAQQTLDYTRAALERGIETKLEYYKQ--RFAQYRRW------LKSD 347

Query: 361 FLIHNIQKN------------RQHILEKQQHIEQIV--------------KQHLRYIFLE 394
            LI  I+K+            +  I  K+  + Q+                QH R I  +
Sbjct: 348 VLI-RIEKHLADLNQSLMLSIKNKIYTKKTSLNQLYTSCLKNELLNLQHHTQHSRNILSQ 406

Query: 395 KKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAY 454
              ++ I     +QT          + +L   + F + H +               S   
Sbjct: 407 LSRRLHIAIASSQQTHQEC------LVRLQNELSFTIHHLLTKAKERCQAIQEQASSLNP 460

Query: 455 KNTLKRGYTSIQDTNNNF-ITQKRNLATKTRILINFFDGQA 494
           KN LKRG+  + D N +F I    +L     + +   DG+A
Sbjct: 461 KNVLKRGFAQLFDFNKHFVIISAESLKQSDLVRVCLQDGEA 501


>gi|288934101|ref|YP_003438160.1| exodeoxyribonuclease VII large subunit [Klebsiella variicola At-22]
 gi|288888830|gb|ADC57148.1| exodeoxyribonuclease VII, large subunit [Klebsiella variicola
           At-22]
          Length = 463

 Score =  239 bits (611), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 156/504 (30%), Positives = 249/504 (49%), Gaps = 65/504 (12%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
           ++VS L+  ++ ++E  +  V + GEIS +    SSGH YF+LKD+++++   +++ +  
Sbjct: 10  FTVSRLNQTVRLLLEREMGQVWISGEISNF-SQPSSGHWYFTLKDDNAQVRCAMFRNSNR 68

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
           ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K +L  EGLF 
Sbjct: 69  RVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAQLTAEGLFE 128

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANA 193
            +HK  +P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ P +I  A
Sbjct: 129 QKHKQALPSPAHCVGVITSKTGAALHDILHVLRRRDPGLPVIIYPTAVQGDDAPGQIVRA 188

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N  +E   C   D++I+ RGGGS+EDLW FNDE + RAI  S IPI+SA+GHETD 
Sbjct: 189 IALANARQE---C---DVLIVGRGGGSLEDLWSFNDERVARAIFASQIPIVSAVGHETDV 242

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           T+AD+ ADLRAPTP+ AAE                      I+ R           LL+ 
Sbjct: 243 TIADFVADLRAPTPSAAAE----------------------IVSR-------NQQELLRQ 273

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           L +  Q               LE  ++  +  + R F  + +R++        Q++ Q  
Sbjct: 274 LQSGQQ--------------RLEMAMDYFLASRQRRFTQLFHRLQ--------QQHPQLR 311

Query: 374 LEKQQHIEQIVKQHLRYIF------LEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRI 427
           L +QQ   + ++Q +R          E+++K  +  +     + RI    + I++L  R+
Sbjct: 312 LARQQTALERLRQRMRIAVESQIKRAEQRQKRTVQRLDHYNPQPRIHRAQSRIQQLEYRL 371

Query: 428 EFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILI 487
              +  ++             L++ +   TL RGY+    ++   + Q + + T   +  
Sbjct: 372 AENMRGRLSERRERFGNAVTHLEAVSPLATLARGYSVTSVSDGTVLKQTKQVKTGDLLTT 431

Query: 488 NFFDGQANAIVINKAPPKEQPTKK 511
              DG   + V   AP K+   +K
Sbjct: 432 RLKDGWVESEVKQIAPVKKTRARK 455


>gi|317122008|ref|YP_004102011.1| exodeoxyribonuclease VII large subunit [Thermaerobacter marianensis
           DSM 12885]
 gi|315591988|gb|ADU51284.1| Exodeoxyribonuclease VII large subunit [Thermaerobacter marianensis
           DSM 12885]
          Length = 459

 Score =  239 bits (610), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 133/352 (37%), Positives = 209/352 (59%), Gaps = 12/352 (3%)

Query: 13  PEYSVSELSYHLKHIVESN--LSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           P  +VSEL+  ++  +E++  L  V VRGEI+  +  HSSGH YF+L+D  + +  ++++
Sbjct: 33  PVLTVSELTARIRQRLETDARLRQVWVRGEINSCK-RHSSGHLYFTLQDEGATLRCVMFR 91

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
                + F PE+G+E +  G++  +  +  YQ+ +++L P+G G L  ALE+R+++L  E
Sbjct: 92  SAARHLTFTPEDGMEVIAQGRVGVYEPAGTYQLYVDALEPAGLGALYLALEQRRRRLARE 151

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKE 189
           GLF  Q K P+P  P+ I V+TS  GA +RDIL+    R P LRV++ PV VQG+   + 
Sbjct: 152 GLFDPQRKRPLPPFPRCIGVVTSADGAALRDILRVALGRHPRLRVVVAPVPVQGEGAAEA 211

Query: 190 IANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGH 249
           IA AI + N           D++I+ RGGG+ EDLW FN+E++VRA+A+S IP++SA+GH
Sbjct: 212 IAAAIARFNRWGGA------DVLIVGRGGGAREDLWTFNEEVVVRAVASSRIPVVSAVGH 265

Query: 250 ETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNS 309
           E D TL D AAD+RAPTP+ AA +AVP    L++ L  L  RL   + R ++     L+ 
Sbjct: 266 EIDVTLCDLAADVRAPTPSAAAALAVPELGRLEARLAELAGRLEGAVRRRLEQARQRLDE 325

Query: 310 LLK--ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
           L +   L +  Q +   R RL  L ++L       +  + R    +  R+++
Sbjct: 326 LARRPGLRHPAQQVQAWRQRLRELQQDLTRAAVWRVAGERRRLEGLAGRLEA 377


>gi|332298471|ref|YP_004440393.1| Exodeoxyribonuclease 7 large subunit [Treponema brennaborense DSM
           12168]
 gi|332181574|gb|AEE17262.1| Exodeoxyribonuclease 7 large subunit [Treponema brennaborense DSM
           12168]
          Length = 408

 Score =  239 bits (610), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 118/272 (43%), Positives = 173/272 (63%), Gaps = 8/272 (2%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
           +SVSEL+  +K ++E +   V + GEIS  R   S+GH YF+LKD  + I A+++KG + 
Sbjct: 16  FSVSELTGIIKEMLEGSFPFVHIEGEISNCRP-ASTGHLYFTLKDAGAAISAVMFKGKMK 74

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
            + F P +G    V G I+ +     YQI++ES+  +G+G +L  LE+RK++L  EGLF 
Sbjct: 75  SLTFAPADGTLVRVKGSISVYALRGNYQIVVESMELAGTGNILQMLEERKRRLAAEGLFD 134

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANA 193
            + K P+PF P+ I V+TSPTGA +RDILQ    R P + V + P  VQG +  + I   
Sbjct: 135 SRRKRPLPFFPQTIGVVTSPTGAALRDILQITRRRNPKVSVTVLPCAVQGSDAAQAIVRM 194

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N  +        D++I+ RGGGS+EDL  F++E +VRA+A S IPI+SA+GHE DW
Sbjct: 195 IETANAYRLA------DVLIVGRGGGSLEDLLPFSEESVVRAVAASEIPIVSAVGHEIDW 248

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSL 285
            L+D+AAD+RAPTP+ AAE+  P+   L + +
Sbjct: 249 ALSDFAADVRAPTPSAAAELVTPLLTDLYAGI 280


>gi|153824580|ref|ZP_01977247.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae MZO-2]
 gi|149741798|gb|EDM55827.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae MZO-2]
          Length = 446

 Score =  239 bits (610), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 137/391 (35%), Positives = 227/391 (58%), Gaps = 14/391 (3%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
           Y+VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++   ++KG   
Sbjct: 11  YTVSRLNSEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSQAQVKCAMFKGNNR 69

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
            + F P+ G + LV  +++ +     YQII+ES+ P G G L    E+ K +L  EGLF+
Sbjct: 70  LVNFKPQNGQQVLVKARLSLYEPRGDYQIILESMQPEGDGRLQQQFEQLKMQLAAEGLFA 129

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANA 193
              K P+P  P+ + +ITS TGA + DIL  +  R P L V+I+P  VQG+E   +IA A
Sbjct: 130 QTRKKPLPENPRCVGIITSRTGAALHDILHVLKRRDPNLPVVIYPTLVQGEEAAIQIAQA 189

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I + NT  E   C   D++I+ RGGGS+EDLW FN E++ R IA S IPIISA+GHE D 
Sbjct: 190 IGRANTRAE---C---DVLIVGRGGGSLEDLWCFNHEIVARTIAASEIPIISAVGHEIDV 243

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           T+AD+ AD+RAPTP+ AAE+      H Q +L   +A+L + +   +  +      L   
Sbjct: 244 TIADFVADVRAPTPSAAAELVSRDHRHKQQALHQWQAKLASAMRHYLAQQDTQFARLQHK 303

Query: 314 LPNS--DQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQ 371
           L        L   + +LD L   LE  ++  +  + + ++ + ++I+    IH I++ R 
Sbjct: 304 LDKQHPQARLERQQQQLDELSLRLEQKMQQRLATQQQRWDRLSHKIELHSPIHLIRQQRF 363

Query: 372 HILEKQQHIEQIVKQHLRYIFLEKKEKIAIL 402
           ++++++Q I Q ++++L    ++ + ++A+L
Sbjct: 364 NLIQQEQRINQSIQRYL----IQSRHQLALL 390


>gi|94967310|ref|YP_589358.1| exodeoxyribonuclease VII large subunit [Candidatus Koribacter
           versatilis Ellin345]
 gi|124007142|sp|Q1IV16|EX7L_ACIBL RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|94549360|gb|ABF39284.1| Exodeoxyribonuclease VII large subunit [Candidatus Koribacter
           versatilis Ellin345]
          Length = 455

 Score =  239 bits (610), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 151/487 (31%), Positives = 242/487 (49%), Gaps = 57/487 (11%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
           + V ++   ++  +E   + V V GEIS +R    SGH YFSLKD  +++  ++++    
Sbjct: 19  WQVRDIVSAVRAALEREYADVWVEGEISNFRPA-DSGHLYFSLKDESTQLRIVMFRSQAR 77

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
            ++F PE G++ +  GK+T + G  + Q++ E L P G+G L  A E+ K KL  EGLF+
Sbjct: 78  LLKFRPENGLKVIARGKVTLYEGRGELQLMAEYLEPQGAGALQIAFEQLKAKLQAEGLFA 137

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRF-PLRVIIFPVKVQGDECPKEIANA 193
            + K PIP +PK I V+TSP GAVI+DIL  +  R   + V+IFP +VQG+    E+A+ 
Sbjct: 138 RERKKPIPALPKKIGVVTSPRGAVIQDILNVLRRRHNSVHVLIFPAQVQGETAASEVASG 197

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           +   N           ++II+ARGGGSIEDL  FNDE + R+IA S+IP+ISA+GHETD+
Sbjct: 198 VRYFN------KAANVEVIIVARGGGSIEDLAAFNDEGLARSIATSTIPVISAVGHETDF 251

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNII-IRLIKYKINTLNSLLK 312
           T+ D+ ADLRAPTP+ AAE+ +  K+ +   L  L   L   + +RL++Y+         
Sbjct: 252 TICDFVADLRAPTPSAAAELVIRSKQEVDERLTALSTHLARALRVRLLEYE--------- 302

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEH-NLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQ 371
                         +LDRL R      ++  I R+ +  + +       F +   Q N  
Sbjct: 303 -------------KKLDRLARHGAFGGMQTAIARRQQRVDDLA------FRLSVAQTN-- 341

Query: 372 HILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFIL 431
                      + +Q      L ++  +A   +     ++R    H  +   + ++   L
Sbjct: 342 -----------VFRQ------LHRRLDVASTRVRHHDLRSRFAAEHRELSARVEKLAATL 384

Query: 432 SHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFD 491
              +    T +      LQ  +  + L+RGY  + D     +   R +     I      
Sbjct: 385 RANLMRRRTRIERLAGQLQGLSPISILERGYALVFDAEGRLLKDARQVREGNTIRAQLAL 444

Query: 492 GQANAIV 498
           GQ +A+V
Sbjct: 445 GQISAVV 451


>gi|330829941|ref|YP_004392893.1| exodeoxyribonuclease 7 large subunit [Aeromonas veronii B565]
 gi|328805077|gb|AEB50276.1| Exodeoxyribonuclease 7 large subunit [Aeromonas veronii B565]
          Length = 459

 Score =  239 bits (610), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 118/298 (39%), Positives = 185/298 (62%), Gaps = 8/298 (2%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
            P S  N  +   ++V+ L+  ++ I+E +L  V + GE+S    + SSGH YFSLKD  
Sbjct: 5   TPSSAANGREQQVFTVTRLNSAVRMILEQDLGLVWLTGELSNL-AMPSSGHWYFSLKDMS 63

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           +++   ++KG   ++ F P++G++ LV  +++ +     YQ+IIES+ P+G G L    E
Sbjct: 64  AQVRCAMFKGNNRRVAFRPQDGMQVLVQARVSLYEPRGDYQLIIESMQPAGDGVLALRFE 123

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVK 180
           + K++L  EGLF +  K P+P  P+ + ++TS TGA + D+L  +  R P L V I+P +
Sbjct: 124 ELKRRLGAEGLFDESRKRPLPREPRAVGLVTSSTGAALHDMLTVLKRRAPDLPVFIYPTQ 183

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQG     +I  AI + N   E       D++I+ RGGGS+EDLW FN+E + RAIA+S+
Sbjct: 184 VQGSAAISQIVAAIAKANQRAE------VDVLIVGRGGGSLEDLWCFNEEAVARAIAHSA 237

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIR 298
           IP++SA+GHE D T++D+AADLRAPTP+ AAE+  P +      L++L+ RL   + R
Sbjct: 238 IPVVSAVGHEVDVTISDFAADLRAPTPSAAAELVAPDQSARAQRLVHLKQRLLQAMSR 295


>gi|15640785|ref|NP_230415.1| exodeoxyribonuclease VII large subunit [Vibrio cholerae O1 biovar
           El Tor str. N16961]
 gi|121585732|ref|ZP_01675527.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae 2740-80]
 gi|121725972|ref|ZP_01679271.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae V52]
 gi|153817270|ref|ZP_01969937.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae NCTC 8457]
 gi|227080945|ref|YP_002809496.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae M66-2]
 gi|254847903|ref|ZP_05237253.1| exodeoxyribonuclease 7 large subunit [Vibrio cholerae MO10]
 gi|255744572|ref|ZP_05418523.1| exodeoxyribonuclease VII large subunit [Vibrio cholera CIRS 101]
 gi|262161293|ref|ZP_06030404.1| exodeoxyribonuclease VII large subunit [Vibrio cholerae INDRE 91/1]
 gi|298499101|ref|ZP_07008908.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae MAK 757]
 gi|14194729|sp|Q9KTW4|EX7L_VIBCH RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|254783717|sp|C3LT19|EX7L_VIBCM RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|9655213|gb|AAF93931.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae O1 biovar
           El Tor str. N16961]
 gi|121550095|gb|EAX60111.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae 2740-80]
 gi|121631454|gb|EAX63824.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae V52]
 gi|126512186|gb|EAZ74780.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae NCTC 8457]
 gi|227008833|gb|ACP05045.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae M66-2]
 gi|254843608|gb|EET22022.1| exodeoxyribonuclease 7 large subunit [Vibrio cholerae MO10]
 gi|255737603|gb|EET92997.1| exodeoxyribonuclease VII large subunit [Vibrio cholera CIRS 101]
 gi|262029043|gb|EEY47696.1| exodeoxyribonuclease VII large subunit [Vibrio cholerae INDRE 91/1]
 gi|297543434|gb|EFH79484.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae MAK 757]
          Length = 446

 Score =  239 bits (610), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 137/391 (35%), Positives = 227/391 (58%), Gaps = 14/391 (3%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
           Y+VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++   ++KG   
Sbjct: 11  YTVSRLNSEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSQAQVKCAMFKGNNR 69

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
            + F P+ G + LV  +++ +     YQII+ES+ P G G L    E+ K +L  EGLF+
Sbjct: 70  LVNFKPQNGQQVLVKARLSLYEPRGDYQIILESMQPEGDGRLQQQFEQLKMQLAAEGLFA 129

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANA 193
              K P+P  P+ + +ITS TGA + DIL  +  R P L V+I+P  VQG+E   +IA A
Sbjct: 130 QTRKKPLPENPRCVGIITSRTGAALHDILHVLKRRDPNLPVVIYPTLVQGEEAAIQIAQA 189

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I + NT  E   C   D++I+ RGGGS+EDLW FN E++ R IA S IPIISA+GHE D 
Sbjct: 190 IGRANTRAE---C---DVLIVGRGGGSLEDLWCFNHEIVARTIAASEIPIISAVGHEIDV 243

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           T+AD+ AD+RAPTP+ AAE+      H Q +L   +A+L + +   +  +      L   
Sbjct: 244 TIADFVADVRAPTPSAAAELVSRDHRHKQQALHQWQAKLASTMRHYLAQQETQFARLQHK 303

Query: 314 LPNS--DQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQ 371
           L        L   + +LD L   LE  ++  +  + + ++ + ++I+    IH I++ R 
Sbjct: 304 LDKQHPQARLERQQQQLDELSLRLEQKMQQRLATQQQRWDRLSHKIELHSPIHLIRQQRF 363

Query: 372 HILEKQQHIEQIVKQHLRYIFLEKKEKIAIL 402
           ++++++Q I Q ++++L    ++ + ++A+L
Sbjct: 364 NLIQQEQRINQSIQRYL----IQSRHQLALL 390


>gi|254285484|ref|ZP_04960448.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae AM-19226]
 gi|150424346|gb|EDN16283.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae AM-19226]
          Length = 446

 Score =  239 bits (610), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 137/391 (35%), Positives = 227/391 (58%), Gaps = 14/391 (3%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
           Y+VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++   ++KG   
Sbjct: 11  YTVSRLNSEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSQAQVKCAMFKGNNR 69

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
            + F P+ G + LV  +++ +     YQII+ES+ P G G L    E+ K +L  EGLF+
Sbjct: 70  LVNFKPQNGQQVLVKARLSLYEPRGDYQIILESMQPEGDGRLQQQFEQLKMQLAAEGLFA 129

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANA 193
              K P+P  P+ + +ITS TGA + DIL  +  R P L V+I+P  VQG+E   +IA A
Sbjct: 130 QTRKKPLPENPRCVGIITSRTGAALHDILHVLKRRDPNLPVVIYPTLVQGEEAAIQIAQA 189

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I + NT  E   C   D++I+ RGGGS+EDLW FN E++ R IA S IPIISA+GHE D 
Sbjct: 190 IGRANTRAE---C---DVLIVGRGGGSLEDLWCFNHEIVARTIAASEIPIISAVGHEIDV 243

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           T+AD+ AD+RAPTP+ AAE+      H Q +L   +A+L + +   +  +      L   
Sbjct: 244 TIADFVADVRAPTPSAAAELVSRDHRHKQQALHQWQAKLASAMRHYLAQQDTQFARLQHK 303

Query: 314 LPNS--DQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQ 371
           L        L   + +LD L   LE  ++  +  + + ++ + ++I+    IH I++ R 
Sbjct: 304 LDKQHPQARLERQQQQLDELSLRLEQKMQQRLATQQQRWDRLSHKIELHSPIHLIRQQRF 363

Query: 372 HILEKQQHIEQIVKQHLRYIFLEKKEKIAIL 402
           ++++++Q I Q ++++L    ++ + ++A+L
Sbjct: 364 NLIQQEQRINQSIQRYL----IQSRHQLALL 390


>gi|327483549|gb|AEA77956.1| Exodeoxyribonuclease VII large subunit [Vibrio cholerae LMA3894-4]
          Length = 446

 Score =  239 bits (610), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 137/391 (35%), Positives = 227/391 (58%), Gaps = 14/391 (3%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
           Y+VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++   ++KG   
Sbjct: 11  YTVSRLNSEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSQAQVKCAMFKGNNR 69

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
            + F P+ G + LV  +++ +     YQII+ES+ P G G L    E+ K +L  EGLF+
Sbjct: 70  LVNFKPQNGQQVLVKARLSLYEPRGDYQIILESMQPEGDGRLQQQFEQLKMQLAAEGLFA 129

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANA 193
              K P+P  P+ + +ITS TGA + DIL  +  R P L V+I+P  VQG+E   +IA A
Sbjct: 130 QTRKKPLPENPRCVGIITSRTGAALHDILHVLKRRDPNLPVVIYPTLVQGEEAAIQIAQA 189

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I + NT  E   C   D++I+ RGGGS+EDLW FN E++ R IA S IPIISA+GHE D 
Sbjct: 190 IGRANTRAE---C---DVLIVGRGGGSLEDLWCFNHEIVARTIAASEIPIISAVGHEIDV 243

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           T+AD+ AD+RAPTP+ AAE+      H Q +L   +A+L + +   +  +      L   
Sbjct: 244 TIADFVADVRAPTPSAAAELVSRDHRHKQQALHQWQAKLASAMRHYLAQQDTQFARLQHK 303

Query: 314 LPNS--DQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQ 371
           L        L   + +LD L   LE  ++  +  + + ++ + ++I+    IH I++ R 
Sbjct: 304 LDKQHPQARLERQQQQLDELSLRLEQKMQQRLATQQQRWDRLSHKIELHSPIHLIRQQRF 363

Query: 372 HILEKQQHIEQIVKQHLRYIFLEKKEKIAIL 402
           ++++++Q I Q ++++L    ++ + ++A+L
Sbjct: 364 NLIQQEQRINQSIQRYL----IQSRHQLALL 390


>gi|39996866|ref|NP_952817.1| exodeoxyribonuclease VII large subunit [Geobacter sulfurreducens
           PCA]
 gi|81832034|sp|Q74CA7|EX7L_GEOSL RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|39983754|gb|AAR35144.1| exodeoxyribonuclease VII, large subunit [Geobacter sulfurreducens
           PCA]
 gi|298505879|gb|ADI84602.1| exodeoxyribonuclease VII, large subunit [Geobacter sulfurreducens
           KN400]
          Length = 447

 Score =  239 bits (610), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 157/459 (34%), Positives = 249/459 (54%), Gaps = 25/459 (5%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M+ FS+K  L     +VS+L+  ++ ++E N  HV V GE+S      +SGH YF+LKD 
Sbjct: 1   MDIFSEKRIL-----TVSQLTSLIRGVLEENFEHVWVEGEVSNL-ATPASGHLYFTLKDG 54

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            ++I  ++++ +   ++F P +G+  +V G++T +    +YQ+++E L P G G L  A 
Sbjct: 55  AAQIRCVMFRASSRALKFRPRDGMGLIVRGRVTVYDQRGEYQLLVEYLEPRGIGALQLAF 114

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPV 179
            + K++L  EGLF+D+HK PIP +P+ I V+TS TGA I DIL  ++ RF  + ++I PV
Sbjct: 115 IQLKEQLAREGLFADEHKKPIPPLPQKIGVVTSATGAAIHDILTVLNRRFANVEILIRPV 174

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
           KVQG+   +EIA AI   N  + G      D++I+ RGGGS+EDLW FN+EM+ RAI  S
Sbjct: 175 KVQGEGAAEEIAAAIDDFN--RYGVI----DVMIVGRGGGSLEDLWAFNEEMVARAIHRS 228

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
            IP+ISA+GHE D+T+AD+ ADLRAPTP+ AAE+ V  KE L + L  L  RL     ++
Sbjct: 229 RIPVISAVGHEVDFTIADFVADLRAPTPSAAAELVVKSKEELAARLEFLRHRLVQGGRQV 288

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
           +  +   L+SL ++L +    +     R+D L   LE      + R     + +   ++ 
Sbjct: 289 LAERRGELDSLNRSLRDPSMLVGHLSQRVDDLSARLERGTANSVRRHRGSLDLLTTNLRL 348

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQ---HLRYIFLEKKEKIAILHMLREQTKNRIFYL 416
                 +++ R+ ++      E ++++   HLR   L    ++  L  L    +     L
Sbjct: 349 TNPAVRLERARERVIALAGRNETLLRRFLDHLREKTLVAAARLDTLSPLATMARGYSIVL 408

Query: 417 HTHIKKLIT---------RIEFILSHKIKSCHTSVSITT 446
               + L+T         R+E  L      C    S  T
Sbjct: 409 KLPERCLVTDSARLAPGDRVELCLRRGRAGCCVESSSDT 447


>gi|153828281|ref|ZP_01980948.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae 623-39]
 gi|148876235|gb|EDL74370.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae 623-39]
          Length = 446

 Score =  239 bits (609), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 137/391 (35%), Positives = 227/391 (58%), Gaps = 14/391 (3%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
           Y+VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++   ++KG   
Sbjct: 11  YTVSRLNSEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSQAQVKCAMFKGNNR 69

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
            + F P+ G + LV  +++ +     YQII+ES+ P G G L    E+ K +L  EGLF+
Sbjct: 70  LVNFKPQNGQQVLVKARLSLYEPRGDYQIILESMQPEGDGRLQQQFEQLKMQLAAEGLFA 129

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANA 193
              K P+P  P+ + +ITS TGA + DIL  +  R P L V+I+P  VQG+E   +IA A
Sbjct: 130 QTRKKPLPENPRCVGIITSRTGAALHDILHVLKRRDPNLPVVIYPTLVQGEEAAIQIAQA 189

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I + NT  E   C   D++I+ RGGGS+EDLW FN E++ R IA S IPIISA+GHE D 
Sbjct: 190 IGRANTRAE---C---DVLIVGRGGGSLEDLWCFNHEIVARTIAASEIPIISAVGHEIDV 243

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           T+AD+ AD+RAPTP+ AAE+      H Q +L   +A+L + +   +  +      L   
Sbjct: 244 TIADFVADVRAPTPSAAAELVSRDHRHKQQALHQWQAKLASAMRHYLAQQDTQFARLQHK 303

Query: 314 LPNS--DQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQ 371
           L        L   + +LD L   LE  ++  +  + + ++ + ++I+    IH I++ R 
Sbjct: 304 LDKQHPQARLERQQQQLDELSLRLEQKMQRRLATQQQRWDRLSHKIELHSPIHLIRQQRF 363

Query: 372 HILEKQQHIEQIVKQHLRYIFLEKKEKIAIL 402
           ++++++Q I Q ++++L    ++ + ++A+L
Sbjct: 364 NLIQQEQRINQSIQRYL----IQSRHQLALL 390


>gi|147675003|ref|YP_001216251.1| exodeoxyribonuclease VII large subunit [Vibrio cholerae O395]
 gi|262168786|ref|ZP_06036481.1| exodeoxyribonuclease VII large subunit [Vibrio cholerae RC27]
 gi|172047437|sp|A5F3E9|EX7L_VIBC3 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|146316886|gb|ABQ21425.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae O395]
 gi|227012590|gb|ACP08800.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae O395]
 gi|262022904|gb|EEY41610.1| exodeoxyribonuclease VII large subunit [Vibrio cholerae RC27]
          Length = 446

 Score =  239 bits (609), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 137/391 (35%), Positives = 227/391 (58%), Gaps = 14/391 (3%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
           Y+VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++   ++KG   
Sbjct: 11  YTVSRLNSEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSQAQVKCAMFKGNNR 69

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
            + F P+ G + LV  +++ +     YQII+ES+ P G G L    E+ K +L  EGLF+
Sbjct: 70  LVNFKPQNGQQVLVKARLSLYEPRGDYQIILESMQPEGDGRLQQQFEQLKMQLAAEGLFA 129

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANA 193
              K P+P  P+ + +ITS TGA + DIL  +  R P L V+I+P  VQG+E   +IA A
Sbjct: 130 QTRKKPLPENPRCVGIITSRTGAALHDILHVLKRRDPNLPVVIYPTLVQGEEAAIQIAQA 189

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I + NT  E   C   D++I+ RGGGS+EDLW FN E++ R IA S IPIISA+GHE D 
Sbjct: 190 IGRANTRAE---C---DVLIVGRGGGSLEDLWCFNHEIVARTIAASEIPIISAVGHEIDV 243

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           T+AD+ AD+RAPTP+ AAE+      H Q +L   +A+L + +   +  +      L   
Sbjct: 244 TIADFVADVRAPTPSAAAELVSRDHRHKQQALHQWQAKLASTMRHYLAQQETQFARLQHK 303

Query: 314 LPNS--DQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQ 371
           L        L   + +LD L   LE  ++  +  + + ++ + ++I+    IH I++ R 
Sbjct: 304 LDKQHPQARLERQQQQLDELSLRLEQKMQQRLATQQQRWDRLSHKIELHSPIHLIRQQRF 363

Query: 372 HILEKQQHIEQIVKQHLRYIFLEKKEKIAIL 402
           ++++++Q I Q ++++L    ++ + ++A+L
Sbjct: 364 NLIQQEQRINQSIQRYL----IQSRHQLALL 390


>gi|206579351|ref|YP_002237142.1| exodeoxyribonuclease VII, large subunit [Klebsiella pneumoniae 342]
 gi|226736766|sp|B5XNM2|EX7L_KLEP3 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|206568409|gb|ACI10185.1| exodeoxyribonuclease VII, large subunit [Klebsiella pneumoniae 342]
          Length = 463

 Score =  239 bits (609), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 156/504 (30%), Positives = 248/504 (49%), Gaps = 65/504 (12%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
           ++VS L+  ++ ++E  +  V + GEIS +    SSGH YF+LKD+++++   +++ +  
Sbjct: 10  FTVSRLNQTVRLLLEREMGQVWISGEISNF-SQPSSGHWYFTLKDDNAQVRCAMFRNSNR 68

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
           ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K +L  EGLF 
Sbjct: 69  RVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAQLTAEGLFE 128

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANA 193
            +HK  +P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ P +I  A
Sbjct: 129 QKHKQALPSPAHCVGVITSKTGAALHDILHVLRRRDPGLPVIIYPTAVQGDDAPGQIVRA 188

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I   N  +E   C   D++I+ RGGGS+EDLW FNDE + RAI  S IPI+SA+GHETD 
Sbjct: 189 IALANARQE---C---DVLIVGRGGGSLEDLWSFNDERVARAIFASQIPIVSAVGHETDV 242

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           T+AD+ ADLRAPTP+ AAE                      I+ R           LL+ 
Sbjct: 243 TIADFVADLRAPTPSAAAE----------------------IVSR-------NQQELLRQ 273

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           L +  Q               LE  ++  +  + R F  + +R++        Q++ Q  
Sbjct: 274 LQSGQQ--------------RLEMAMDYFLASRQRRFTQLFHRLQ--------QQHPQLR 311

Query: 374 LEKQQHIEQIVKQHLRYIF------LEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRI 427
           L +QQ   + ++Q +R          E+++K  +  +     + RI    + I++L  R+
Sbjct: 312 LARQQTALERLRQRMRIAVESQLKRAEQRQKRTVQRLDHYNPQPRIHRAQSRIQQLEYRL 371

Query: 428 EFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILI 487
              +  ++             L++ +   TL RGY+     +   + Q + + T   +  
Sbjct: 372 AENMRGRLSERRERFGNAVTHLEAVSPLATLARGYSVTSVNDGTVLKQTKQVKTGDLLTT 431

Query: 488 NFFDGQANAIVINKAPPKEQPTKK 511
              DG   + V   AP K+   +K
Sbjct: 432 RLKDGWVESEVKQIAPVKKTRARK 455


>gi|255311132|ref|ZP_05353702.1| exodeoxyribonuclease VII large subunit [Chlamydia trachomatis 6276]
 gi|255317433|ref|ZP_05358679.1| exodeoxyribonuclease VII large subunit [Chlamydia trachomatis
           6276s]
          Length = 516

 Score =  239 bits (609), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 173/522 (33%), Positives = 261/522 (50%), Gaps = 58/522 (11%)

Query: 9   SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAII 68
           S+  P   VS L+  +K+++E N   V V+GE+S    + +SGH YF++KD+ + ++   
Sbjct: 2   SITSPPIEVSVLTDSIKNLLEKNFLRVVVKGELSNV-SLQTSGHLYFAIKDSKAVLNGAF 60

Query: 69  WKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLL 128
           +       +  P++G   ++ GK+T +    +YQI+  +L  SG G LL   E+RK++L 
Sbjct: 61  FHFRSKYFDRKPKDGDYVILHGKLTVYAPRGQYQIVAYALTFSGEGNLLQQFEERKQRLA 120

Query: 129 EEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCR-FPLRVIIFPVKVQGDECP 187
            EG F  + K P+P   ++I VITSPTGAVI+DIL+ +S R    +VI++PV VQG    
Sbjct: 121 AEGYFDPKRKKPLPSGARVIGVITSPTGAVIQDILRVLSRRCHQFQVILYPVTVQGATAA 180

Query: 188 KEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAI 247
           +EI+ AI   N    G        +I+ARGGGSIEDLW FN+E +V++I  SSIPIISA+
Sbjct: 181 QEISQAIQFFNQNSMG-----VHALIIARGGGSIEDLWAFNEEELVKSIVASSIPIISAV 235

Query: 248 GHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTL 307
           GHETD+TL D+A+D+RAPTP+ AAE+     +  +  L NL   + +   + I  K N L
Sbjct: 236 GHETDFTLCDFASDVRAPTPSAAAEIVCKSSDQYRQELQNLRRYVLSHARQFIAAKKNLL 295

Query: 308 NSLLKALPNSD------QTLSCSRYRLDRLPRELEHNLEIII--FRKYRHFNHIINRIKS 359
               + L + D      QTL    Y L  L R +E  LE     F +YR +      +KS
Sbjct: 296 THWQRHLASVDFYHTAQQTLD---YTLAALERGIETKLEYYKQRFAQYRRW------LKS 346

Query: 360 DFLIHNIQKN------------RQHILEKQQHIEQIV--------------KQHLRYIFL 393
           D LI  I+K+            +  I  K+  + Q+                QH R I  
Sbjct: 347 DVLI-RIEKHLADLNQSLMLSIKNKIYTKKTSLNQLYTSCLKNELLNLQHHTQHSRNILS 405

Query: 394 EKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFA 453
           +   ++ I     +QT          + +L   + F + H +               S  
Sbjct: 406 QLSRRLHIAIASSQQTHQEC------LVRLQNELSFTIHHLLTKAKERCQAIQEQASSLN 459

Query: 454 YKNTLKRGYTSIQDTNNNF-ITQKRNLATKTRILINFFDGQA 494
            KN LKRG+  + D N +F I    +L     + +   DG+A
Sbjct: 460 PKNVLKRGFAQLFDFNKHFVIISAESLKQSDLVRVCLQDGEA 501


>gi|153800572|ref|ZP_01955158.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae MZO-3]
 gi|124123861|gb|EAY42604.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae MZO-3]
          Length = 446

 Score =  239 bits (609), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 136/391 (34%), Positives = 227/391 (58%), Gaps = 14/391 (3%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
           Y+VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++   ++KG   
Sbjct: 11  YTVSRLNSEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSQAQVKCAMFKGNNR 69

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
            + F P+ G + LV  +++ +     YQII+ES+ P G G L    E+ K +L  EGLF+
Sbjct: 70  LVNFKPQNGQQVLVKARLSLYEPRGDYQIILESMQPEGDGRLQQQFEQLKMQLAAEGLFA 129

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANA 193
              K P+P  P+ + +ITS TGA + DIL  +  R P L V+I+P  VQG+E   +IA A
Sbjct: 130 QTRKKPLPENPRCVGIITSRTGAALHDILHVLKRRDPNLPVVIYPTLVQGEEAAIQIAQA 189

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I + NT  E   C   D++I+ RGGGS+EDLW FN E++ R IA S IPIISA+GHE D 
Sbjct: 190 IGRANTRAE---C---DVLIVGRGGGSLEDLWCFNHEIVARTIAASEIPIISAVGHEIDV 243

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           T+AD+ AD+RAPTP+ AAE+      H Q +L   +A+L + +   +  +      L   
Sbjct: 244 TIADFVADVRAPTPSAAAELVSRDHRHKQQALHQWQAKLASTMRHYLAQQDTQFARLQHK 303

Query: 314 LPNS--DQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQ 371
           L        L   + +LD L   LE  ++  +  + + ++ + ++I+    IH +++ R 
Sbjct: 304 LDKQHPQARLERQQQQLDELSLRLEQKMQQRLATQQQRWDRLSHKIELHSPIHLVRQQRF 363

Query: 372 HILEKQQHIEQIVKQHLRYIFLEKKEKIAIL 402
           ++++++Q I Q ++++L    ++ + ++A+L
Sbjct: 364 NLIQQEQRINQSIQRYL----IQSRHQLALL 390


>gi|284801746|ref|YP_003413611.1| exodeoxyribonuclease VII large subunit [Listeria monocytogenes
           08-5578]
 gi|284994888|ref|YP_003416656.1| exodeoxyribonuclease VII large subunit [Listeria monocytogenes
           08-5923]
 gi|284057308|gb|ADB68249.1| exodeoxyribonuclease VII large subunit [Listeria monocytogenes
           08-5578]
 gi|284060355|gb|ADB71294.1| exodeoxyribonuclease VII large subunit [Listeria monocytogenes
           08-5923]
          Length = 450

 Score =  239 bits (609), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 131/365 (35%), Positives = 212/365 (58%), Gaps = 10/365 (2%)

Query: 28  VESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNKIEFLPEEGIEFL 87
           V+  +  V VRGEIS  +   +SGH YF++KD  + + ++++   + KI F+PE+G+  L
Sbjct: 22  VDPYMKQVFVRGEISNLKQ-PASGHLYFTVKDEFAMLRSVMFHKAVQKIGFVPEDGMNVL 80

Query: 88  VIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSDQHKNPIPFIPKI 147
           V G+I  F  + +YQ   E + P G G L   LE+ K +L +EGLF++ HK  +P  P  
Sbjct: 81  VTGRIGVFTKAGRYQFYAEHMEPDGVGALYIQLEQLKAQLEKEGLFAETHKKVLPSFPSK 140

Query: 148 IAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANAILQLNTLKEGRTC 206
           +AV+TS TGA +RDIL  I  R P + VI++P  VQG++  ++I   I ++N   +    
Sbjct: 141 VAVVTSKTGAAVRDILTTIHRRMPSVEVIVYPTIVQGEKAAQKIVENIGKINQRND---- 196

Query: 207 PRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWTLADYAADLRAPT 266
              D++I+ RGGGS+E+LW FN+E +VRA+ +S +P+ISA+GHETD+ L+D++AD+RA T
Sbjct: 197 --IDVMIIGRGGGSLEELWAFNEEPVVRAVYDSDVPVISAVGHETDFALSDFSADVRAAT 254

Query: 267 PTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK--ALPNSDQTLSCS 324
           PT AAE+AVP    L+  L   + RL  +  ++++ K  +L  L +   L      L   
Sbjct: 255 PTAAAELAVPDYRDLEERLAERKYRLLAVTRQVLERKERSLEQLKQHLILNGPKHQLEQQ 314

Query: 325 RYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHILEKQQHIEQIV 384
             R D     L +     IF K   F+ + +R+        I+  ++ +  + Q +++ +
Sbjct: 315 MERTDYFSERLNNAFSKQIFVKQTAFDRLNDRLHYYHPNKEIELQKEQMTLRLQALDKAM 374

Query: 385 KQHLR 389
           KQ L+
Sbjct: 375 KQLLK 379


>gi|229505620|ref|ZP_04395130.1| exodeoxyribonuclease VII large subunit [Vibrio cholerae BX 330286]
 gi|229517830|ref|ZP_04407274.1| exodeoxyribonuclease VII large subunit [Vibrio cholerae RC9]
 gi|229344545|gb|EEO09519.1| exodeoxyribonuclease VII large subunit [Vibrio cholerae RC9]
 gi|229357843|gb|EEO22760.1| exodeoxyribonuclease VII large subunit [Vibrio cholerae BX 330286]
          Length = 464

 Score =  239 bits (609), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 137/391 (35%), Positives = 227/391 (58%), Gaps = 14/391 (3%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
           Y+VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++   ++KG   
Sbjct: 29  YTVSRLNSEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSQAQVKCAMFKGNNR 87

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
            + F P+ G + LV  +++ +     YQII+ES+ P G G L    E+ K +L  EGLF+
Sbjct: 88  LVNFKPQNGQQVLVKARLSLYEPRGDYQIILESMQPEGDGRLQQQFEQLKMQLAAEGLFA 147

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANA 193
              K P+P  P+ + +ITS TGA + DIL  +  R P L V+I+P  VQG+E   +IA A
Sbjct: 148 QTRKKPLPENPRCVGIITSRTGAALHDILHVLKRRDPNLPVVIYPTLVQGEEAAIQIAQA 207

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I + NT  E   C   D++I+ RGGGS+EDLW FN E++ R IA S IPIISA+GHE D 
Sbjct: 208 IGRANTRAE---C---DVLIVGRGGGSLEDLWCFNHEIVARTIAASEIPIISAVGHEIDV 261

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           T+AD+ AD+RAPTP+ AAE+      H Q +L   +A+L + +   +  +      L   
Sbjct: 262 TIADFVADVRAPTPSAAAELVSRDHRHKQQALHQWQAKLASTMRHYLAQQETQFARLQHK 321

Query: 314 LPNS--DQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQ 371
           L        L   + +LD L   LE  ++  +  + + ++ + ++I+    IH