BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780791|ref|YP_003065204.1| exodeoxyribonuclease VII large
subunit [Candidatus Liberibacter asiaticus str. psy62]
         (529 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|241207230|ref|YP_002978326.1| exodeoxyribonuclease VII large subunit [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240861120|gb|ACS58787.1| exodeoxyribonuclease VII, large subunit [Rhizobium leguminosarum
           bv. trifolii WSM1325]
          Length = 526

 Score =  476 bits (1226), Expect = e-132,   Method: Composition-based stats.
 Identities = 240/526 (45%), Positives = 328/526 (62%), Gaps = 4/526 (0%)

Query: 4   FSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSR 63
           F   +  +  EYSVSELS  +K  VE+    V VRGEISGYRG HSSGHAYF+LKD+ +R
Sbjct: 5   FDGDSPTNLAEYSVSELSGSIKRTVETAFDQVRVRGEISGYRGPHSSGHAYFALKDDRAR 64

Query: 64  IDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKR 123
           IDA+IWKGT ++++F PEEG+E +  GK+TTFPGSSKYQI+IE+L P+G+G L+  +E+R
Sbjct: 65  IDAVIWKGTFSRLKFRPEEGMEVIATGKVTTFPGSSKYQIVIETLEPAGAGALMALIEER 124

Query: 124 KKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQG 183
           K+KL  EGLF    K  +PF+P +I V+TSPTGAVIRDIL RIS RFP+ V+++PVKVQG
Sbjct: 125 KRKLGAEGLFDAARKKRLPFMPGVIGVVTSPTGAVIRDILHRISDRFPVHVLVWPVKVQG 184

Query: 184 DECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPI 243
           +   +E+ANAI   N L+     PRPD++I+ARGGGS+EDLW FNDE++VRA A S IP+
Sbjct: 185 EGSGEEVANAIRGFNALEPSGAIPRPDVLIVARGGGSLEDLWSFNDEIVVRAAAESRIPL 244

Query: 244 ISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYK 303
           ISA+GHETDWTL DYAAD+RAPTPTGAAEMAVPVK  L++    L ARL   + R +  +
Sbjct: 245 ISAVGHETDWTLIDYAADVRAPTPTGAAEMAVPVKAELEAQAAALAARLQGCMNRQMDQR 304

Query: 304 INTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLI 363
             ++ +L++ALP+ DQ L+  R R D     L   LE+    K R F  +   ++ D L 
Sbjct: 305 RQSVRALMRALPSLDQLLALPRRRFDEAATGLGRGLELNTINKRRGFERVAAHLRPDLLA 364

Query: 364 HNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKL 423
             I + RQ + E+    E++V++ +           AIL  L  + K +       +  L
Sbjct: 365 GRIAERRQTLNERMARAERMVERLIDRSKSRVDRAEAILASLPARLKTQTDRGRERLGNL 424

Query: 424 ITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKT 483
               +  + H++      +S   R+LQS +YKN LKRGY  I+D +N  ++Q   L+   
Sbjct: 425 SRHADTAVRHQLTRARAELSSQDRVLQSLSYKNVLKRGYAVIRDEDNRPVSQAAQLSAGM 484

Query: 484 RILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
            I I F DG+  A+          P    +  + +      QG LF
Sbjct: 485 GIAIEFADGRVGAMTTEGGA----PPAGAKKRSARPADPPKQGSLF 526


>gi|116250050|ref|YP_765888.1| exodeoxyribonuclease VII large subunit [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|158564215|sp|Q1MMN0|EX7L_RHIL3 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|115254698|emb|CAK05772.1| putative exodeoxyribonuclease VII large subunit [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 526

 Score =  476 bits (1224), Expect = e-132,   Method: Composition-based stats.
 Identities = 242/526 (46%), Positives = 333/526 (63%), Gaps = 4/526 (0%)

Query: 4   FSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSR 63
           F   +  +  EYSVSELS  +K  VE+    V VRGEISGYRG HSSGHAYF+LKD+ +R
Sbjct: 5   FDGDSPTNLAEYSVSELSGSIKRTVETAFDQVRVRGEISGYRGPHSSGHAYFALKDDRAR 64

Query: 64  IDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKR 123
           IDA+IWKGT ++++F PEEG+E +  GK+TTFPGSSKYQI+IE+L P+G+G L+  +E+R
Sbjct: 65  IDAVIWKGTFSRLKFRPEEGMEVIATGKVTTFPGSSKYQIVIETLEPAGAGALMALIEER 124

Query: 124 KKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQG 183
           K+KL  EGLF    K  +PF+P +I V+TSPTGAVIRDIL RIS RFP+ V+++PVKVQG
Sbjct: 125 KRKLGAEGLFDAARKKRLPFMPGVIGVVTSPTGAVIRDILHRISDRFPVHVLVWPVKVQG 184

Query: 184 DECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPI 243
           +   +E+ANAI   N L+   T PRPD++I+ARGGGS+EDLW FNDE++VRA A S+IP+
Sbjct: 185 EGSGEEVANAIRGFNALEPSGTIPRPDVLIVARGGGSLEDLWSFNDEIVVRAAAESAIPL 244

Query: 244 ISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYK 303
           ISA+GHETDWTL DYAAD+RAPTPTGAAEMAVPVK  L++    L ARL   + R +  +
Sbjct: 245 ISAVGHETDWTLIDYAADVRAPTPTGAAEMAVPVKAELEAQAAGLAARLQGCMNRQMDQR 304

Query: 304 INTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLI 363
             ++ +L++ALP+ DQ L+  R R D     L   LE+    K R F  +   ++ D L 
Sbjct: 305 RQSVRALMRALPSLDQLLALPRRRFDEAATGLGRGLELNTINKRRGFERVAAHLRPDLLA 364

Query: 364 HNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKL 423
             I + RQ + E+    E++V++ +           AIL  L  + K +       +  L
Sbjct: 365 GRIAERRQTLNERMARAERMVERLIDRSKSRVDRAEAILASLPARLKTQTDRGRERLGNL 424

Query: 424 ITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKT 483
               +  + H++    + +S   R+LQS +YKN LKRGY  I+D +N  ++Q  +L+   
Sbjct: 425 SRHADTAVRHQLTRARSELSAQDRVLQSLSYKNVLKRGYAVIRDEDNRPVSQAAHLSAGM 484

Query: 484 RILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
            I I F DG+  A+          P    +  + K  +   QG LF
Sbjct: 485 GIAIEFADGRVGAMTTEGG----TPPAGAKKRSTKPAEPPKQGSLF 526


>gi|190889943|ref|YP_001976485.1| exodeoxyribonuclease VII protein, large subunit [Rhizobium etli
           CIAT 652]
 gi|226697598|sp|B3PYF6|EX7L_RHIE6 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|190695222|gb|ACE89307.1| exodeoxyribonuclease VII protein, large subunit [Rhizobium etli
           CIAT 652]
          Length = 526

 Score =  474 bits (1220), Expect = e-131,   Method: Composition-based stats.
 Identities = 243/528 (46%), Positives = 330/528 (62%), Gaps = 4/528 (0%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           N F   +  +  EYSVSELS  +K  VE+    V VRGEISGYRG HSSGHAYF+LKD+ 
Sbjct: 3   NLFDSDSPTNLAEYSVSELSGSIKRTVETAFDQVRVRGEISGYRGPHSSGHAYFALKDDR 62

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           +RIDA+IWKGT ++++F PEEG+E +  GK+TTFPGSSKYQI+IE+L P+G+G L+  +E
Sbjct: 63  ARIDAVIWKGTFSRLKFRPEEGMEVIATGKVTTFPGSSKYQIVIETLEPAGAGALMALIE 122

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           +RK+KL  EGLF    K  +PF+PK+I V+TSPTGAVIRDIL RIS RFP+ V+++PVKV
Sbjct: 123 ERKRKLGAEGLFDAARKKRLPFMPKVIGVVTSPTGAVIRDILHRISDRFPVHVLVWPVKV 182

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QG+    E+ANAI   N L+ G    RPD++I+ARGGGS+EDLW FNDE++VRA A S I
Sbjct: 183 QGEGAGDEVANAIRGFNALEPGGAIARPDVLIVARGGGSLEDLWSFNDEIVVRAAAESRI 242

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETDWTL DYAAD+RAPTPTGAAEMAVPVK  L++    L ARL   I R + 
Sbjct: 243 PLISAVGHETDWTLIDYAADVRAPTPTGAAEMAVPVKAELEAQATALAARLQGCINRQMD 302

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            +  ++ +L++ALP+ DQ L+  R R D     L   LE+    K R F  + + ++ D 
Sbjct: 303 QRRQSVRALMRALPSLDQLLALPRRRFDEAAAGLGRGLELNTINKRRGFERVASHLRPDV 362

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIK 421
           L + I + RQ + ++    E+ V++ L           AIL  L  + K +       + 
Sbjct: 363 LSNRIAERRQLLNDRMARAERTVERLLDRSKSRIDRAEAILASLPTRLKTQTDRGRERLG 422

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLAT 481
            L    +  + H++      +S   R+LQS +YKN LKRGY  I+D ++  ++Q   L+ 
Sbjct: 423 NLTRHADTAIRHQLTRARAELSAQDRVLQSLSYKNVLKRGYAVIRDEDDRPVSQAAALSA 482

Query: 482 KTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
              I I F DG+  A+          P    +  + K      QG LF
Sbjct: 483 GMGIAIEFADGRVGAMTTEGG----TPPAGAKKRSAKPADPTKQGSLF 526


>gi|254780791|ref|YP_003065204.1| exodeoxyribonuclease VII large subunit [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040468|gb|ACT57264.1| exodeoxyribonuclease VII large subunit [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 529

 Score =  473 bits (1218), Expect = e-131,   Method: Composition-based stats.
 Identities = 529/529 (100%), Positives = 529/529 (100%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN
Sbjct: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
           HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL
Sbjct: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK
Sbjct: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS
Sbjct: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI
Sbjct: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD
Sbjct: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420
           FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI
Sbjct: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420

Query: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480
           KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA
Sbjct: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480

Query: 481 TKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
           TKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF
Sbjct: 481 TKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529


>gi|209551852|ref|YP_002283769.1| exodeoxyribonuclease VII large subunit [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|226697599|sp|B5ZYC6|EX7L_RHILW RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|209537608|gb|ACI57543.1| exodeoxyribonuclease VII, large subunit [Rhizobium leguminosarum
           bv. trifolii WSM2304]
          Length = 527

 Score =  473 bits (1216), Expect = e-131,   Method: Composition-based stats.
 Identities = 239/526 (45%), Positives = 329/526 (62%), Gaps = 3/526 (0%)

Query: 4   FSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSR 63
           F   +  +  EYSVSELS  +K  VE+    V VRGEISGYRG HSSGHAYF+LKD+ +R
Sbjct: 5   FDSDSPTNLAEYSVSELSGSIKRTVETAFDQVRVRGEISGYRGPHSSGHAYFALKDDRAR 64

Query: 64  IDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKR 123
           IDA+IWKGT ++++F PEEG+E +  GK+TTFPGSSKYQI+IE+L P+G+G L+  +E+R
Sbjct: 65  IDAVIWKGTFSRLKFRPEEGMEVIATGKVTTFPGSSKYQIVIETLEPAGAGALMALIEER 124

Query: 124 KKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQG 183
           K+KL  EGLF    K  +PF+P++I V+TSPTGAVIRDIL RIS RFP+ V+++PVKVQG
Sbjct: 125 KRKLGAEGLFDAARKKRLPFMPRVIGVVTSPTGAVIRDILHRISDRFPVHVLVWPVKVQG 184

Query: 184 DECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPI 243
           +   +E+ANAI   N L+     PRPD++I+ARGGGS+EDLW FNDE++VRA A S IP+
Sbjct: 185 EGSGEEVANAIRGFNALEPAGLIPRPDVLIVARGGGSLEDLWSFNDEIVVRAAAESRIPL 244

Query: 244 ISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYK 303
           ISA+GHETDWTL DYAAD+RAPTPTGAAEMAVPVK  L++    L ARL   + R +  +
Sbjct: 245 ISAVGHETDWTLIDYAADVRAPTPTGAAEMAVPVKAELEAQAAALAARLQGCMNRQMDQR 304

Query: 304 INTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLI 363
             ++ +L++ALP+ DQ L+  R R D     L   LE+    K R F  +   ++ D L 
Sbjct: 305 RQSVRALMRALPSLDQLLALPRRRFDEAAAGLGRGLELNTINKRRGFERVGAHLRPDLLS 364

Query: 364 HNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKL 423
             I + RQ + E+    E++V++ +           AIL  L  + K +       +  L
Sbjct: 365 GRIAERRQTLNERIVRAERMVERLIDRSKSRIDRAEAILASLPARFKTQTDRSREALANL 424

Query: 424 ITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKT 483
               +  + H++      +S   R+LQS +YKN LKRGY  I+D ++  ++Q   L+  +
Sbjct: 425 SRHGDTAIRHQLARARAELSAQDRVLQSLSYKNVLKRGYAVIRDEDDRPVSQAAALSAGS 484

Query: 484 RILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
            + I F DG+  A+      P     K+             QG LF
Sbjct: 485 AVSIEFSDGRIGAVTTEGGAPPASLKKRPAREAG---DPPKQGSLF 527


>gi|327191973|gb|EGE58954.1| exodeoxyribonuclease VII protein, large subunit [Rhizobium etli
           CNPAF512]
          Length = 526

 Score =  472 bits (1214), Expect = e-131,   Method: Composition-based stats.
 Identities = 242/526 (46%), Positives = 329/526 (62%), Gaps = 4/526 (0%)

Query: 4   FSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSR 63
           F   +  +  EYSVSELS  +K  VE+    V VRGEISGYRG HSSGHAYFSLKD+ +R
Sbjct: 5   FDSDSPTNLAEYSVSELSGSIKRTVETAFDQVRVRGEISGYRGPHSSGHAYFSLKDDRAR 64

Query: 64  IDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKR 123
           IDA+IWKGT ++++F PEEG+E +  GK+TTFPGSSKYQI+IE+L P+G+G L+  +E+R
Sbjct: 65  IDAVIWKGTFSRLKFRPEEGMEVIATGKVTTFPGSSKYQIVIETLEPAGAGALMALIEER 124

Query: 124 KKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQG 183
           K++L  EGLF    K  +PF+PK+I V+TSPTGAVIRDIL RIS RFP+ V+++PVKVQG
Sbjct: 125 KRRLGAEGLFDAARKKRLPFMPKVIGVVTSPTGAVIRDILHRISDRFPVHVLVWPVKVQG 184

Query: 184 DECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPI 243
           +   +E+ANAI   N L+ G    RPD++I+ARGGGS+EDLW FNDE +VRA A S IP+
Sbjct: 185 EGSGEEVANAIRGFNALEPGGAIARPDVLIVARGGGSLEDLWSFNDETVVRAAAESRIPL 244

Query: 244 ISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYK 303
           ISA+GHETDWTL DYAAD+RAPTPTGAAEMAVPVK  L++    L ARL   + R +  +
Sbjct: 245 ISAVGHETDWTLIDYAADVRAPTPTGAAEMAVPVKAELEAQAAALAARLQGCMNRQMDQR 304

Query: 304 INTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLI 363
             ++ +L++ALP+ DQ L+  R R D     L   LE+    K R F  + + ++ D L 
Sbjct: 305 RQSVRALMRALPSLDQLLALPRRRFDEAAAGLGRGLELNTINKRRGFERVASHLRPDVLS 364

Query: 364 HNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKL 423
           + I + RQ + E+    E+ V++ L           AIL  L  + K +       +  L
Sbjct: 365 NRIAERRQLLSERMARAERTVERLLDRSKSRIDRAEAILASLPARLKTQTDRGRERLGNL 424

Query: 424 ITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKT 483
               +  + H++      +S   R+LQS +YKN LKRGY  I+D ++  ++Q   L+   
Sbjct: 425 TRHADTAIRHQLTRARAELSAQDRVLQSLSYKNVLKRGYAVIRDEDDRPVSQAAALSAGM 484

Query: 484 RILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
            I I F DG+  A+          P    +  + K      QG LF
Sbjct: 485 GIAIEFADGRVGAMTTEGGA----PPASAKKRSAKPADPTKQGTLF 526


>gi|86355934|ref|YP_467826.1| exodeoxyribonuclease VII large subunit [Rhizobium etli CFN 42]
 gi|123513318|sp|Q2KDI7|EX7L_RHIEC RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|86280036|gb|ABC89099.1| exodeoxyribonuclease VII large subunit protein [Rhizobium etli CFN
           42]
          Length = 526

 Score =  469 bits (1206), Expect = e-130,   Method: Composition-based stats.
 Identities = 239/528 (45%), Positives = 330/528 (62%), Gaps = 4/528 (0%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           N F   +  +  EYSVSELS  +K  +E+    V VRGEISGYRG HSSGHAYF+LKD+ 
Sbjct: 3   NLFDSDSPTNLAEYSVSELSGSIKRTIETAFDQVRVRGEISGYRGPHSSGHAYFALKDDR 62

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           +RIDA+IWKGT ++++F PEEG+E +  GK+TTFPGSSKYQI+IE+L P+G+G L+  +E
Sbjct: 63  ARIDAVIWKGTFSRLKFRPEEGMEVIATGKVTTFPGSSKYQIVIETLEPAGAGALMALIE 122

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           +RK++L  EGLF    K  +PF+P +I V+TSPTGAVIRDIL RIS RFP+ V+++PVKV
Sbjct: 123 ERKRRLGAEGLFDAARKKRLPFMPHVIGVVTSPTGAVIRDILHRISDRFPVHVLVWPVKV 182

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QG+   +E+ANAI   N L+      RPD++I+ARGGGS+EDLW FNDE++VRA A S I
Sbjct: 183 QGEGSGEEVANAIRGFNALEPASAISRPDVLIVARGGGSLEDLWSFNDEIVVRAAAESRI 242

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETDWTL DYAAD+RAPTPTGAAEMAVPVK  L++    L ARL   + R + 
Sbjct: 243 PLISAVGHETDWTLIDYAADVRAPTPTGAAEMAVPVKAELEAQAAALAARLQGCMNRQMD 302

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            +  ++ SL++A P+ DQ L+  R R D     L   LE+    K R F  +I  ++ D 
Sbjct: 303 QRRQSVRSLMRAFPSLDQLLALPRRRFDEAAAGLGRGLELNTINKRRGFERVIAHLRPDL 362

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIK 421
           L   I + RQ + E+    E++V++ +       +   AIL  L  + K +       + 
Sbjct: 363 LSGRISERRQMLNERMVRAERMVERLIDRSASRVERAEAILASLPARLKAQTDRSRERLG 422

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLAT 481
            L    +  + H++      +S   R+LQS +YKN L+RGY  I+D +N  ++Q   L+ 
Sbjct: 423 NLTRHADTAIRHQLTRARAELSAQDRVLQSLSYKNVLRRGYAVIRDEDNRPVSQAAALSA 482

Query: 482 KTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
              I I F DG+  A+          P    +  + K  +   QG LF
Sbjct: 483 GMGIAIEFADGRIGAMTTEGG----TPPGGAKKRSTKPAEPTKQGSLF 526


>gi|163757587|ref|ZP_02164676.1| putative exodeoxyribonuclease VII large subunit [Hoeflea
           phototrophica DFL-43]
 gi|162285089|gb|EDQ35371.1| putative exodeoxyribonuclease VII large subunit [Hoeflea
           phototrophica DFL-43]
          Length = 530

 Score =  458 bits (1179), Expect = e-127,   Method: Composition-based stats.
 Identities = 223/531 (41%), Positives = 326/531 (61%), Gaps = 3/531 (0%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M+     +  +  E++VSELS  ++  VE    +V VRGEISGYRG HSSGHAYFSLKD+
Sbjct: 1   MSSLLDDSPTNAAEFTVSELSGSIRRTVEDAFGNVRVRGEISGYRGPHSSGHAYFSLKDD 60

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            +RI+A+IWKG  ++++  PEEG+E +  GKITT+ GSSKYQI+IES+ P+G+G L+  +
Sbjct: 61  RARIEAVIWKGVFSRLKHRPEEGLEVIATGKITTYAGSSKYQIVIESIEPAGAGALMALI 120

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           E+R+ KL  EGLF +  K  +P++P +I V+TSPTGAVIRDIL RI  RFP+ VI++PV+
Sbjct: 121 EERRCKLAAEGLFDEARKQLLPYMPLVIGVVTSPTGAVIRDILHRIEDRFPVHVIVWPVR 180

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQGD    E+ANAI   N L  G    RPD+II+ARGGGS+EDLW FNDE +VRA A S 
Sbjct: 181 VQGDTSGNEVANAITGFNALAPGGRIKRPDLIIVARGGGSLEDLWGFNDEAVVRAAAESD 240

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP+ISA+GHETDWTL D+A+D RAPTPTGAAEMAVPVK  L++ L  L ARL +   R++
Sbjct: 241 IPLISAVGHETDWTLIDHASDRRAPTPTGAAEMAVPVKADLEAHLAGLAARLKSAQSRML 300

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
             +   +  L +ALP  D  L+  R RLDR  + L   L++    + R F     RI   
Sbjct: 301 DRRREAVRGLTRALPTLDSVLALPRQRLDRSGQGLGQALQLNTANRRRGFERQAARITPI 360

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420
            L+  I++ RQ + ++    ++ +++ +  +    +    +L  +  +      +    +
Sbjct: 361 ALVSAIREKRQVLRDRATRADRSLERRVEVLRTGLERHALVLSAVPRRITETQTHARERL 420

Query: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480
             L  R E  L+  I     ++    R+L+S +Y++ L RGY  +++ +   +++   + 
Sbjct: 421 TGLGRRGETALTQLIGQHKRALGAQARMLKSLSYQSVLGRGYAVVRNQDRKLLSRAEQVQ 480

Query: 481 TKTRILINFFDGQANAIV--INKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
           +   I + F DG+ +A+V       P  +P K+ +   NK  + G QG LF
Sbjct: 481 SGEMIGVEFADGEVSALVNGTGAEAPSSKPKKQTRTKANKTPEPG-QGSLF 530


>gi|222084548|ref|YP_002543077.1| exodeoxyribonuclease VII, large subunit [Agrobacterium radiobacter
           K84]
 gi|221721996|gb|ACM25152.1| exodeoxyribonuclease VII, large subunit [Agrobacterium radiobacter
           K84]
          Length = 571

 Score =  457 bits (1176), Expect = e-126,   Method: Composition-based stats.
 Identities = 245/538 (45%), Positives = 331/538 (61%), Gaps = 9/538 (1%)

Query: 1   MNPF-SQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKD 59
           M+ F    +  +  EYSVSELS  +K  VES    V VRGEISGYRG HSSGHAYFSLKD
Sbjct: 34  MSSFFENDSPSNLAEYSVSELSGSIKRTVESAFDQVRVRGEISGYRGPHSSGHAYFSLKD 93

Query: 60  NHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTA 119
           + +RIDA+IWKGT +K++F PEEG+E +  GK+TTFPGSSKYQI+IE+L P+G+G L+  
Sbjct: 94  DRARIDAVIWKGTFSKLKFRPEEGMEVIATGKVTTFPGSSKYQIVIETLEPAGAGALMAL 153

Query: 120 LEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPV 179
           LE+RK+KL  EGLF  + K  +PF+PK+I V+TSPTGAVIRDIL RIS RFP+ V+++PV
Sbjct: 154 LEERKRKLGAEGLFDAERKRRLPFMPKVIGVVTSPTGAVIRDILHRISDRFPVHVLVWPV 213

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
           KVQG+    E+ANAI   N +  G   PRPD++I+ARGGGS+EDLW FNDE +VRA A S
Sbjct: 214 KVQGEGSGDEVANAIRGFNEVAPGGPLPRPDVLIVARGGGSLEDLWSFNDEAVVRAAAAS 273

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
            IP+ISA+GHETDWTL DYAAD+RAPTPTGAAEMAVPVK  L++ L +  ARL   + R 
Sbjct: 274 EIPLISAVGHETDWTLIDYAADVRAPTPTGAAEMAVPVKADLEAQLASFAARLQGGVSRQ 333

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
           +  +   + +LL+ALP+ DQ L+  R R D     L   LE+    K R F    + ++ 
Sbjct: 334 MDQRRQAVRALLRALPSLDQLLALPRRRFDEAASGLGRGLELNTLNKRRTFERAASHLRP 393

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH 419
           D L + I + RQ + E+    E+ +++ +           A+   L  + + +       
Sbjct: 394 DVLSNRIVERRQMLSERMTRAERTIERMIDRARARIGRADAVFATLPSRLETQTGRARDL 453

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
           +  L  R +  + H++      ++   R+LQS +YKN LKRGY  ++D  +  ++    L
Sbjct: 454 LGNLSRRTDTAIRHQLVRARGELAAQERVLQSLSYKNVLKRGYAVVRDEADRPVSLAAAL 513

Query: 480 ATKTRILINFFDGQANAIVIN--------KAPPKEQPTKKCQLHNNKREKQGTQGELF 529
           AT   I I F DG+  A+  +        + P    P KK             QG LF
Sbjct: 514 ATGAAISIEFADGRVGAVTGDNSVAPAPTETPTGVPPQKKRVAKPAGSADPSNQGSLF 571


>gi|239833509|ref|ZP_04681837.1| exodeoxyribonuclease VII, large subunit [Ochrobactrum intermedium
           LMG 3301]
 gi|239821572|gb|EEQ93141.1| exodeoxyribonuclease VII, large subunit [Ochrobactrum intermedium
           LMG 3301]
          Length = 529

 Score =  457 bits (1176), Expect = e-126,   Method: Composition-based stats.
 Identities = 224/521 (42%), Positives = 317/521 (60%), Gaps = 4/521 (0%)

Query: 9   SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAII 68
           S +  EYSVSE+S  LK  VE    HV VRGEISGYRG HSSGHAYF+LKD+ SR++A+I
Sbjct: 13  SSNVAEYSVSEISGALKRTVEDVFGHVRVRGEISGYRGPHSSGHAYFALKDDRSRLEAVI 72

Query: 69  WKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLL 128
           W+G+++++ F PEEG+E +  GK+TT+PGSSKYQI+IE + P+G+G L+  LE+RK++L 
Sbjct: 73  WRGSMSRLRFRPEEGMEVIATGKLTTYPGSSKYQIVIEQMEPAGAGALMALLEERKRRLA 132

Query: 129 EEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPK 188
            EGLF    K  +PF+P++I V+TSPTGAVIRD++ RI+ R+PL VI++PV+VQG+    
Sbjct: 133 SEGLFDPAVKQLLPFMPRVIGVVTSPTGAVIRDVIHRIADRYPLHVIVWPVRVQGETSGP 192

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           E+A A+   NTL EG   PRPD++I+ARGGGS+EDLW FNDE++VRA+A S IP+ISA+G
Sbjct: 193 EVATAVHGFNTLPEGGAIPRPDVVIVARGGGSLEDLWGFNDEIVVRAVAASHIPVISAVG 252

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HETDWTL D AAD+RAPTPTGAAEMAVPVK  L ++L    ARL++ I R I  K  +  
Sbjct: 253 HETDWTLIDLAADIRAPTPTGAAEMAVPVKADLLAALAGQSARLSSAISRFIDLKRRSHR 312

Query: 309 SLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQK 368
           S  +ALP++DQ L+  R R D     L   L +   +K  HF   + ++    L     +
Sbjct: 313 SAARALPSADQLLALPRRRFDEAASRLTRALFVNTQKKRVHFEGHVRQLSPRLLQRRFTE 372

Query: 369 NRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIE 428
             + I    Q + + ++  LR        +   L    E    R       +++L  R +
Sbjct: 373 LERGISVLGQRLPRALETFLRERRTTFTHRANRLSA--EPILRRTKLATNSMEQLDRRRD 430

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
             +   I+          R++++ +Y++ L+RG+  + D     I Q   ++    + I 
Sbjct: 431 QAVRILIERAKRRGQELERLMRTLSYESVLERGFAVVFDAEGKPIKQAATVSAGDALSIR 490

Query: 489 FFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
           F DG  +  VI       +P K  Q    +    G QG LF
Sbjct: 491 FRDG--DVAVIADEGGGSEPAKPVQTKKVQSPGSGNQGSLF 529


>gi|15964051|ref|NP_384404.1| exodeoxyribonuclease VII large subunit [Sinorhizobium meliloti
           1021]
 gi|307301196|ref|ZP_07580958.1| exodeoxyribonuclease VII, large subunit [Sinorhizobium meliloti
           BL225C]
 gi|307321097|ref|ZP_07600502.1| exodeoxyribonuclease VII, large subunit [Sinorhizobium meliloti
           AK83]
 gi|22095673|sp|Q92SR7|EX7L_RHIME RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|15073227|emb|CAC41735.1| Putative exodeoxyribonuclease 7 large subunit [Sinorhizobium
           meliloti 1021]
 gi|306893269|gb|EFN24050.1| exodeoxyribonuclease VII, large subunit [Sinorhizobium meliloti
           AK83]
 gi|306903652|gb|EFN34239.1| exodeoxyribonuclease VII, large subunit [Sinorhizobium meliloti
           BL225C]
          Length = 526

 Score =  457 bits (1175), Expect = e-126,   Method: Composition-based stats.
 Identities = 230/526 (43%), Positives = 325/526 (61%), Gaps = 4/526 (0%)

Query: 4   FSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSR 63
           F  ++  +  EYSVSELS  +K  VE    HV VRGEISGYRG HSSGHAYF+LKD+ +R
Sbjct: 5   FDSESPSNVAEYSVSELSGSIKRTVEQAFEHVRVRGEISGYRGPHSSGHAYFALKDDRAR 64

Query: 64  IDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKR 123
           IDA++WK T  +++F PEEG+E +  G++TTFPGSSKYQI+I+SL P+G+G L+  +E+R
Sbjct: 65  IDAVVWKTTFARLKFRPEEGMEVIATGRVTTFPGSSKYQIVIDSLEPAGAGALMALIEER 124

Query: 124 KKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQG 183
           K+KL  EGLF    K P+PF+P+++ V+TSPTGAVIRDIL RI+ RFP+ VI++PV+VQG
Sbjct: 125 KRKLAAEGLFDAGRKRPLPFMPRVVGVVTSPTGAVIRDILHRIADRFPVHVIVWPVRVQG 184

Query: 184 DECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPI 243
           D   +EI  AI   N L+ G + PRPD++I+ARGGGS+EDLW FNDE +VRA A S+IP+
Sbjct: 185 DGACEEIVAAIEGFNALQPGGSIPRPDVLIVARGGGSLEDLWCFNDEAMVRAAAASAIPL 244

Query: 244 ISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYK 303
           ISA+GHETDWTL D+AAD RAPTPTGAAEMAVPVK  L++ L +L ARL     R +  +
Sbjct: 245 ISAVGHETDWTLIDHAADQRAPTPTGAAEMAVPVKADLEAQLASLAARLKGAAARQMDNR 304

Query: 304 INTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLI 363
             TL SL +ALP+ DQ L+  R R D     L   L++    K R F      ++ + L 
Sbjct: 305 RQTLRSLARALPSLDQLLALPRRRFDEAAAGLGRGLQMNTANKRRSFERNAAHLRPELLT 364

Query: 364 HNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKL 423
             I   RQ +L+     E+IV++ ++          A L +L  +   +I      +  L
Sbjct: 365 ARIVDRRQRVLDAVNRAERIVERKVQRGAQRISSADASLRVLPSRLIGQIHRASDRVSSL 424

Query: 424 ITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKT 483
             R +  ++  ++   ++++   R+LQS +Y + L+RG+  ++D     + Q   +    
Sbjct: 425 GRRGDAAIAADLRRMKSALAAQDRVLQSLSYHSVLQRGFALVRDAAGEPVKQAAAVHPGM 484

Query: 484 RILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
            + + F DG+  A+        + P K+             QG LF
Sbjct: 485 ALSLEFADGRIAAVAGEDGTAPQSPKKRPARSGEPT----KQGSLF 526


>gi|153010319|ref|YP_001371533.1| exodeoxyribonuclease VII large subunit [Ochrobactrum anthropi ATCC
           49188]
 gi|166232359|sp|A6X3A0|EX7L_OCHA4 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|151562207|gb|ABS15704.1| exodeoxyribonuclease VII, large subunit [Ochrobactrum anthropi ATCC
           49188]
          Length = 527

 Score =  456 bits (1172), Expect = e-126,   Method: Composition-based stats.
 Identities = 217/521 (41%), Positives = 318/521 (61%), Gaps = 4/521 (0%)

Query: 9   SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAII 68
           S +  EYSVSE+S  LK  VE    HV VRGEISGYRG HSSGHAYF+LKD+ +R++A+I
Sbjct: 11  SSNVAEYSVSEISGALKRTVEDTFGHVRVRGEISGYRGPHSSGHAYFALKDDRARLEAVI 70

Query: 69  WKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLL 128
           W+G+++++ F PEEG+E +  GK+TT+PGSSKYQI+IE + P+G+G L+  LE+RK++L 
Sbjct: 71  WRGSMSRLRFRPEEGMEVIATGKLTTYPGSSKYQIVIEQMEPAGAGALMALLEERKRRLA 130

Query: 129 EEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPK 188
            EGLF    K  +PF+P++I V+TSPTGAVIRDI+ RI+ R+PL VI++PV+VQG+    
Sbjct: 131 TEGLFDPAVKQLLPFMPRVIGVVTSPTGAVIRDIIHRIADRYPLHVIVWPVRVQGETSGP 190

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           E+A A+   N L +    PRPD++I+ARGGGS+EDLW FNDE++VRA+A S IP+ISA+G
Sbjct: 191 EVAAAVDGFNALPDEGNIPRPDVLIVARGGGSLEDLWGFNDEIVVRAVAASHIPVISAVG 250

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HETDWTL D AAD+RAPTPTGAAEMAVPVK  L ++L    ARL++ + R I  K     
Sbjct: 251 HETDWTLIDLAADIRAPTPTGAAEMAVPVKADLLATLAGQSARLSSAMSRFIDLKRQAHR 310

Query: 309 SLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQK 368
           S  +ALP++DQ L+  R R D     L   L +   +K  HF+    ++    L     +
Sbjct: 311 SAARALPSADQLLALPRRRFDEAAARLTRALFVNTQKKRVHFDGHARQLSPRLLQRRFTE 370

Query: 369 NRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIE 428
            ++ +    Q + + ++  LR        +   L    E    R       I++L  R +
Sbjct: 371 LQRDVSALGQRLPRALEAFLRERRTAFIHRANRLSA--EPILRRTKLTSVAIEQLDRRRD 428

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
             +   I+          R++++ +Y++ L+RG+  + D     + Q  +++    + I 
Sbjct: 429 QAVRLLIERAKRRGQELERLMRTLSYESVLERGFAVVFDEEGKPVKQAGSVSAGDALSIR 488

Query: 489 FFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
           F DG+   +  ++   + +P K  Q    +    G QG LF
Sbjct: 489 FRDGEVAVVAGDE--DESEPAKLVQTKKVQSPGSGNQGSLF 527


>gi|150398684|ref|YP_001329151.1| exodeoxyribonuclease VII large subunit [Sinorhizobium medicae
           WSM419]
 gi|166232367|sp|A6UF86|EX7L_SINMW RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|150030199|gb|ABR62316.1| exodeoxyribonuclease VII, large subunit [Sinorhizobium medicae
           WSM419]
          Length = 526

 Score =  454 bits (1168), Expect = e-125,   Method: Composition-based stats.
 Identities = 229/526 (43%), Positives = 326/526 (61%), Gaps = 4/526 (0%)

Query: 4   FSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSR 63
           F  ++  +  EYSVSELS  +K  +E    HV VRGEISGYRG HSSGHAYF+LKD+ +R
Sbjct: 5   FDSESPSNVAEYSVSELSGSIKRTIEQTFEHVRVRGEISGYRGPHSSGHAYFTLKDDRAR 64

Query: 64  IDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKR 123
           IDA++WKGT  +++F PEEG+E +  G++TTFPGSSKYQ++I++L P+G+G L+  +E+R
Sbjct: 65  IDAVVWKGTFARLKFRPEEGMEVIATGRVTTFPGSSKYQVVIDALEPAGAGALMALIEER 124

Query: 124 KKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQG 183
           K+KL  EGLF    K P+PF+PK+I V+TSPTGAVIRDIL RI+ RFP+ V+++PV+VQG
Sbjct: 125 KRKLAAEGLFDAGRKRPLPFMPKVIGVVTSPTGAVIRDILHRIADRFPVHVLVWPVRVQG 184

Query: 184 DECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPI 243
           D   +EI  AI   N L+ G    RPD++I+ARGGGS+EDLW FNDE +VRA A S+IP+
Sbjct: 185 DGACEEIVAAIEGFNALQPGGPIARPDVLIVARGGGSLEDLWCFNDEAMVRAAAGSAIPL 244

Query: 244 ISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYK 303
           ISA+GHETDWTL D+AAD RAPTPTGAAEMAVPVK  L++ L +L ARL    +R +  +
Sbjct: 245 ISAVGHETDWTLIDHAADQRAPTPTGAAEMAVPVKADLEAQLASLSARLKGAAVRQMDNR 304

Query: 304 INTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLI 363
             TL SL +ALP+ DQ L+  R R D     L   L++    K R F      ++ D L 
Sbjct: 305 RQTLRSLARALPSLDQLLALPRRRFDEAAAGLGRGLQMNTANKRRSFERSAAHLRPDLLT 364

Query: 364 HNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKL 423
             I   RQ +++     E+IV++ +           A L  L  +   ++      +  +
Sbjct: 365 ARIVDRRQRVVDAVNRAERIVERQVHRGAARVASADASLRALPSRLIGQVHRASDRVSAM 424

Query: 424 ITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKT 483
             R +  ++  ++   ++V+   R+LQS +Y+N L+RG+  ++D     + Q   + +  
Sbjct: 425 SRRADAAIAADLRRLKSAVAAQDRVLQSLSYRNVLQRGFALVRDAAGEPVKQAAAVHSGM 484

Query: 484 RILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
            + + F DG+  A+      P + P K+             QG LF
Sbjct: 485 ALSVEFADGRVAAVAGEDGTPSQAPKKRPARAGEPT----KQGSLF 526


>gi|222147129|ref|YP_002548086.1| exodeoxyribonuclease VII large subunit [Agrobacterium vitis S4]
 gi|254783685|sp|B9JYI6|EX7L_AGRVS RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|221734119|gb|ACM35082.1| exodeoxyribonuclease VII large subunit [Agrobacterium vitis S4]
          Length = 543

 Score =  452 bits (1162), Expect = e-125,   Method: Composition-based stats.
 Identities = 230/540 (42%), Positives = 325/540 (60%), Gaps = 15/540 (2%)

Query: 4   FSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSR 63
           F      +  E+SVSELS  +K  +E+    V VRGEISG+RG HSSGHAYFSLKD+ +R
Sbjct: 5   FDDDQPSNLTEFSVSELSGSIKRTIETAFDQVRVRGEISGFRGQHSSGHAYFSLKDDKAR 64

Query: 64  IDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKR 123
           IDA+IWKG+ +K+++ PEEG+E +  G+ITTFPGSSKYQI+IE + P+G+G L+  +E+R
Sbjct: 65  IDAVIWKGSFSKLKYRPEEGMEVIATGRITTFPGSSKYQIVIEQMEPAGAGALMALIEER 124

Query: 124 KKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQG 183
           K++   EGLF    K  +PF+PK+I V+TSPTGAVIRDIL RIS RFP+ V+++PVKVQG
Sbjct: 125 KRRFTAEGLFDPATKQLLPFMPKVIGVVTSPTGAVIRDILHRISDRFPVHVLVWPVKVQG 184

Query: 184 DECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPI 243
           +    E+ANAI   N  +     PRPD++I+ARGGGS+EDLW FNDE +VRA A S+IP+
Sbjct: 185 EGSGDEVANAINGFNAFQPDGVIPRPDVLIVARGGGSLEDLWSFNDEAVVRAAAASAIPL 244

Query: 244 ISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYK 303
           ISA+GHETDWTL DYAAD+RAPTPTGAAEMAVPVK  L++ L  L ARL   + R + ++
Sbjct: 245 ISAVGHETDWTLIDYAADVRAPTPTGAAEMAVPVKADLEAQLAGLAARLAGAVNRQMDHR 304

Query: 304 INTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLI 363
              L +L +ALP+ DQ L+  R R D     L  +LE+    K + F     ++  D L+
Sbjct: 305 RQNLRALARALPSLDQLLALPRRRFDEAASGLGRSLELNTMTKRQSFERAAAKLSPDMLV 364

Query: 364 HNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKL 423
             + + RQ + E+    ++I+++ +           A L  +  + K +       +   
Sbjct: 365 RRLVERRQRVSERAALSDRIIERLIERQKANLGRIDATLTAVPARLKAQTGRSRDRLDSF 424

Query: 424 ITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKT 483
             R +  + + ++   ++VS   R+LQS +YKN L RGY  I+  ++  +++   L    
Sbjct: 425 SRRADSAVINDLRRARSTVSAHDRMLQSLSYKNVLMRGYAVIRGQDDRPLSRAAGLEDGR 484

Query: 484 RILINFFDGQANAIVINKAPPKEQPTKKC--------------QLHNNKREKQGTQGELF 529
            I I F DG+ +A V  +      P +                     K E    QG LF
Sbjct: 485 AIAIEFADGRVSA-VTGEGDKASPPPQAASATTTPAPGRPNPLPKSPKKSEPPAGQGSLF 543


>gi|27382618|ref|NP_774147.1| exodeoxyribonuclease VII large subunit [Bradyrhizobium japonicum
           USDA 110]
 gi|31563103|sp|Q89DD2|EX7L_BRAJA RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|27355790|dbj|BAC52772.1| exodeoxyribonuclease VII large subunit [Bradyrhizobium japonicum
           USDA 110]
          Length = 545

 Score =  451 bits (1161), Expect = e-124,   Method: Composition-based stats.
 Identities = 209/541 (38%), Positives = 306/541 (56%), Gaps = 15/541 (2%)

Query: 3   PFSQ-KNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           P    +  L+ PE++VSELS  LK  VE    HV VRGEISG+RG HSSGH YF+LKD  
Sbjct: 6   PMPPAEPLLNAPEFTVSELSQSLKRTVEDAFGHVRVRGEISGFRGAHSSGHCYFALKDES 65

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           ++I+A+IWKG   ++ F P+EG+E +  GK+TT+PGSSKYQI+IE+L P+G G L+  +E
Sbjct: 66  AKIEAVIWKGVHGRMRFKPQEGLEVIATGKLTTYPGSSKYQIVIEALEPAGIGALMALME 125

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           +RKKKL  EGLF +  K  +P++P++I V+TSPTGAVIRDIL R+  RFP  V+++PVKV
Sbjct: 126 ERKKKLAAEGLFDEARKQLLPWLPEVIGVVTSPTGAVIRDILHRLEDRFPRHVLVWPVKV 185

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QG+   +++A AI   N L EG   PRPD++I+ARGGGS+EDLW FN+E++VRA A S I
Sbjct: 186 QGEGSAEQVAAAIRGFNALPEGGKIPRPDVLIVARGGGSLEDLWSFNEEIVVRAAAESMI 245

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETD TL D+ AD RAPTPT AAEMAVPV+  L   + +L  R      R  +
Sbjct: 246 PLISAVGHETDITLIDFVADKRAPTPTAAAEMAVPVRSDLFVEVADLARRTRAYWQRAHE 305

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            + + L +  +ALP +   L+  R RLD     L   L+      +R F     ++    
Sbjct: 306 SRRSELRAAARALPAAGDLLAIPRQRLDSAGAALPRGLKANTHAHFRRFTAAGAKLTLRV 365

Query: 362 LIHNIQKNRQHILEKQQHI-----EQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYL 416
           L   I +    +    + +       + ++  R+  LE + + + L   + Q +N I   
Sbjct: 366 LHGQIAQADHRLTVCGERLGLSARSLLRQRRDRFAGLEVRLRASKLSNAQAQ-RNAIARQ 424

Query: 417 HTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQK 476
                +L  R    L   ++     V  + ++L + +Y+  L RG+  ++D   + +   
Sbjct: 425 RERTHRLAERANRALVTLLQRLDARVEASGKLLSALSYRGVLARGFALVRDEAGHPLHSA 484

Query: 477 RNLATKTRILINFFDGQANAIVINKAPPKEQP--------TKKCQLHNNKREKQGTQGEL 528
            ++    R+ I F DG+  A      P              ++ +    +  K   QG L
Sbjct: 485 DSVGPGARVEIEFADGRVGATTDADRPAPPAKRAQQPKPAAQETKPAPKRVGKPVDQGSL 544

Query: 529 F 529
           F
Sbjct: 545 F 545


>gi|146342911|ref|YP_001207959.1| exodeoxyribonuclease VII large subunit [Bradyrhizobium sp. ORS278]
 gi|146195717|emb|CAL79744.1| putative exonuclease VII, large subunit OB-fold nucleic acid
           binding domain [Bradyrhizobium sp. ORS278]
          Length = 538

 Score =  451 bits (1159), Expect = e-124,   Method: Composition-based stats.
 Identities = 204/540 (37%), Positives = 296/540 (54%), Gaps = 13/540 (2%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M P       + PE++VSELS  LK  VE    HV VRGEISG+RG HSSGH YF+LKD 
Sbjct: 1   MPPAEALP--NAPEFTVSELSSALKRTVEDQFGHVRVRGEISGFRGPHSSGHCYFALKDE 58

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            ++I+A+IWKG   ++ F P+EG+E +  GK+TT+P SSKYQI+IE+L P+G G L+  +
Sbjct: 59  SAKIEAVIWKGVHGRMRFKPQEGLEVIATGKLTTYPNSSKYQIVIEALEPAGIGALMALM 118

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           E+RK+KL  EGLF    K  +P++P++I V+TSPTGAVIRDIL R+  RFP RV+++PVK
Sbjct: 119 EERKRKLGAEGLFDPARKQLLPWLPEVIGVVTSPTGAVIRDILHRLEDRFPRRVLVWPVK 178

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQGD   +++A AI   N L E    PRPD++I+ARGGGS+EDLW FN+E++VRA A S 
Sbjct: 179 VQGDGSAEQVAAAIRGFNDLPEDGPIPRPDVLIVARGGGSLEDLWSFNEEIVVRAAAESM 238

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP+ISA+GHETD TL D+AAD RAPTPT AAEMAVPV+  L   + +L  R++    R  
Sbjct: 239 IPLISAVGHETDVTLIDFAADKRAPTPTAAAEMAVPVRSELMQEVASLARRVSVCWQRGQ 298

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           + + N L +  +ALP +   L+  R RLD     L   L+      +R F     ++   
Sbjct: 299 ESRRNELRAAARALPGASDLLAIPRQRLDAASSSLPRALKTNTHVHFRQFAAASAKLTLR 358

Query: 361 FLIHNIQKNRQHILEKQQHI----EQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYL 416
            L   I +    ++   + +      ++ +             A      +  +  I   
Sbjct: 359 VLHGQISQADHRLVVSSERLSLSARALLHRRRERFEALDARFKASRQAYAQAKRQAIARE 418

Query: 417 HTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQK 476
               ++L  R    L+  I           ++L + +Y++ L RG+  ++D   + + Q 
Sbjct: 419 RDRAERLADRASRALATSILRLRARTDHAGQLLSALSYRSVLARGFALVRDEAGHPLHQA 478

Query: 477 RNLATKTRILINFFDGQANAIVINKAPPKEQPTKKCQL-------HNNKREKQGTQGELF 529
             + +   + I F DG+  A     +P         +           +      QG LF
Sbjct: 479 AGIESGAALSIEFADGRVAATAGAGSPLPTSAPAAPKPVRESKPAAAKRTPDPADQGSLF 538


>gi|85717179|ref|ZP_01048137.1| exodeoxyribonuclease VII large subunit [Nitrobacter sp. Nb-311A]
 gi|85696012|gb|EAQ33912.1| exodeoxyribonuclease VII large subunit [Nitrobacter sp. Nb-311A]
          Length = 541

 Score =  449 bits (1156), Expect = e-124,   Method: Composition-based stats.
 Identities = 209/541 (38%), Positives = 305/541 (56%), Gaps = 12/541 (2%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M     +   + PEY+VSELS  LK  VE+   HV VRGEISG+RG H+SGH YF+LKD 
Sbjct: 1   MPANPAQLLANSPEYTVSELSSALKRTVENAYGHVRVRGEISGFRGPHASGHCYFALKDE 60

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            ++I+A+IWKG   ++ F P+EG+E +  GK+TT+PGSSKYQI+IE++ P+G G L+  +
Sbjct: 61  SAKIEAVIWKGVHGRMRFKPQEGLEVIATGKLTTYPGSSKYQIVIEAIEPAGIGALMALM 120

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           E+RKKKL  EGLF +  K  +P++P++I V+TSPTGAVIRDIL R+  RFP RV+++PV+
Sbjct: 121 EERKKKLAAEGLFDEARKQLLPWLPEVIGVVTSPTGAVIRDILHRLEDRFPRRVLVWPVR 180

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQG+   ++IA AI   N   +G   PRPD++I+ARGGGS+EDLW FN+E++VRA A S 
Sbjct: 181 VQGEGSAEQIAAAIDGFNARPDGGPVPRPDLLIVARGGGSLEDLWSFNEEIVVRAAAASM 240

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP+ISA+GHETD TL D+AAD RAPTPT AAEMAVPV+  L   + NL AR      R  
Sbjct: 241 IPLISAVGHETDVTLIDFAADQRAPTPTAAAEMAVPVRSDLLVEVSNLAARALVAWKRGH 300

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
             +   L S  +ALP + + L+  R +LD     L   L       +R F  I + +   
Sbjct: 301 DDRRTELRSSARALPGAFELLAIPRQKLDNAAAALPRALRASTHVHHRRFTQISSGLTLR 360

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLR----EQTKNRIFYL 416
            L   +   +Q +      +    +  LR+         A L   R    +  + +I   
Sbjct: 361 VLRAQVAHAKQSVAATGARLTHCTQVVLRHRRDRFAGLAARLKASRLANVQAQREQISRA 420

Query: 417 HTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQK 476
               ++L  R    +   ++     ++ ++++L + +Y+  L RG+  ++D   + +   
Sbjct: 421 EERTRRLFERAHRAVVTSLQRHEARIAHSSQLLAAVSYRGVLARGFALVRDETGHALRSA 480

Query: 477 RNLATKTRILINFFDGQANAIVINKAPPKEQP--------TKKCQLHNNKREKQGTQGEL 528
             + + TR+ + F DGQ NA                    +        +R K   QG L
Sbjct: 481 AAVGSGTRLTLEFIDGQVNATSDTDQTAPAASSTTESNPGSPPRPASGKRRAKIADQGSL 540

Query: 529 F 529
           F
Sbjct: 541 F 541


>gi|13475744|ref|NP_107311.1| exodeoxyribonuclease VII large subunit [Mesorhizobium loti
           MAFF303099]
 gi|22095676|sp|Q987V3|EX7L_RHILO RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|14026500|dbj|BAB53097.1| exodeoxyribonuclease VII large subunit [Mesorhizobium loti
           MAFF303099]
          Length = 521

 Score =  446 bits (1147), Expect = e-123,   Method: Composition-based stats.
 Identities = 211/529 (39%), Positives = 314/529 (59%), Gaps = 8/529 (1%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M+  + ++  +  EY+VSE+S  LK  VE    +V VRGEISGYRG HSSGHAYF+LKD+
Sbjct: 1   MSEAASESRTNATEYTVSEISGALKRTVEDVFGNVRVRGEISGYRGPHSSGHAYFALKDD 60

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            +R+DA++WKGT+++++F PEEG+E +  GK+TT+PG S YQI+I++L P+G+G L+  L
Sbjct: 61  RARLDAVVWKGTMSRLKFRPEEGMEVIATGKLTTYPGKSNYQIVIDNLEPAGAGALMALL 120

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           E+RK++L  EGLF    K  +PF+P+ I V+TSPTG+VIRDI+ RI  RFPL V+++PV+
Sbjct: 121 EERKRRLQAEGLFDAGRKRRLPFMPRTIGVVTSPTGSVIRDIIHRIKDRFPLHVLVWPVR 180

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQGD    E+ NA+   N L    +  RPD++I+ARGGGS+EDLW FNDE + RA+A S 
Sbjct: 181 VQGDTASAEVTNAVTGFNALAWDGSIQRPDLLIVARGGGSLEDLWGFNDEALARAVAASG 240

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP+ISA+GHETDWTL D  AD+RAPTPTGAAE+AVPVK  L+++L +L ARL   ++R  
Sbjct: 241 IPVISAVGHETDWTLIDLVADVRAPTPTGAAEIAVPVKADLEATLASLGARLKAAVLRNF 300

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           + K     +  +ALP+ DQ L+  R RLD     L   L + + RK         R+   
Sbjct: 301 ERKRQAARAAARALPSPDQLLALPRRRLDEATSRLGRGLSVSVDRKRARLQG--QRLTPA 358

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420
            L   I + R          +      +R            L       + ++      +
Sbjct: 359 TLSRRINEARTLTGRDLARAQAAFFAIVRERRARFARTATRLSPAPIARRQKLQA--DTL 416

Query: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480
             L  R + ++S +++     +S   R+L + ++K  L RG+  +++ +   I Q  ++ 
Sbjct: 417 AALARRQDRVISLRLERLRGQLSQAERLLTTLSHKAVLARGFALVKNADGAVIKQAADVV 476

Query: 481 TKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
           +   + + F DG A+A+  + A       K     + K ++ G QG LF
Sbjct: 477 SGMALTLEFADGTADAVATSGAA----RPKPAAKPSTKAKEPGNQGSLF 521


>gi|92118640|ref|YP_578369.1| exodeoxyribonuclease VII large subunit [Nitrobacter hamburgensis
           X14]
 gi|91801534|gb|ABE63909.1| Exodeoxyribonuclease VII large subunit [Nitrobacter hamburgensis
           X14]
          Length = 541

 Score =  445 bits (1144), Expect = e-123,   Method: Composition-based stats.
 Identities = 214/542 (39%), Positives = 313/542 (57%), Gaps = 14/542 (2%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M     +   + PEY+VSELS  LK  VE+   HV VRGEISG+RG H SGH YF+LKD 
Sbjct: 1   MPANPAQLLANAPEYTVSELSSALKRTVENAYGHVRVRGEISGFRGPHGSGHCYFALKDE 60

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            ++I+A+IWKG   ++ F P+EG+E +  GK+TT+PGSSKYQI+IE+L P+G G L+  +
Sbjct: 61  SAKIEAVIWKGVHGRMRFKPQEGLEVIATGKLTTYPGSSKYQIVIEALEPAGIGALMALM 120

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           E+RKKKL  EGLF +  K  +P++P++I V+TSPTGAVIRDIL R+  RFP RV+++PV+
Sbjct: 121 EERKKKLAAEGLFDEARKQLLPWLPEVIGVVTSPTGAVIRDILHRLEDRFPRRVLVWPVR 180

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQG+   ++IA AI   N L EG   PRPD++I+ARGGGS+EDLW FN+E++VRA A+S 
Sbjct: 181 VQGEGSAEQIAAAIDGFNALPEGGHVPRPDLLIVARGGGSLEDLWSFNEEIVVRAAASSM 240

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP+ISA+GHETD TL D+AAD RAPTPT AAEMAVPV+  L   +    AR      R  
Sbjct: 241 IPLISAVGHETDVTLIDFAADKRAPTPTAAAEMAVPVRTELFVEVSGFAARAIVAWRRGH 300

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
             +   L S  +ALP + + L+  R +LD +   L   L       +R F  I   +   
Sbjct: 301 DDRRTELRSAARALPGAGELLAIPRQKLDGVAAALPRVLRASTHLHHRRFTEISRGLTLR 360

Query: 361 FLIHNIQKNRQHILEKQQHIEQ-----IVKQHLRYIFLEKKEKIAILHMLREQTKNRIFY 415
            L   +   +Q +      +       +  +  R++ L  + K + L   + Q ++RI  
Sbjct: 361 VLRAQVAHAKQSVAATGARLAHGTQVVLRHRRDRFVGLAIRLKASRLANAQAQ-RDRIAR 419

Query: 416 LHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQ 475
            +   ++L  R    L+  ++     ++ + ++L +F+Y+  L RG+  ++D     +  
Sbjct: 420 ANERTQRLAERTRRALATLLQRHEARITYSGQLLAAFSYRGVLARGFALVRDDAGQALRS 479

Query: 476 KRNLATKTRILINFFDGQANAI-------VINKAPPKEQPTKKCQLHNNKR-EKQGTQGE 527
              +    R+ + F DG+  A          + AP    P  + +  + KR  K   QG 
Sbjct: 480 ASAVGPGARLTLEFTDGRVAATADDDQSAATSSAPTGSNPRGRPKPASGKRAAKAADQGS 539

Query: 528 LF 529
           LF
Sbjct: 540 LF 541


>gi|316932705|ref|YP_004107687.1| exodeoxyribonuclease VII large subunit [Rhodopseudomonas palustris
           DX-1]
 gi|315600419|gb|ADU42954.1| exodeoxyribonuclease VII, large subunit [Rhodopseudomonas palustris
           DX-1]
          Length = 537

 Score =  444 bits (1143), Expect = e-122,   Method: Composition-based stats.
 Identities = 205/532 (38%), Positives = 302/532 (56%), Gaps = 7/532 (1%)

Query: 5   SQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRI 64
           S +   +  E++VSELS  LK  VE    HV VRGEI+G+RG HSSGH YF+LKD  ++I
Sbjct: 6   SPQALANVGEFTVSELSQALKRTVEDTYGHVRVRGEITGFRGPHSSGHCYFALKDEGAKI 65

Query: 65  DAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRK 124
           +A+IWKG   ++ F P+EG+E +  GK+TT+PGSSKYQI+IE+L P+G G L+  +E+RK
Sbjct: 66  EAVIWKGVAGRMRFRPQEGLEVIATGKLTTYPGSSKYQIVIEALEPAGVGALMALMEERK 125

Query: 125 KKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGD 184
           KKL  EGLF +  K  +P++P++I V+TSPTGAVIRDIL R+  RFP RV+++PV+VQG+
Sbjct: 126 KKLAAEGLFDEARKQLLPWLPEVIGVVTSPTGAVIRDILHRLEDRFPRRVLVWPVRVQGE 185

Query: 185 ECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPII 244
              +++A AI   N L E    PRPD++I+ARGGGS+EDLW FN+E++VRA A+S IP+I
Sbjct: 186 GSAEQVAAAIHGFNALPEDGPIPRPDLLIVARGGGSLEDLWSFNEEIVVRAAADSMIPLI 245

Query: 245 SAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKI 304
           SA+GHETD TL D+AAD RAPTPT AAEMAVPV+  L   +  L  R+ +   R   ++ 
Sbjct: 246 SAVGHETDVTLIDFAADKRAPTPTAAAEMAVPVRAELFVEVGGLARRMLSSWQRGQDFRR 305

Query: 305 NTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
           N L +  +ALP +   L+  R RLD     L   L       +R F      +    L  
Sbjct: 306 NELRAAARALPGASDLLAIPRQRLDTAAASLPRALRANTHAHHRRFAAAAAGMTLKVLRA 365

Query: 365 NIQKNRQHIL---EKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKN-RIFYLHTHI 420
            +  +   +     + Q   +   +H R  F     ++    +  +Q +  RI      +
Sbjct: 366 QVAHSAHRLDVSGTQLQRCARATLRHRRDRFEGLAVRLQASRLANQQAQRMRIAGEQERL 425

Query: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480
           ++L  R    L+  ++     +  T ++L + +Y+  L RG+  ++D     +    ++A
Sbjct: 426 QRLAERARRALATLLERRQARLDATGKLLTALSYRGVLARGFALVRDAEGRSVHTAASVA 485

Query: 481 TKTRILINFFDGQANAIVINKAPPKEQPTKK---CQLHNNKREKQGTQGELF 529
              R+ + F DG+        +       K          +  K   QG LF
Sbjct: 486 AGARLSVEFADGRLGVTADGGSGSPAHTAKPASVPAKAAKRLVKPAGQGSLF 537


>gi|325291705|ref|YP_004277569.1| exodeoxyribonuclease VII large subunit [Agrobacterium sp. H13-3]
 gi|325059558|gb|ADY63249.1| exodeoxyribonuclease VII large subunit [Agrobacterium sp. H13-3]
          Length = 534

 Score =  444 bits (1142), Expect = e-122,   Method: Composition-based stats.
 Identities = 238/534 (44%), Positives = 336/534 (62%), Gaps = 5/534 (0%)

Query: 1   MNP-FSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKD 59
           M+  FS     +  E+SVSELS  +K  VE+    V VRGEISGYRG HSSGHAYFSLKD
Sbjct: 1   MSDIFSNAALSNLAEFSVSELSGSIKRTVETAFDQVRVRGEISGYRGPHSSGHAYFSLKD 60

Query: 60  NHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTA 119
           + +RIDA+IWKGT ++++F PEEG+E +  GK+TTFPGSSKYQI+IESL P+G+G L+  
Sbjct: 61  DRARIDAVIWKGTFSRLKFRPEEGMEVIATGKVTTFPGSSKYQIVIESLEPAGAGALMAL 120

Query: 120 LEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPV 179
           LE R+++L  EGLF  + K  +PF+P++I V+TSPTGAVIRDIL RIS RFP+ V+++PV
Sbjct: 121 LEDRRRRLAAEGLFDAERKRRLPFMPRVIGVVTSPTGAVIRDILHRISDRFPVHVVVWPV 180

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
           KVQG+   +E+ANAI   N L+ G    RPD++I+ARGGGS+EDLW FNDE++VRA A S
Sbjct: 181 KVQGEGSGEEVANAIRGFNALQPGGEIARPDVLIVARGGGSLEDLWSFNDEIVVRAAAES 240

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
            IP+ISA+GHETD TL DYAAD+RAPTPTGAAEMAVPV+  L++ L  L ARL+  + R 
Sbjct: 241 EIPLISAVGHETDTTLIDYAADVRAPTPTGAAEMAVPVRAELEAQLSGLAARLSGSVSRQ 300

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
           +  +   + +L++ALP+ DQ L+  R R D     L   LE+    K R F    + ++ 
Sbjct: 301 MDNRRQGVRALVRALPSLDQLLALPRRRFDEAASGLGRGLEMTTLNKRRAFERSASGLRP 360

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH 419
           + L++ ++++RQ + E+ Q  E +V++ L           + L  L  +   ++      
Sbjct: 361 EILLNGLRQHRQRVTERMQRAEALVERRLLQAQSRISSTDSALRSLPARLLGQLERQKER 420

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
           +     R +  + H++    + ++   RILQS +YKN L RGY  I+D  N  +T+   +
Sbjct: 421 VVTATRRADTAVLHRMAQNRSGLAAHDRILQSLSYKNVLNRGYAVIRDEENRPLTRAAAI 480

Query: 480 ATKTRILINFFDGQANAIVINKAPPKE----QPTKKCQLHNNKREKQGTQGELF 529
           A+   + + F DG+  A+   +A P          K +         G QG LF
Sbjct: 481 ASGAVVSMEFADGRVAALTTGEATPSSDVQTPAAPKKKPVKPASSDPGNQGSLF 534


>gi|75676737|ref|YP_319158.1| exodeoxyribonuclease VII large subunit [Nitrobacter winogradskyi
           Nb-255]
 gi|74421607|gb|ABA05806.1| Exodeoxyribonuclease VII large subunit [Nitrobacter winogradskyi
           Nb-255]
          Length = 541

 Score =  442 bits (1136), Expect = e-122,   Method: Composition-based stats.
 Identities = 212/541 (39%), Positives = 309/541 (57%), Gaps = 12/541 (2%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M     +   + PEY+VSELS  LK  VE+   HV VRGEISG+RG H+SGH YF+LKD 
Sbjct: 1   MPANPAQLLANAPEYTVSELSSALKRTVENAYGHVRVRGEISGFRGPHASGHCYFALKDE 60

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            ++I+A+IWKG   ++ F P+EG+E +  GK+TT+PGSSKYQI+IE++ P+G G L+  +
Sbjct: 61  SAKIEAVIWKGVHGRMRFKPQEGLEVIATGKLTTYPGSSKYQIVIEAIEPAGIGALMALM 120

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           E+RKKKL  +GLF +  K  +P++P++I V+TSPTGAVIRDIL R+  RFP RV+++PV+
Sbjct: 121 EERKKKLAAQGLFDEARKQLLPWLPEVIGVVTSPTGAVIRDILHRLEDRFPRRVLVWPVR 180

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQG+   ++IA AI   N L +G   PRPD++I+ARGGGS+EDLW FN+E++VRA A S 
Sbjct: 181 VQGEGSAEQIAAAIDGFNALPDGGPIPRPDLLIVARGGGSLEDLWSFNEEIVVRAAAGSM 240

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP+ISA+GHETD TL D+AAD RAPTPT AAEMAVPV+  L   + +L AR      R  
Sbjct: 241 IPLISAVGHETDVTLIDFAADQRAPTPTAAAEMAVPVRSDLAIEISDLAARALVAWKRGH 300

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
             +   L S  +ALP + + L+  R +LD     L   L       +R F  I   +   
Sbjct: 301 DDRRTELRSAARALPGAGELLAIPRQKLDNAAAALPRALRASTHLHHRRFTRISGGLTLR 360

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLR----EQTKNRIFYL 416
            L   I   +Q +      +    +  LR+           L   R    +  ++RI   
Sbjct: 361 VLHAQITHAKQSVAATGARLAHCTQVMLRHRRDRFAGLAVRLRASRVANVQAQRDRIARD 420

Query: 417 HTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQK 476
           +   ++L  R    L   ++     ++ + ++L + +Y+  L RG+  ++D     +   
Sbjct: 421 NERTRRLAERARRALVTLLRRHEARITHSGQLLAALSYRGVLARGFALVRDDAGQAVRSA 480

Query: 477 RNLATKTRILINFFDGQANAI-------VINKAPPKEQPTKKCQLHNNKR-EKQGTQGEL 528
               +  R+ + F DG+ N           +  PP+  PT + +  + KR  K   QG L
Sbjct: 481 TAAGSGARLTLEFADGKVNVTSDTDQTAATSSNPPRSGPTSEPKPVSRKRAAKPAGQGSL 540

Query: 529 F 529
           F
Sbjct: 541 F 541


>gi|227824137|ref|YP_002828110.1| exodeoxyribonuclease VII large subunit [Sinorhizobium fredii
           NGR234]
 gi|254783705|sp|C3MCQ9|EX7L_RHISN RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|227343139|gb|ACP27357.1| exodeoxyribonuclease VII, large subunit [Sinorhizobium fredii
           NGR234]
          Length = 527

 Score =  441 bits (1135), Expect = e-121,   Method: Composition-based stats.
 Identities = 230/519 (44%), Positives = 330/519 (63%), Gaps = 3/519 (0%)

Query: 11  DHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           +  EYSVSELS  +K  +E    HV VRGEISGYRG HSSGHAYF+LKD+ +R++A+IWK
Sbjct: 12  NVAEYSVSELSGSIKRTLEQAFEHVRVRGEISGYRGPHSSGHAYFALKDDRARMEAVIWK 71

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           GT  +++  PEEG+E +  G++TTFPGSSKYQI+I+SL P+G+G L+  LE+RK+KL  E
Sbjct: 72  GTFARLKLRPEEGMEVIATGRVTTFPGSSKYQIVIDSLEPAGAGALMALLEERKRKLAAE 131

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEI 190
           GLF    K P+PF+PK+I V+TSPTGAVIRDIL RI+ RFP+ V+++PV+VQGD   +E+
Sbjct: 132 GLFDAARKRPLPFMPKVIGVVTSPTGAVIRDILHRIADRFPVHVVVWPVRVQGDGASEEV 191

Query: 191 ANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHE 250
           A AI   N L+EG   PRPD++I+ARGGGS+EDLW FNDE +VRA+A S IP+ISA+GHE
Sbjct: 192 AAAIRGFNALEEGGPIPRPDVLIVARGGGSLEDLWGFNDEAVVRAVAASGIPLISAVGHE 251

Query: 251 TDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSL 310
           TDWTL DYA+D RAPTPTGAAEMAVPVK  L++ + NL ARL     R + ++ + L +L
Sbjct: 252 TDWTLIDYASDQRAPTPTGAAEMAVPVKADLEAQVANLSARLQAAATRQMDHRRHALRAL 311

Query: 311 LKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNR 370
            +ALP+ DQ L+  R R D     L   L++    K R F  I   ++ + L   I++ R
Sbjct: 312 ARALPSLDQLLALPRRRFDEAAAGLGRGLQMNTANKRRSFERIAAHLRPELLTTRIREQR 371

Query: 371 QHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFI 430
           +H+LE     E+ V++ +           A L  L  +   +I      +  L  R +  
Sbjct: 372 RHLLEAINKAERCVERQIDRRQARVSAADASLRTLPSRLAGQIHRSSDRVSGLGRRADAA 431

Query: 431 LSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFF 490
           ++ +++    +++   R+LQS +Y+N L+RG+  ++D   + + Q   +     + + F 
Sbjct: 432 MAAEMRRLKGALAAQDRVLQSLSYRNVLQRGFALVRDAAGDPVKQAAAVTAGMALSLEFA 491

Query: 491 DGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
           DG+ +A+   +  P   P    +   ++      QG LF
Sbjct: 492 DGRVSAVAGEEGAP---PPAAPKKRASRPVVPTKQGSLF 527


>gi|328545113|ref|YP_004305222.1| exodeoxyribonuclease 7 large subunit [polymorphum gilvum
           SL003B-26A1]
 gi|326414855|gb|ADZ71918.1| Exodeoxyribonuclease 7 large subunit [Polymorphum gilvum
           SL003B-26A1]
          Length = 519

 Score =  438 bits (1127), Expect = e-121,   Method: Composition-based stats.
 Identities = 205/524 (39%), Positives = 302/524 (57%), Gaps = 6/524 (1%)

Query: 6   QKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRID 65
                +  EYSVS++S+ +K  +E    +V VRGE+ G      SGH Y  LKD+ S + 
Sbjct: 2   ADTPTNIAEYSVSDISFSIKRTLEDTFGYVRVRGEL-GRISRPGSGHVYLDLKDDRSVLS 60

Query: 66  AIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKK 125
           A+IWKG   K++  PE+G+E +  GKITTFPG SKYQ++I++L P+G+G L+  LE RK+
Sbjct: 61  AVIWKGAAAKLKIQPEQGLEVIATGKITTFPGQSKYQMVIDALEPAGAGALMALLEDRKR 120

Query: 126 KLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDE 185
           KL  EGLF+ + K P+P +P++I V+TSPTGAVIRDIL R+S RFPL V+++PV+VQGD 
Sbjct: 121 KLAAEGLFAAERKRPLPTLPRVIGVVTSPTGAVIRDILHRLSDRFPLHVLVWPVRVQGDS 180

Query: 186 CPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIIS 245
           C  E+AN I   N L+ G   PRPD+II+ARGGGS+EDLW FNDE +VRA A S+IP+IS
Sbjct: 181 CGAEVANGIRGFNALEAGGAIPRPDLIIVARGGGSLEDLWGFNDEQVVRAAAESAIPLIS 240

Query: 246 AIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKIN 305
           A+GHETDWTL D AAD+RAPTPTGAAE+AVPVK  L + + +L  RL + + RL+  +  
Sbjct: 241 AVGHETDWTLIDLAADVRAPTPTGAAEIAVPVKAELMAGVDDLSRRLASGLNRLVASRRT 300

Query: 306 TLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHN 365
            L +   ALP     L+  R RLD     LE  L +          H    +    L+  
Sbjct: 301 ELRAAAAALPAPRDLLALPRQRLDFSGGNLERGLTVNTRAHRSRLQHAAALLTPMTLVRA 360

Query: 366 IQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLIT 425
           +++ R+ +   +Q   +  +  +       +     L   R   + ++      +  L+ 
Sbjct: 361 MRQGRERLDGHRQRQARAWETTIFRHRQRLEAAAGRLTSGR--LEQQLRLGTERLDGLLR 418

Query: 426 RIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRI 485
           R+E     ++      +    ++L++ +YK+ L RGY  ++D     +    +++   R+
Sbjct: 419 RLERAQQARLAEQRARLQGLEKLLKTLSYKDVLARGYALVRDAAGEPVRSAAHVSAGDRL 478

Query: 486 LINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
            +   DG+  AI    A P E+  K  +  +N      +QG LF
Sbjct: 479 SVEVADGRFEAI---AATPAEELRKSRKPKDNPAPGGTSQGSLF 519


>gi|260462651|ref|ZP_05810857.1| exodeoxyribonuclease VII, large subunit [Mesorhizobium
           opportunistum WSM2075]
 gi|259031557|gb|EEW32827.1| exodeoxyribonuclease VII, large subunit [Mesorhizobium
           opportunistum WSM2075]
          Length = 548

 Score =  437 bits (1124), Expect = e-120,   Method: Composition-based stats.
 Identities = 217/550 (39%), Positives = 323/550 (58%), Gaps = 23/550 (4%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M+  + ++  +  EY+VSE+S  LK  VE    +V VRGEISGYRG HSSGHAYF+LKD+
Sbjct: 1   MSDAASESRTNATEYTVSEISGALKRTVEDVFGNVRVRGEISGYRGPHSSGHAYFALKDD 60

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            +R+DA++WKGT+++++F PEEG+E +  GK+TT+PG S YQI+I++L P+G+G L+  L
Sbjct: 61  RARLDAVVWKGTMSRLKFRPEEGMEVIATGKLTTYPGKSNYQIVIDNLEPAGAGALMALL 120

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           E+RK++L  EGLF    K  +PF+P++I V+TSPTG+VIRDI+ RI  RFPL V+++PV+
Sbjct: 121 EERKRRLQGEGLFDAGRKRRLPFMPRVIGVVTSPTGSVIRDIIHRIKDRFPLHVLVWPVR 180

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQG+    E+ NA+   N L       RPD++I+ARGGGS+EDLW FNDE + RA+A S 
Sbjct: 181 VQGETSGVEVTNAVAGFNALAWDGAIQRPDLLIVARGGGSLEDLWGFNDEALARAVAASG 240

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP+ISA+GHETDWTL D  AD+RAPTPTGAAE+AVPVK  L+++L +L ARL   ++R  
Sbjct: 241 IPVISAVGHETDWTLIDLVADVRAPTPTGAAEIAVPVKADLEATLASLGARLKAAVLRNF 300

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           + K     +  +ALP+ DQ L+  R RLD     L   L +   RK   +  +  ++   
Sbjct: 301 ERKRQAARAAARALPSPDQLLALPRRRLDEATSRLGRGLMVSTERKRARY--VAVKLTPT 358

Query: 361 FLIHNIQKNR----QHILEKQ--------------QHIEQIVKQHLRYIFLEKKEKIAIL 402
            L   I + R    +++L  Q                    + +  R      ++++A+L
Sbjct: 359 MLSQRIAEARRTNERNLLRAQGALRALARARRAELNRAADQLPKCARASLQRHRQQLALL 418

Query: 403 HML--REQTKNRIFYLHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKR 460
                 E T  R       +  L  R    +  +++     V    R+L + ++K  L R
Sbjct: 419 QGRITIEPTARRQRVQRDLLTALTRRGGQAMLIRLERLRGRVVQADRLLATLSHKAVLAR 478

Query: 461 GYTSIQDTNNNFITQKRNLATKTRILINFFDGQANAIVINKAP-PKEQPTKKCQLHNNKR 519
           G+  ++D +   I Q  ++A+   + + F DG A+A+  + A  PK       +    K 
Sbjct: 479 GFALVKDADGAVIKQAADVASGMALSLEFADGIADAVATSGAARPKPAAKPSAKTPVAKT 538

Query: 520 EKQGTQGELF 529
            + G QG LF
Sbjct: 539 REPGNQGSLF 548


>gi|192289762|ref|YP_001990367.1| exodeoxyribonuclease VII large subunit [Rhodopseudomonas palustris
           TIE-1]
 gi|192283511|gb|ACE99891.1| exodeoxyribonuclease VII, large subunit [Rhodopseudomonas palustris
           TIE-1]
          Length = 537

 Score =  436 bits (1120), Expect = e-120,   Method: Composition-based stats.
 Identities = 204/532 (38%), Positives = 302/532 (56%), Gaps = 7/532 (1%)

Query: 5   SQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRI 64
           + +   +  E++VSELS  LK  VE    HV VRGEI+G+RG HSSGH YF+LKD  ++I
Sbjct: 6   TPQALANVGEFTVSELSQALKRTVEDTYGHVRVRGEITGFRGPHSSGHCYFALKDEGAKI 65

Query: 65  DAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRK 124
           +A+IWKG   ++ F P+EG+E +  GK+TT+PGSSKYQI+IE+L P+G G L+  +E+RK
Sbjct: 66  EAVIWKGVAGRMRFKPQEGLEVIATGKLTTYPGSSKYQIVIEALEPAGVGALMALMEERK 125

Query: 125 KKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGD 184
           KKL  EGLF +  K  +P++P++I V+TSPTGAVIRDIL R+  RFP RV+++PV+VQG+
Sbjct: 126 KKLAAEGLFDEARKQLLPWLPEVIGVVTSPTGAVIRDILHRLEDRFPRRVLVWPVRVQGE 185

Query: 185 ECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPII 244
              ++IA AI   N L E    PRPD++I+ARGGGS+EDLW FN+E++VRA A+S IP+I
Sbjct: 186 GSAEQIAAAIHGFNALPEDGPIPRPDLLIVARGGGSLEDLWSFNEEIVVRAAADSMIPLI 245

Query: 245 SAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKI 304
           SA+GHETD TL D+A+D RAPTPT AAEMAVPV+  L   +  L  R+ +   R   ++ 
Sbjct: 246 SAVGHETDVTLIDFASDKRAPTPTAAAEMAVPVRAELFVEVGGLARRILSSWQRGQDFRR 305

Query: 305 NTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
           N L +  +ALP +   L+  R RLD     L   L       +R F      +    L  
Sbjct: 306 NELRAAARALPGASDLLAIPRQRLDGASAALPRALRASTNAHHRRFAAAAAGMTLKVLRA 365

Query: 365 NIQKNRQHILE---KQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKN-RIFYLHTHI 420
            +  +   +     + Q   +   +H R  F     ++    +  +Q +  RI      +
Sbjct: 366 QVAHSAHRLDSAGTQLQRCARATLRHRRERFDGLAVRLQASKLANQQAQRMRIAREQERL 425

Query: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480
           ++L  R    L   ++     V  T ++L + +Y+  L RG+  ++D +   +    ++A
Sbjct: 426 QRLGERARRALITLLERRQARVDATGKLLTALSYRGVLARGFALVRDADGRSVHAAASVA 485

Query: 481 TKTRILINFFDGQANAIVINKAPPK---EQPTKKCQLHNNKREKQGTQGELF 529
              R+ + F DG+        +       +P         +      QG LF
Sbjct: 486 AGARLSVEFADGRVAVTADGGSGSPVEAAKPAPTPAKPAKRPTSPADQGSLF 537


>gi|39934236|ref|NP_946512.1| exodeoxyribonuclease VII large subunit [Rhodopseudomonas palustris
           CGA009]
 gi|39648084|emb|CAE26604.1| putative exonuclease VII, large subunit OB-fold nucleic acid
           binding domain [Rhodopseudomonas palustris CGA009]
          Length = 537

 Score =  436 bits (1120), Expect = e-120,   Method: Composition-based stats.
 Identities = 205/532 (38%), Positives = 303/532 (56%), Gaps = 7/532 (1%)

Query: 5   SQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRI 64
           + +   +  E++VSELS  LK  VE    HV VRGEI+G+RG HSSGH YF+LKD  ++I
Sbjct: 6   TPQALANVGEFTVSELSQALKRTVEDTYGHVRVRGEITGFRGPHSSGHCYFALKDEGAKI 65

Query: 65  DAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRK 124
           +A+IWKG   ++ F P+EG+E +  GK+TT+PGSSKYQI+IE+L P+G G L+  +E+RK
Sbjct: 66  EAVIWKGVAGRMRFKPQEGLEVIATGKLTTYPGSSKYQIVIEALEPAGVGALMALMEERK 125

Query: 125 KKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGD 184
           KKL  EGLF +  K  +P++P++I V+TSPTGAVIRDIL R+  RFP RV+++PV+VQG+
Sbjct: 126 KKLAAEGLFDEARKQLLPWLPEVIGVVTSPTGAVIRDILHRLEDRFPRRVLVWPVRVQGE 185

Query: 185 ECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPII 244
              ++IA AI   N L E    PRPD++I+ARGGGS+EDLW FN+E++VRA A+S IP+I
Sbjct: 186 GSAEQIAAAIHGFNALPEDGPIPRPDLLIVARGGGSLEDLWSFNEEIVVRAAADSMIPLI 245

Query: 245 SAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKI 304
           SA+GHETD TL D+A+D RAPTPT AAEMAVPV+  L   +  L  R+ +   R   ++ 
Sbjct: 246 SAVGHETDVTLIDFASDKRAPTPTAAAEMAVPVRAELFVEVGGLARRILSSWQRGQDFRR 305

Query: 305 NTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
           N L +  +ALP +   L+  R RLD     L   L       +R F      +    L  
Sbjct: 306 NELRAAARALPGASDLLAIPRQRLDGASAALPRALRASTNAHHRRFAAAAAGMTLKVLRA 365

Query: 365 NIQKNRQHILE---KQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKN-RIFYLHTHI 420
            +  +   +     + Q   +   +H R  F     ++    +  +Q +  RI      +
Sbjct: 366 QVAHSAHRLDSAGTQLQRCARATLRHRRERFEGLAVRLQASKLANQQAQRMRIAREQERL 425

Query: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480
           ++L  R    L   ++     V  T ++L + +Y+  L RG+  ++D +   +    ++A
Sbjct: 426 QRLAERARRALITLLERRQARVDATGKLLTALSYRGVLARGFALVRDADGRSVHAAASVA 485

Query: 481 TKTRILINFFDGQANAIVINKAPPK---EQPTKKCQLHNNKREKQGTQGELF 529
              R+ + F DG+        +       +PT        +      QG LF
Sbjct: 486 AGARLSVEFADGRVAVTADGGSGSPVEAAKPTPAPAKPVKRPPSPAGQGSLF 537


>gi|323138985|ref|ZP_08074045.1| exodeoxyribonuclease VII, large subunit [Methylocystis sp. ATCC
           49242]
 gi|322395739|gb|EFX98280.1| exodeoxyribonuclease VII, large subunit [Methylocystis sp. ATCC
           49242]
          Length = 522

 Score =  435 bits (1118), Expect = e-120,   Method: Composition-based stats.
 Identities = 200/521 (38%), Positives = 281/521 (53%), Gaps = 20/521 (3%)

Query: 9   SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAII 68
             + PE SVSEL+  LK  +E     V VRGEIS YRG H+SGHAYFSLKD  +R+DA+I
Sbjct: 22  GTNAPEISVSELANALKRTIEDRFGRVRVRGEISNYRGPHASGHAYFSLKDQSARLDAVI 81

Query: 69  WKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLL 128
           WKGT  ++   P+EG+E +  G+ITTFPG S YQI+IE++ P+G G L+  L++R+KKL 
Sbjct: 82  WKGTFMRLRTRPQEGLEVVATGRITTFPGKSSYQIVIEAMEPAGVGALMALLDERRKKLA 141

Query: 129 EEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPK 188
            EGLF +  K P+PF+P+++ V+TSPTGAVIRDIL R++ RFP RV+++PV+VQG+    
Sbjct: 142 AEGLFDEARKRPLPFLPRVVGVVTSPTGAVIRDILHRLNDRFPRRVLVWPVRVQGETSAV 201

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           E+A AI   N L      PRPD++I+ARGGGS+EDLW FN+E++VR+ A S IP+ISAIG
Sbjct: 202 EVAAAINGFNALPADGPVPRPDVLIVARGGGSLEDLWSFNEEIVVRSAAASDIPLISAIG 261

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HETD TL D+ ADLRAPTPTGAAE AVPV+  L   L     RL     R ++ +   L 
Sbjct: 262 HETDTTLIDFVADLRAPTPTGAAEKAVPVRAELAEHLAARARRLAAAKTRAMEQRRTQLA 321

Query: 309 SLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQK 368
           +L + LP  +Q L+  R RLDR    L          +        N +        + +
Sbjct: 322 TLARLLPAPEQLLANPRQRLDRAGERLRGAFRAGRDAQRLRLARAANLLARHSPQAELAR 381

Query: 369 NRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIE 428
            R+ +      + Q                   L       + +       +     R++
Sbjct: 382 ARERLKGLDARLAQG------------------LAARLTLARQQNQGSAQRLANAGGRLD 423

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
                 ++     +    R+  S ++K  L RG+  ++D  +  +         T + I 
Sbjct: 424 RAFVTLLRQKKEKLERLGRLQDSLSHKAVLARGFALVRDEKDALVRGVAQAPPGTALSIE 483

Query: 489 FFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
           F DG+ +A     A     PT        K+     QG LF
Sbjct: 484 FADGRIDAR-AGNAATGPAPTVPAPRKRAKKPGD-DQGSLF 522


>gi|149914435|ref|ZP_01902966.1| exodeoxyribonuclease VII, large subunit [Roseobacter sp. AzwK-3b]
 gi|149811954|gb|EDM71787.1| exodeoxyribonuclease VII, large subunit [Roseobacter sp. AzwK-3b]
          Length = 530

 Score =  435 bits (1118), Expect = e-119,   Method: Composition-based stats.
 Identities = 187/534 (35%), Positives = 290/534 (54%), Gaps = 9/534 (1%)

Query: 1   MNPFSQKN--SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLK 58
           M+          + PE+SVSE+S  +K ++E   +H+ V+GE+ G      SGH Y  LK
Sbjct: 1   MSDLIDDPMEGENAPEFSVSEISGAVKRVIEGEFAHIRVKGEV-GRVSRPRSGHVYLDLK 59

Query: 59  DNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLT 118
           D+ S +  +IWKG  +++   PEEG+E +  G++TTFPG S+YQI+IE + P+G G L+ 
Sbjct: 60  DDRSVLAGVIWKGVASRLSVQPEEGMEVVATGRLTTFPGQSRYQIVIEDIKPAGMGALMA 119

Query: 119 ALEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFP 178
            LEKRK +L  EGLF+ + K P+P++P++I V+TSP+GAVIRDIL R+  RFP +V+I+P
Sbjct: 120 MLEKRKTQLAAEGLFAPERKRPLPYLPEVIGVVTSPSGAVIRDILHRLRDRFPRKVLIWP 179

Query: 179 VKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIAN 238
           V VQG++C  E+  AI   N L  G   PRPD++I+ARGGGSIEDLW FN+E +VRA A 
Sbjct: 180 VAVQGEKCAPEVTRAIQGFNRLSPGGALPRPDLLIVARGGGSIEDLWGFNEESVVRAAAA 239

Query: 239 SSIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIR 298
           S IP+ISA+GHETD TL D+AAD RAPTPT AAE+AVPV+  L + +   EAR+ + +  
Sbjct: 240 SEIPLISAVGHETDTTLIDFAADQRAPTPTAAAELAVPVRMDLLAWVDKQEARMTHALTS 299

Query: 299 LIKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIK 358
            +  +   L  L +ALP  ++ L   R RLD     L   L   +  +          ++
Sbjct: 300 GVTARGQRLRDLARALPRPERLLDTPRQRLDAWSDRLPAALTRTVQARRVRLFEASGALR 359

Query: 359 SDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHT 418
              L   +   R+  L  +  +   +++ +         ++  L +     +  I     
Sbjct: 360 PGALQSRLASRREMFLSWEARLAPALQRMVDRKRETLDRRLDRLSLRP--IERDIARKSE 417

Query: 419 HIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRN 478
            + ++  R+      +++     ++   R+ ++  YK TL+RGY  ++  + + +T +  
Sbjct: 418 QLDRVARRLSDAGDRQLRGWRERINAMDRLRETLGYKATLQRGYAVVRG-DGDVVTTRAA 476

Query: 479 LATKTRILINFFDGQ--ANAIVINKAPPKEQPT-KKCQLHNNKREKQGTQGELF 529
                 + I F DG+        + A        K  +    +      QG LF
Sbjct: 477 ALGAQALEIEFADGRMPVGGAPDDGAAQDRTLAEKPVKKPGKRPSDPPDQGSLF 530


>gi|254502889|ref|ZP_05115040.1| exodeoxyribonuclease VII, large subunit [Labrenzia alexandrii
           DFL-11]
 gi|222438960|gb|EEE45639.1| exodeoxyribonuclease VII, large subunit [Labrenzia alexandrii
           DFL-11]
          Length = 540

 Score =  435 bits (1118), Expect = e-119,   Method: Composition-based stats.
 Identities = 199/524 (37%), Positives = 292/524 (55%), Gaps = 3/524 (0%)

Query: 6   QKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRID 65
                +  E+SVSE+S+ +K  +E    +V VRGE+ G      SGH Y  LKD+ + + 
Sbjct: 20  ADTPSNVAEFSVSEISFSIKRTMEDAFGYVRVRGEL-GRISRPGSGHIYLDLKDDRAVLS 78

Query: 66  AIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKK 125
            +IW+G  +K++  PE+G+E +  GKITTFPG SKYQ++I++L P+G+G L+  LE+RKK
Sbjct: 79  GVIWRGVASKLKIQPEQGLEVIATGKITTFPGQSKYQMVIDALEPAGAGALMALLEERKK 138

Query: 126 KLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDE 185
           KL  EGLF+++ K P+P +P +I V+TSPTGAVIRDIL RIS RFP+ V+++PV+VQG+ 
Sbjct: 139 KLAAEGLFAEERKRPLPSLPNVIGVVTSPTGAVIRDILHRISDRFPVHVLVWPVRVQGET 198

Query: 186 CPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIIS 245
              E+AN I   N  + G T PRPD++I+ARGGGSIEDLW FN+E +VRA A S IP+IS
Sbjct: 199 SGAEVANGIRGFNAFQTGGTIPRPDLVIVARGGGSIEDLWGFNEEAVVRAAAESQIPLIS 258

Query: 246 AIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKIN 305
           A+GHETDWTL D AADLRAPTPTGAAE+AVPVK  L S + +   RL+  + R +  +  
Sbjct: 259 AVGHETDWTLIDLAADLRAPTPTGAAEIAVPVKAELMSMVDDRARRLSTGLQRFVGSRRT 318

Query: 306 TLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHN 365
            L +   ALP     L+  R R D     LE  L +        + +   R+    L   
Sbjct: 319 ELRAASAALPAPRDLLALPRQRFDTAANSLERGLIVNTKHHRSTYQNASARLSPIVLTRL 378

Query: 366 IQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLIT 425
             K RQ +L      ++ +   +          +A L   R             +  L  
Sbjct: 379 STKARQDLLVAGDRQQRALSVGIAQKRQAFDAIVARLTPSR--LSQHTALSKERVTGLGD 436

Query: 426 RIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRI 485
           R++     ++K     +    ++L+S +YK+ L RGY  ++D +   I     + T   +
Sbjct: 437 RLDRAYLTQLKDSAAKLDGLQKLLKSLSYKDVLARGYAVVRDADGQPIRSTSAVETGAAL 496

Query: 486 LINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
            +   DG  +A+ ++ +   ++P           +    QG LF
Sbjct: 497 SVELADGTLDAVAMSGSSAPKKPKTTGPKKAASHKPAADQGNLF 540


>gi|315122013|ref|YP_004062502.1| exodeoxyribonuclease VII large subunit [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495415|gb|ADR52014.1| exodeoxyribonuclease VII large subunit [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 533

 Score =  434 bits (1115), Expect = e-119,   Method: Composition-based stats.
 Identities = 379/533 (71%), Positives = 445/533 (83%), Gaps = 4/533 (0%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           MN   QKNSL  PEYSVSELSYHLK+ VES   +V VRGEISGYRGIH+SGHAYFSLKDN
Sbjct: 1   MNSSPQKNSLTLPEYSVSELSYHLKNTVESKFPYVFVRGEISGYRGIHASGHAYFSLKDN 60

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            SRIDA+IWKGTL+KIE  PEEGIEFL +GKITTFPGSSKYQIIIESLIPSGSG L+T L
Sbjct: 61  KSRIDAVIWKGTLSKIEHPPEEGIEFLALGKITTFPGSSKYQIIIESLIPSGSGALMTIL 120

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           E+RKKKL EE LFSD++KNPIPF+PK IAVITSPTGAVIRDILQRISCRFP+RVI+FP K
Sbjct: 121 EERKKKLREEELFSDKYKNPIPFMPKNIAVITSPTGAVIRDILQRISCRFPVRVIVFPAK 180

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQGDECP+EI NAI+QLN LKE   CPRPDIIILARGGGSIEDLWHFNDE IVRAIANSS
Sbjct: 181 VQGDECPREIVNAIIQLNGLKEESICPRPDIIILARGGGSIEDLWHFNDETIVRAIANSS 240

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IPIISAIGHETDWTL+DYAADLRAPTPTGAAEMAVPVK  L SSL +LE+RLN+ I+RL 
Sbjct: 241 IPIISAIGHETDWTLSDYAADLRAPTPTGAAEMAVPVKHLLTSSLKSLESRLNHSIVRLT 300

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           K K+N LNSL+K LPNSDQ LSC RY+LDRL RELEHNLEIIIFRK R+FN+ I RIKSD
Sbjct: 301 KNKVNCLNSLIKILPNSDQILSCPRYQLDRLSRELEHNLEIIIFRKCRYFNNTIIRIKSD 360

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420
             +HNIQK RQ+I++KQ++IE  ++Q+LR I L+ ++K  +LHML EQTK+RI  LH HI
Sbjct: 361 VPMHNIQKYRQNIIKKQEYIEHQIEQYLRCIHLKTQQKGTMLHMLCEQTKSRITRLHAHI 420

Query: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480
           K  I RIE +LS+KI++CHTS+S   RIL+S A++N LKRGY++I+D NNN +T+   L+
Sbjct: 421 KDSINRIELMLSYKIQNCHTSISTPNRILKSLAHRNILKRGYSTIRDLNNNLLTKTNKLS 480

Query: 481 TKTRILINFFDGQANAIVINKA----PPKEQPTKKCQLHNNKREKQGTQGELF 529
             T ILI+FF+GQA+AI+ NK     P +++ T+K + ++ K++    QG LF
Sbjct: 481 AGTNILIDFFEGQASAIITNKNHSVLPIEKKYTRKRKDNSQKKKNHEDQGSLF 533


>gi|294853461|ref|ZP_06794133.1| exodeoxyribonuclease VII [Brucella sp. NVSL 07-0026]
 gi|294819116|gb|EFG36116.1| exodeoxyribonuclease VII [Brucella sp. NVSL 07-0026]
          Length = 513

 Score =  433 bits (1114), Expect = e-119,   Method: Composition-based stats.
 Identities = 211/496 (42%), Positives = 310/496 (62%), Gaps = 2/496 (0%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           +      S +  EYSVSE+S  LK  VE    HV VRGEISGYRG HSSGHAYF+LKD+ 
Sbjct: 6   DSSFPGASSNVAEYSVSEISGALKRTVEDTFGHVRVRGEISGYRGPHSSGHAYFALKDDR 65

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           +R++A+IW+G+++++ F PEEG+E +  GK+TT+PGSSKYQI+IE + P+G+G L+  LE
Sbjct: 66  ARLEAVIWRGSMSRLRFRPEEGMEVIATGKLTTYPGSSKYQIVIEQMEPAGAGALMALLE 125

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           +RK++L  EGLF    K  +PF+P++I V+TSPTGAVIRDI+ RIS R+PLRVI++PV+V
Sbjct: 126 ERKQRLAAEGLFDPALKQLLPFMPRVIGVVTSPTGAVIRDIIHRISDRYPLRVIVWPVRV 185

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QGD C  E+A A+   NTL +    PRPD++I+ARGGGS+EDLW FNDE++VRA+A S I
Sbjct: 186 QGDTCGPEVATAVNGFNTLPDDGPIPRPDVLIVARGGGSLEDLWGFNDEIVVRAVAASHI 245

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETDWTL D AAD+RAPTPTGAAEMAVPVK  LQ+SL +  ARL++ + R   
Sbjct: 246 PVISAVGHETDWTLIDLAADMRAPTPTGAAEMAVPVKADLQASLASQSARLSSAMSRFFD 305

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            K     + ++A+P++DQ L+  R R D     L   L +   +K  HF+    ++    
Sbjct: 306 QKRQAHRAAVRAMPSADQLLALPRRRFDEAASRLTRALFVNTQKKRVHFDGHARQLSPRL 365

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIK 421
           L   + +  + +    Q + + ++  LR        +   L    E    R     + ++
Sbjct: 366 LQRRLVELERGVTMLGQRLPRALEAFLRERRTAFTHRANRLSP--EPILRRTRLTGSTLE 423

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLAT 481
           +L  R +  +   I+          R++++ +Y++ L+RG+  + D     + Q   ++ 
Sbjct: 424 QLDRRRDQAVRLLIERVKRRSQELDRLMRTLSYESVLERGFAVVFDAQGKPVKQAAAVSP 483

Query: 482 KTRILINFFDGQANAI 497
              + + F DG    +
Sbjct: 484 GDALSVRFRDGDVGVV 499


>gi|225686532|ref|YP_002734504.1| exodeoxyribonuclease VII large subunit [Brucella melitensis ATCC
           23457]
 gi|256262331|ref|ZP_05464863.1| exodeoxyribonuclease 7 large subunit [Brucella melitensis bv. 2
           str. 63/9]
 gi|254783692|sp|C0RLR7|EX7L_BRUMB RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|225642637|gb|ACO02550.1| exodeoxyribonuclease VII, large subunit [Brucella melitensis ATCC
           23457]
 gi|263092059|gb|EEZ16356.1| exodeoxyribonuclease 7 large subunit [Brucella melitensis bv. 2
           str. 63/9]
 gi|326410913|gb|ADZ67977.1| exodeoxyribonuclease VII large subunit [Brucella melitensis M28]
 gi|326554204|gb|ADZ88843.1| exodeoxyribonuclease VII large subunit [Brucella melitensis M5-90]
          Length = 511

 Score =  432 bits (1110), Expect = e-119,   Method: Composition-based stats.
 Identities = 212/496 (42%), Positives = 309/496 (62%), Gaps = 2/496 (0%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           +      S +  EYSVSE+S  LK  VE    HV VRGEISGYRG HSSGHAYF+LKD+ 
Sbjct: 4   DSSFPGASSNVAEYSVSEISGALKRTVEDTFGHVRVRGEISGYRGPHSSGHAYFALKDDR 63

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           +R++A+IW+G+++++ F PEEG+E +  GK+TT+PGSSKYQI+IE + P+G+G L+  LE
Sbjct: 64  ARLEAVIWRGSMSRLRFRPEEGMEVIATGKLTTYPGSSKYQIVIEQMEPAGAGALMALLE 123

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           +RK++L  EGLF    K  +PF+P++I V+TSPTGAVIRDI+ RIS R+PLRVI++PV+V
Sbjct: 124 ERKQRLAAEGLFDPALKQLLPFMPRVIGVVTSPTGAVIRDIIHRISDRYPLRVIVWPVRV 183

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QGD C  E+A A+   NTL +    PRPD++I+ARGGGS+EDLW FNDE++VRA+A S I
Sbjct: 184 QGDTCGPEVATAVNGFNTLPDDGPIPRPDVLIVARGGGSLEDLWGFNDEIVVRAVAASHI 243

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETDWTL D AAD+RAPTPTGAAEMAVPVK  LQ+SL +  ARL++ + R   
Sbjct: 244 PVISAVGHETDWTLIDLAADMRAPTPTGAAEMAVPVKADLQASLASQSARLSSAMSRFFD 303

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            K     +  +A+P++DQ L+  R R D     L   L +   +K  HF+    ++    
Sbjct: 304 QKRQAHRAAARAMPSADQLLALPRRRFDEAASRLTRALFVNTQKKRVHFDGHARQLSPRL 363

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIK 421
           L   + +  + +    Q + + ++  LR        +   L    E    R     + ++
Sbjct: 364 LQRRLVELERGVTMLGQRLPRALEAFLRERRTAFTHRANRLSP--EPILRRTRLTGSTLE 421

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLAT 481
           +L  R +  +   I+          R++++ +Y++ L+RG+  + D     + Q   ++ 
Sbjct: 422 QLDRRRDQAVRLLIERVKRRSQELDRLMRTLSYESVLERGFAVVFDAQGKPVKQAAAVSP 481

Query: 482 KTRILINFFDGQANAI 497
              + I F DG    +
Sbjct: 482 GDALSIRFRDGDVGVV 497


>gi|17988872|ref|NP_541505.1| exodeoxyribonuclease VII large subunit [Brucella melitensis bv. 1
           str. 16M]
 gi|225629238|ref|ZP_03787271.1| exodeoxyribonuclease VII, large subunit [Brucella ceti str. Cudo]
 gi|261216208|ref|ZP_05930489.1| exodeoxyribonuclease VII large subunit [Brucella abortus bv. 3 str.
           Tulya]
 gi|17984697|gb|AAL53769.1| exodeoxyribonuclease vii large subunit [Brucella melitensis bv. 1
           str. 16M]
 gi|225615734|gb|EEH12783.1| exodeoxyribonuclease VII, large subunit [Brucella ceti str. Cudo]
 gi|260917815|gb|EEX84676.1| exodeoxyribonuclease VII large subunit [Brucella abortus bv. 3 str.
           Tulya]
          Length = 513

 Score =  431 bits (1108), Expect = e-118,   Method: Composition-based stats.
 Identities = 211/496 (42%), Positives = 309/496 (62%), Gaps = 2/496 (0%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           +      S +  EYSVSE+S  LK  VE    HV VRGEISGYRG HSSGHAYF+LKD+ 
Sbjct: 6   DSSFPGASSNVAEYSVSEISGALKRTVEDTFGHVRVRGEISGYRGPHSSGHAYFALKDDR 65

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           +R++A+IW+G+++++ F PEEG+E +  GK+TT+PGSSKYQI+IE + P+G+G L+  LE
Sbjct: 66  ARLEAVIWRGSMSRLRFRPEEGMEVIATGKLTTYPGSSKYQIVIEQMEPAGAGALMALLE 125

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           +RK++L  EGLF    K  +PF+P++I V+TSPTGAVIRDI+ RIS R+PLRVI++PV+V
Sbjct: 126 ERKQRLAAEGLFDPALKQLLPFMPRVIGVVTSPTGAVIRDIIHRISDRYPLRVIVWPVRV 185

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QGD C  E+A A+   NTL +    PRPD++I+ARGGGS+EDLW FNDE++VRA+A S I
Sbjct: 186 QGDTCGPEVATAVNGFNTLPDDGPIPRPDVLIVARGGGSLEDLWGFNDEIVVRAVAASHI 245

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETDWTL D AAD+RAPTPTGAAEMAVPVK  LQ+SL +  ARL++ + R   
Sbjct: 246 PVISAVGHETDWTLIDLAADMRAPTPTGAAEMAVPVKADLQASLASQSARLSSAMSRFFD 305

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            K     +  +A+P++DQ L+  R R D     L   L +   +K  HF+    ++    
Sbjct: 306 QKRQAHRAAARAMPSADQLLALPRRRFDEAASRLTRALFVNTQKKRVHFDGHARQLSPRL 365

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIK 421
           L   + +  + +    Q + + ++  LR        +   L    E    R     + ++
Sbjct: 366 LQRRLVELERGVTMLGQRLPRALEAFLRERRTAFTHRANRLSP--EPILRRTRLTGSTLE 423

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLAT 481
           +L  R +  +   I+          R++++ +Y++ L+RG+  + D     + Q   ++ 
Sbjct: 424 QLDRRRDQAVRLLIERVKRRSQELDRLMRTLSYESVLERGFAVVFDAQGKPVKQAAAVSP 483

Query: 482 KTRILINFFDGQANAI 497
              + + F DG    +
Sbjct: 484 GDALSVRFRDGDVGVV 499


>gi|254695790|ref|ZP_05157618.1| exodeoxyribonuclease VII large subunit [Brucella abortus bv. 3 str.
           Tulya]
 gi|254705758|ref|ZP_05167586.1| exodeoxyribonuclease VII large subunit [Brucella pinnipedialis
           M163/99/10]
 gi|254710990|ref|ZP_05172801.1| exodeoxyribonuclease VII large subunit [Brucella pinnipedialis
           B2/94]
 gi|256029372|ref|ZP_05442986.1| exodeoxyribonuclease VII large subunit [Brucella pinnipedialis
           M292/94/1]
 gi|256043639|ref|ZP_05446564.1| exodeoxyribonuclease VII large subunit [Brucella melitensis bv. 1
           str. Rev.1]
 gi|256111324|ref|ZP_05452350.1| exodeoxyribonuclease VII large subunit [Brucella melitensis bv. 3
           str. Ether]
 gi|256157564|ref|ZP_05455482.1| exodeoxyribonuclease VII large subunit [Brucella ceti M490/95/1]
 gi|256253461|ref|ZP_05458997.1| exodeoxyribonuclease VII large subunit [Brucella ceti B1/94]
 gi|260167540|ref|ZP_05754351.1| exodeoxyribonuclease VII large subunit [Brucella sp. F5/99]
 gi|260564829|ref|ZP_05835314.1| exodeoxyribonuclease 7 large subunit [Brucella melitensis bv. 1
           str. 16M]
 gi|261220588|ref|ZP_05934869.1| exodeoxyribonuclease 7 large subunit [Brucella ceti B1/94]
 gi|261313179|ref|ZP_05952376.1| exodeoxyribonuclease 7 large subunit [Brucella pinnipedialis
           M163/99/10]
 gi|261318571|ref|ZP_05957768.1| exodeoxyribonuclease 7 large subunit [Brucella pinnipedialis B2/94]
 gi|261756959|ref|ZP_06000668.1| exodeoxyribonuclease 7 large subunit [Brucella sp. F5/99]
 gi|265986371|ref|ZP_06098928.1| exodeoxyribonuclease 7 large subunit [Brucella pinnipedialis
           M292/94/1]
 gi|265990059|ref|ZP_06102616.1| exodeoxyribonuclease 7 large subunit [Brucella melitensis bv. 1
           str. Rev.1]
 gi|265992830|ref|ZP_06105387.1| exodeoxyribonuclease 7 large subunit [Brucella melitensis bv. 3
           str. Ether]
 gi|265996065|ref|ZP_06108622.1| exodeoxyribonuclease 7 large subunit [Brucella ceti M490/95/1]
 gi|31563442|sp|Q8YCK1|EX7L_BRUME RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|260152472|gb|EEW87565.1| exodeoxyribonuclease 7 large subunit [Brucella melitensis bv. 1
           str. 16M]
 gi|260919172|gb|EEX85825.1| exodeoxyribonuclease 7 large subunit [Brucella ceti B1/94]
 gi|261297794|gb|EEY01291.1| exodeoxyribonuclease 7 large subunit [Brucella pinnipedialis B2/94]
 gi|261302205|gb|EEY05702.1| exodeoxyribonuclease 7 large subunit [Brucella pinnipedialis
           M163/99/10]
 gi|261736943|gb|EEY24939.1| exodeoxyribonuclease 7 large subunit [Brucella sp. F5/99]
 gi|262550362|gb|EEZ06523.1| exodeoxyribonuclease 7 large subunit [Brucella ceti M490/95/1]
 gi|262763700|gb|EEZ09732.1| exodeoxyribonuclease 7 large subunit [Brucella melitensis bv. 3
           str. Ether]
 gi|263000728|gb|EEZ13418.1| exodeoxyribonuclease 7 large subunit [Brucella melitensis bv. 1
           str. Rev.1]
 gi|264658568|gb|EEZ28829.1| exodeoxyribonuclease 7 large subunit [Brucella pinnipedialis
           M292/94/1]
          Length = 511

 Score =  431 bits (1108), Expect = e-118,   Method: Composition-based stats.
 Identities = 211/496 (42%), Positives = 309/496 (62%), Gaps = 2/496 (0%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           +      S +  EYSVSE+S  LK  VE    HV VRGEISGYRG HSSGHAYF+LKD+ 
Sbjct: 4   DSSFPGASSNVAEYSVSEISGALKRTVEDTFGHVRVRGEISGYRGPHSSGHAYFALKDDR 63

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           +R++A+IW+G+++++ F PEEG+E +  GK+TT+PGSSKYQI+IE + P+G+G L+  LE
Sbjct: 64  ARLEAVIWRGSMSRLRFRPEEGMEVIATGKLTTYPGSSKYQIVIEQMEPAGAGALMALLE 123

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           +RK++L  EGLF    K  +PF+P++I V+TSPTGAVIRDI+ RIS R+PLRVI++PV+V
Sbjct: 124 ERKQRLAAEGLFDPALKQLLPFMPRVIGVVTSPTGAVIRDIIHRISDRYPLRVIVWPVRV 183

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QGD C  E+A A+   NTL +    PRPD++I+ARGGGS+EDLW FNDE++VRA+A S I
Sbjct: 184 QGDTCGPEVATAVNGFNTLPDDGPIPRPDVLIVARGGGSLEDLWGFNDEIVVRAVAASHI 243

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETDWTL D AAD+RAPTPTGAAEMAVPVK  LQ+SL +  ARL++ + R   
Sbjct: 244 PVISAVGHETDWTLIDLAADMRAPTPTGAAEMAVPVKADLQASLASQSARLSSAMSRFFD 303

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            K     +  +A+P++DQ L+  R R D     L   L +   +K  HF+    ++    
Sbjct: 304 QKRQAHRAAARAMPSADQLLALPRRRFDEAASRLTRALFVNTQKKRVHFDGHARQLSPRL 363

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIK 421
           L   + +  + +    Q + + ++  LR        +   L    E    R     + ++
Sbjct: 364 LQRRLVELERGVTMLGQRLPRALEAFLRERRTAFTHRANRLSP--EPILRRTRLTGSTLE 421

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLAT 481
           +L  R +  +   I+          R++++ +Y++ L+RG+  + D     + Q   ++ 
Sbjct: 422 QLDRRRDQAVRLLIERVKRRSQELDRLMRTLSYESVLERGFAVVFDAQGKPVKQAAAVSP 481

Query: 482 KTRILINFFDGQANAI 497
              + + F DG    +
Sbjct: 482 GDALSVRFRDGDVGVV 497


>gi|161620822|ref|YP_001594708.1| exodeoxyribonuclease VII large subunit [Brucella canis ATCC 23365]
 gi|254703100|ref|ZP_05164928.1| exodeoxyribonuclease VII large subunit [Brucella suis bv. 3 str.
           686]
 gi|260567971|ref|ZP_05838440.1| exodeoxyribonuclease 7 large subunit [Brucella suis bv. 4 str. 40]
 gi|261753717|ref|ZP_05997426.1| exodeoxyribonuclease 7 large subunit [Brucella suis bv. 3 str. 686]
 gi|189037854|sp|A9MC50|EX7L_BRUC2 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|161337633|gb|ABX63937.1| exodeoxyribonuclease VII, large subunit [Brucella canis ATCC 23365]
 gi|260154636|gb|EEW89717.1| exodeoxyribonuclease 7 large subunit [Brucella suis bv. 4 str. 40]
 gi|261743470|gb|EEY31396.1| exodeoxyribonuclease 7 large subunit [Brucella suis bv. 3 str. 686]
          Length = 511

 Score =  431 bits (1108), Expect = e-118,   Method: Composition-based stats.
 Identities = 211/496 (42%), Positives = 309/496 (62%), Gaps = 2/496 (0%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           +      S +  EYSVSE+S  LK  VE    HV VRGEISGYRG HSSGHAYF+LKD+ 
Sbjct: 4   DSSFPGASSNVAEYSVSEISGALKRTVEDTFGHVRVRGEISGYRGPHSSGHAYFALKDDR 63

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           +R++A+IW+G+++++ F PEEG+E +  GK+TT+PGSSKYQI+IE + P+G+G L+  LE
Sbjct: 64  ARLEAVIWRGSMSRLRFRPEEGMEVIATGKLTTYPGSSKYQIVIEQMEPAGAGALMALLE 123

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           +RK++L  EGLF    K  +PF+P++I V+TSPTGAVIRDI+ RIS R+PLRVI++PV+V
Sbjct: 124 ERKQRLAAEGLFDPALKQLLPFMPRVIGVVTSPTGAVIRDIIHRISDRYPLRVIVWPVRV 183

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QGD C  E+A A+   NTL +    PRPD++I+ARGGGS+EDLW FNDE++VRA+A S I
Sbjct: 184 QGDTCGPEVATAVNGFNTLPDDGPIPRPDVLIVARGGGSLEDLWGFNDEIVVRAVAASHI 243

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETDWTL D AAD+RAPTPTGAAEMAVPVK  LQ+SL +  ARL++ + R   
Sbjct: 244 PVISAVGHETDWTLIDLAADMRAPTPTGAAEMAVPVKADLQASLASQSARLSSAMSRFFD 303

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            K     +  +A+P++DQ L+  R R D     L   L +   +K  HF+    ++    
Sbjct: 304 QKRQAHRAAARAMPSADQLLALPRRRFDEAASRLTRALFVNTQKKRVHFDGHARQLSPRL 363

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIK 421
           L   + +  + +    Q + + ++  LR        +   L    E    R     + ++
Sbjct: 364 LQRRLVELERGVTMLGQRLPRALEAFLRERQTAFTHRANRLSP--EPILRRTRLTGSTLE 421

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLAT 481
           +L  R +  +   I+          R++++ +Y++ L+RG+  + D     + Q   ++ 
Sbjct: 422 QLDRRRDQAVRLLIERVKRRSQELDRLMRTLSYESVLERGFAVVFDAQGKPVKQAAAVSP 481

Query: 482 KTRILINFFDGQANAI 497
              + + F DG    +
Sbjct: 482 GDALSVRFRDGDVGVV 497


>gi|62317398|ref|YP_223251.1| exodeoxyribonuclease VII large subunit [Brucella abortus bv. 1 str.
           9-941]
 gi|83269378|ref|YP_418669.1| exodeoxyribonuclease VII large subunit [Brucella melitensis biovar
           Abortus 2308]
 gi|189022653|ref|YP_001932394.1| exodeoxyribonuclease VII large subunit [Brucella abortus S19]
 gi|254690900|ref|ZP_05154154.1| exodeoxyribonuclease VII large subunit [Brucella abortus bv. 6 str.
           870]
 gi|254698681|ref|ZP_05160509.1| exodeoxyribonuclease VII large subunit [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254732128|ref|ZP_05190706.1| exodeoxyribonuclease VII large subunit [Brucella abortus bv. 4 str.
           292]
 gi|256256085|ref|ZP_05461621.1| exodeoxyribonuclease VII large subunit [Brucella abortus bv. 9 str.
           C68]
 gi|260544636|ref|ZP_05820457.1| exonuclease VII [Brucella abortus NCTC 8038]
 gi|260882304|ref|ZP_05893918.1| exodeoxyribonuclease 7 large subunit [Brucella abortus bv. 9 str.
           C68]
 gi|297249439|ref|ZP_06933140.1| exodeoxyribonuclease VII, large subunit [Brucella abortus bv. 5
           str. B3196]
 gi|81309307|sp|Q578P4|EX7L_BRUAB RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|123546037|sp|Q2YL15|EX7L_BRUA2 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|226694639|sp|B2SAR1|EX7L_BRUA1 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|62197591|gb|AAX75890.1| XseA, exodeoxyribonuclease VII, large subunit [Brucella abortus bv.
           1 str. 9-941]
 gi|82939652|emb|CAJ12641.1| Exonuclease VII, large subunit:OB-fold nucleic acid binding domain
           [Brucella melitensis biovar Abortus 2308]
 gi|189021227|gb|ACD73948.1| Exonuclease VII, large subunit [Brucella abortus S19]
 gi|260097907|gb|EEW81781.1| exonuclease VII [Brucella abortus NCTC 8038]
 gi|260871832|gb|EEX78901.1| exodeoxyribonuclease 7 large subunit [Brucella abortus bv. 9 str.
           C68]
 gi|297173308|gb|EFH32672.1| exodeoxyribonuclease VII, large subunit [Brucella abortus bv. 5
           str. B3196]
          Length = 511

 Score =  431 bits (1107), Expect = e-118,   Method: Composition-based stats.
 Identities = 211/496 (42%), Positives = 309/496 (62%), Gaps = 2/496 (0%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           +      S +  EYSVSE+S  LK  VE    HV VRGEISGYRG HSSGHAYF+LKD+ 
Sbjct: 4   DSSFPGASSNVAEYSVSEISGALKRTVEDTFGHVRVRGEISGYRGPHSSGHAYFALKDDR 63

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           +R++A+IW+G+++++ F PEEG+E +  GK+TT+PGSSKYQI+IE + P+G+G L+  LE
Sbjct: 64  ARLEAVIWRGSMSRLRFRPEEGMEVIATGKLTTYPGSSKYQIVIEQMEPAGAGALMALLE 123

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           +RK++L  EGLF    K  +PF+P++I V+TSPTGAVIRDI+ RIS R+PLRVI++PV+V
Sbjct: 124 ERKQRLAAEGLFDPTLKQLLPFMPRVIGVVTSPTGAVIRDIIHRISDRYPLRVIVWPVRV 183

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QGD C  E+A A+   NTL +    PRPD++I+ARGGGS+EDLW FNDE++VRA+A S I
Sbjct: 184 QGDTCGPEVATAVNGFNTLPDDGPIPRPDVLIVARGGGSLEDLWGFNDEIVVRAVAASHI 243

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETDWTL D AAD+RAPTPTGAAEMAVPVK  LQ+SL +  ARL++ + R   
Sbjct: 244 PVISAVGHETDWTLIDLAADMRAPTPTGAAEMAVPVKADLQASLASQSARLSSAMSRFFD 303

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            K     +  +A+P++DQ L+  R R D     L   L +   +K  HF+    ++    
Sbjct: 304 QKRQAHRAAARAMPSADQLLALPRRRFDEAASRLTRALFVNTQKKRVHFDGHARQLSPRL 363

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIK 421
           L   + +  + +    Q + + ++  LR        +   L    E    R     + ++
Sbjct: 364 LQRRLVELERGVTMLGQRLPRALEAFLRERRTAFTHRANRLSP--EPILRRTRLTGSTLE 421

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLAT 481
           +L  R +  +   I+          R++++ +Y++ L+RG+  + D     + Q   ++ 
Sbjct: 422 QLDRRRDQAVRLLIERVKRRSQELDRLMRTLSYESVLERGFAVVFDAQGKPVKQAAAVSP 481

Query: 482 KTRILINFFDGQANAI 497
              + + F DG    +
Sbjct: 482 GDALSVRFRDGDVGVV 497


>gi|237816952|ref|ZP_04595944.1| exodeoxyribonuclease VII, large subunit [Brucella abortus str. 2308
           A]
 gi|260756483|ref|ZP_05868831.1| exodeoxyribonuclease VII large subunit [Brucella abortus bv. 6 str.
           870]
 gi|260759915|ref|ZP_05872263.1| exodeoxyribonuclease VII large subunit [Brucella abortus bv. 4 str.
           292]
 gi|260763153|ref|ZP_05875485.1| exodeoxyribonuclease VII large subunit [Brucella abortus bv. 2 str.
           86/8/59]
 gi|237787765|gb|EEP61981.1| exodeoxyribonuclease VII, large subunit [Brucella abortus str. 2308
           A]
 gi|260670233|gb|EEX57173.1| exodeoxyribonuclease VII large subunit [Brucella abortus bv. 4 str.
           292]
 gi|260673574|gb|EEX60395.1| exodeoxyribonuclease VII large subunit [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260676591|gb|EEX63412.1| exodeoxyribonuclease VII large subunit [Brucella abortus bv. 6 str.
           870]
          Length = 513

 Score =  431 bits (1107), Expect = e-118,   Method: Composition-based stats.
 Identities = 211/496 (42%), Positives = 309/496 (62%), Gaps = 2/496 (0%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           +      S +  EYSVSE+S  LK  VE    HV VRGEISGYRG HSSGHAYF+LKD+ 
Sbjct: 6   DSSFPGASSNVAEYSVSEISGALKRTVEDTFGHVRVRGEISGYRGPHSSGHAYFALKDDR 65

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           +R++A+IW+G+++++ F PEEG+E +  GK+TT+PGSSKYQI+IE + P+G+G L+  LE
Sbjct: 66  ARLEAVIWRGSMSRLRFRPEEGMEVIATGKLTTYPGSSKYQIVIEQMEPAGAGALMALLE 125

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           +RK++L  EGLF    K  +PF+P++I V+TSPTGAVIRDI+ RIS R+PLRVI++PV+V
Sbjct: 126 ERKQRLAAEGLFDPTLKQLLPFMPRVIGVVTSPTGAVIRDIIHRISDRYPLRVIVWPVRV 185

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QGD C  E+A A+   NTL +    PRPD++I+ARGGGS+EDLW FNDE++VRA+A S I
Sbjct: 186 QGDTCGPEVATAVNGFNTLPDDGPIPRPDVLIVARGGGSLEDLWGFNDEIVVRAVAASHI 245

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETDWTL D AAD+RAPTPTGAAEMAVPVK  LQ+SL +  ARL++ + R   
Sbjct: 246 PVISAVGHETDWTLIDLAADMRAPTPTGAAEMAVPVKADLQASLASQSARLSSAMSRFFD 305

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            K     +  +A+P++DQ L+  R R D     L   L +   +K  HF+    ++    
Sbjct: 306 QKRQAHRAAARAMPSADQLLALPRRRFDEAASRLTRALFVNTQKKRVHFDGHARQLSPRL 365

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIK 421
           L   + +  + +    Q + + ++  LR        +   L    E    R     + ++
Sbjct: 366 LQRRLVELERGVTMLGQRLPRALEAFLRERRTAFTHRANRLSP--EPILRRTRLTGSTLE 423

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLAT 481
           +L  R +  +   I+          R++++ +Y++ L+RG+  + D     + Q   ++ 
Sbjct: 424 QLDRRRDQAVRLLIERVKRRSQELDRLMRTLSYESVLERGFAVVFDAQGKPVKQAAAVSP 483

Query: 482 KTRILINFFDGQANAI 497
              + + F DG    +
Sbjct: 484 GDALSVRFRDGDVGVV 499


>gi|83309311|ref|YP_419575.1| exonuclease VII large subunit [Magnetospirillum magneticum AMB-1]
 gi|82944152|dbj|BAE49016.1| Exonuclease VII large subunit [Magnetospirillum magneticum AMB-1]
          Length = 688

 Score =  430 bits (1106), Expect = e-118,   Method: Composition-based stats.
 Identities = 194/528 (36%), Positives = 296/528 (56%), Gaps = 26/528 (4%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M+  ++    + PEYSVSELS  L+  VE   S V VRGEISG++  HSSGH YF+LKD 
Sbjct: 186 MSDEARPAPSNVPEYSVSELSGSLRKTVEDAFSFVRVRGEISGFK-RHSSGHLYFALKDA 244

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            + +DA+ W+G+  K+   PE+G+E +  G++TT+PG SKYQ+++E +  +G G LL  L
Sbjct: 245 DAVLDAVCWRGSAGKLAIGPEDGMEVVATGRLTTYPGRSKYQMVVERMELAGQGALLKML 304

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           E RKK+L+ EGLF    K PIPF+P++I V+TSPTGAVIRDIL R++ RFP RV+++PV 
Sbjct: 305 EDRKKRLMAEGLFDTAKKRPIPFLPEVIGVVTSPTGAVIRDILHRLAERFPRRVLLWPVA 364

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQGD    ++A AI   N LK G   PRPD++I+ARGGGS+EDL  FN+E++VRA A S 
Sbjct: 365 VQGDGASAQVAAAIRGFNALKPGGAVPRPDVLIVARGGGSLEDLMAFNEEIVVRAAAESE 424

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP+ISA+GHETD TL D+A+DLRAPTPT AAE AVPV+  L +++ ++ ARL   + R +
Sbjct: 425 IPLISAVGHETDTTLIDFASDLRAPTPTAAAEKAVPVRAELIATVADMGARLIGAMQRGL 484

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           + +   L    +ALP+  + +     RLD     L +   +++ R+    + +  R++  
Sbjct: 485 EERRTRLGHTFRALPHPRRVMEDCARRLDERAERLTNAPRLLLERRRAELDRLAARLR-- 542

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420
                + +    +      ++  +K          + +                     +
Sbjct: 543 HPREQLAEAGHKLTALTTRLDHAMKTVSAAERAANERRTL------------------QL 584

Query: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480
           ++   R+   +   +      V+   ++L+SF+Y+  L+RG+  ++D +   +T      
Sbjct: 585 EQCAGRLIQAMPRLLDEKAKRVAHAGQLLESFSYRKVLERGFAVVRDEHGTPVTSVAAAK 644

Query: 481 TKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGEL 528
               + + F DG+A   V   A P        + H       G QG L
Sbjct: 645 PGAALAVEFADGKAGVRVEGTAAP-----PAPKPHRKPATPDGRQGSL 687


>gi|254699977|ref|ZP_05161805.1| exodeoxyribonuclease VII large subunit [Brucella suis bv. 5 str.
           513]
          Length = 511

 Score =  430 bits (1106), Expect = e-118,   Method: Composition-based stats.
 Identities = 211/496 (42%), Positives = 309/496 (62%), Gaps = 2/496 (0%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           +      S +  EYSVSE+S  LK  VE    HV VRGEISGYRG HSSGHAYF+LKD+ 
Sbjct: 4   DSSFPGASSNVAEYSVSEISGALKRTVEDTFGHVRVRGEISGYRGPHSSGHAYFALKDDR 63

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           +R++A+IW+G+++++ F PEEG+E +  GK+TT+PGSSKYQI+IE + P+G+G L+  LE
Sbjct: 64  ARLEAVIWRGSMSRLRFRPEEGMEVIATGKLTTYPGSSKYQIVIEQMEPAGAGALMALLE 123

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           +RK++L  EGLF    K  +PF+P++I V+TSPTGAVIRDI+ RIS R+PLRVI++PV+V
Sbjct: 124 ERKQRLAAEGLFDPALKQLLPFMPRVIGVVTSPTGAVIRDIIHRISDRYPLRVIVWPVRV 183

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QGD C  E+A A+   NTL +    PRPD++I+ARGGGS+EDLW FNDE++VRA+A S I
Sbjct: 184 QGDTCGPEVATAVNGFNTLPDDGPIPRPDVLIVARGGGSLEDLWGFNDEIVVRAVAASHI 243

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETDWTL D AAD+RAPTPTGAAEMAVPVK  LQ+SL +  ARL++ + R   
Sbjct: 244 PVISAVGHETDWTLIDLAADMRAPTPTGAAEMAVPVKADLQASLASQSARLSSAMSRFFD 303

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            K     +  +A+P++DQ L+  R R D     L   L +   +K  HF+    ++    
Sbjct: 304 QKRQAHRAAARAMPSADQLLALPRRRFDEAVSRLTRALFVNTQKKRVHFDGHARQLSPRL 363

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIK 421
           L   + +  + +    Q + + ++  LR        +   L    E    R     + ++
Sbjct: 364 LQRRLVELERGVTMLGQRLPRALEAFLRERRTAFTHRANRLSP--EPILRRTRLTGSTLE 421

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLAT 481
           +L  R +  +   I+          R++++ +Y++ L+RG+  + D     + Q   ++ 
Sbjct: 422 QLDRRRDQAVRLLIERVKRRSQELDRLMRTLSYESVLERGFAVVFDAQGKPVKQAAAVSP 481

Query: 482 KTRILINFFDGQANAI 497
              + + F DG    +
Sbjct: 482 GDALSVRFRDGDVGVV 497


>gi|261750459|ref|ZP_05994168.1| exodeoxyribonuclease 7 large subunit [Brucella suis bv. 5 str. 513]
 gi|261740212|gb|EEY28138.1| exodeoxyribonuclease 7 large subunit [Brucella suis bv. 5 str. 513]
          Length = 513

 Score =  430 bits (1106), Expect = e-118,   Method: Composition-based stats.
 Identities = 211/496 (42%), Positives = 309/496 (62%), Gaps = 2/496 (0%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           +      S +  EYSVSE+S  LK  VE    HV VRGEISGYRG HSSGHAYF+LKD+ 
Sbjct: 6   DSSFPGASSNVAEYSVSEISGALKRTVEDTFGHVRVRGEISGYRGPHSSGHAYFALKDDR 65

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           +R++A+IW+G+++++ F PEEG+E +  GK+TT+PGSSKYQI+IE + P+G+G L+  LE
Sbjct: 66  ARLEAVIWRGSMSRLRFRPEEGMEVIATGKLTTYPGSSKYQIVIEQMEPAGAGALMALLE 125

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           +RK++L  EGLF    K  +PF+P++I V+TSPTGAVIRDI+ RIS R+PLRVI++PV+V
Sbjct: 126 ERKQRLAAEGLFDPALKQLLPFMPRVIGVVTSPTGAVIRDIIHRISDRYPLRVIVWPVRV 185

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QGD C  E+A A+   NTL +    PRPD++I+ARGGGS+EDLW FNDE++VRA+A S I
Sbjct: 186 QGDTCGPEVATAVNGFNTLPDDGPIPRPDVLIVARGGGSLEDLWGFNDEIVVRAVAASHI 245

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETDWTL D AAD+RAPTPTGAAEMAVPVK  LQ+SL +  ARL++ + R   
Sbjct: 246 PVISAVGHETDWTLIDLAADMRAPTPTGAAEMAVPVKADLQASLASQSARLSSAMSRFFD 305

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            K     +  +A+P++DQ L+  R R D     L   L +   +K  HF+    ++    
Sbjct: 306 QKRQAHRAAARAMPSADQLLALPRRRFDEAVSRLTRALFVNTQKKRVHFDGHARQLSPRL 365

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIK 421
           L   + +  + +    Q + + ++  LR        +   L    E    R     + ++
Sbjct: 366 LQRRLVELERGVTMLGQRLPRALEAFLRERRTAFTHRANRLSP--EPILRRTRLTGSTLE 423

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLAT 481
           +L  R +  +   I+          R++++ +Y++ L+RG+  + D     + Q   ++ 
Sbjct: 424 QLDRRRDQAVRLLIERVKRRSQELDRLMRTLSYESVLERGFAVVFDAQGKPVKQAAAVSP 483

Query: 482 KTRILINFFDGQANAI 497
              + + F DG    +
Sbjct: 484 GDALSVRFRDGDVGVV 499


>gi|256015528|ref|YP_003105537.1| exodeoxyribonuclease VII large subunit [Brucella microti CCM 4915]
 gi|255998188|gb|ACU49875.1| exodeoxyribonuclease VII large subunit [Brucella microti CCM 4915]
          Length = 511

 Score =  430 bits (1105), Expect = e-118,   Method: Composition-based stats.
 Identities = 211/496 (42%), Positives = 309/496 (62%), Gaps = 2/496 (0%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           +      S +  EYSVSE+S  LK  VE    HV VRGEISGYRG HSSGHAYF+LKD+ 
Sbjct: 4   DSSFPGASSNVAEYSVSEISGALKRTVEDTFGHVRVRGEISGYRGPHSSGHAYFALKDDR 63

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           +R++A+IW+G+++++ F PEEG+E +  GK+TT+PGSSKYQI+IE + P+G+G L+  LE
Sbjct: 64  ARLEAVIWRGSMSRLRFRPEEGMEVIATGKLTTYPGSSKYQIVIEQMEPAGAGALMALLE 123

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           +RK++L  EGLF    K  +PF+P++I V+TSPTGAVIRDI+ RIS R+PLRVI++PV+V
Sbjct: 124 ERKQRLAAEGLFDPALKQLLPFMPRVIGVVTSPTGAVIRDIIHRISDRYPLRVIVWPVRV 183

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QGD C  E+A A+   NTL +    PRPD++I+ARGGGS+EDLW FNDE++VRA+A S I
Sbjct: 184 QGDTCGPEVATAVNGFNTLPDDGPIPRPDVLIVARGGGSLEDLWGFNDEIVVRAVAASHI 243

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETDWTL D AAD+RAPTPTGAAEMAVPVK  LQ+SL +  ARL++ + R   
Sbjct: 244 PVISAVGHETDWTLIDLAADMRAPTPTGAAEMAVPVKADLQASLASQSARLSSAMSRFFD 303

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            K     +  +A+P++DQ L+  R R D     L   L +   +K  HF+    ++    
Sbjct: 304 QKRQAHRAAARAMPSADQLLALPRRRFDEAASRLTRALFVNTQKKRVHFDGHARQLSPRL 363

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIK 421
           L   + +  + +    Q + + ++  LR        +   L    E    R     + ++
Sbjct: 364 LQRRLVELERGVTMLGQRLPRALEAFLRERRTAFTHRANRLSP--EPILRRTRLTGSTLE 421

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLAT 481
           +L  R +  +   I+          R++++ +Y++ L+RG+  + D     + Q   ++ 
Sbjct: 422 QLDRRRDQAVRLLIERVKRRSQELDRLMRTLSYESVLERGFAVVFDAQGKPVKQAAAVSP 481

Query: 482 KTRILINFFDGQANAI 497
              + + F DG    +
Sbjct: 482 GDALSVRFRDGDVGVV 497


>gi|306845981|ref|ZP_07478548.1| exodeoxyribonuclease VII, large subunit [Brucella sp. BO1]
 gi|306273616|gb|EFM55461.1| exodeoxyribonuclease VII, large subunit [Brucella sp. BO1]
          Length = 511

 Score =  430 bits (1105), Expect = e-118,   Method: Composition-based stats.
 Identities = 208/496 (41%), Positives = 306/496 (61%), Gaps = 2/496 (0%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           +      S +  EYSVSE+S  LK  VE    HV VRGEIS YRG HSSGHAYF+LKD+ 
Sbjct: 4   DSSFPGASSNVAEYSVSEISGALKRTVEDTFGHVRVRGEISDYRGPHSSGHAYFALKDDR 63

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           +R++A+IW+G++ ++ F PEEG+E +  GK+TT+PGSSKYQI+IE + P+G+G L+  LE
Sbjct: 64  ARLEAVIWRGSMGRLRFRPEEGMEVIATGKLTTYPGSSKYQIVIEQMEPAGAGALMALLE 123

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           +RK++L  EGLF    K  +PF+P++I V+TSPTGAVIRDI+ RIS R+PLRVI++PV+V
Sbjct: 124 ERKQRLAAEGLFDPALKQLLPFMPRVIGVVTSPTGAVIRDIIHRISDRYPLRVIVWPVRV 183

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QGD C  E+A A+   N L +    PRPD++I+ARGGGS+EDLW FNDE++VRA+A S I
Sbjct: 184 QGDTCGPEVAMAVNGFNALPDHGPIPRPDVLIVARGGGSLEDLWGFNDEIVVRAVAASHI 243

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETDWTL D AAD+RAPTPTGAAEMAVPVK  LQ++L +  ARL++ + R   
Sbjct: 244 PVISAVGHETDWTLIDLAADMRAPTPTGAAEMAVPVKADLQAALASQSARLSSAMSRFFD 303

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            K     +  +A+P++DQ L+  R R D     L   L +   +K  HF+    ++    
Sbjct: 304 QKRQAHRAAARAMPSADQLLALPRRRFDEAASRLTRALFVNTQKKRVHFDGHARQLSPRL 363

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIK 421
           L   + +  + +    Q + + ++  LR        +   L    E    R     + ++
Sbjct: 364 LQRRLVELERGVTMLGQRLPRALEAFLRERRTAFTHRANRLSP--EPILRRTRLTGSTLE 421

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLAT 481
           +L  R +  +   I+          R++++ +Y++ L+RG+  + D     + Q   ++ 
Sbjct: 422 QLDRRRDQAVRLLIERVKRRSQELDRLMRTLSYESVLERGFAVVFDAQGKPVKQAAAVSP 481

Query: 482 KTRILINFFDGQANAI 497
              + + F DG    +
Sbjct: 482 GDALSVRFRDGDVGVV 497


>gi|90426092|ref|YP_534462.1| exodeoxyribonuclease VII large subunit [Rhodopseudomonas palustris
           BisB18]
 gi|90108106|gb|ABD90143.1| Exodeoxyribonuclease VII large subunit [Rhodopseudomonas palustris
           BisB18]
          Length = 541

 Score =  430 bits (1105), Expect = e-118,   Method: Composition-based stats.
 Identities = 206/543 (37%), Positives = 306/543 (56%), Gaps = 16/543 (2%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M P +     + PE++V+ELS  LK  VE    HV VRGEISG+RG HSSGH YF+LKD 
Sbjct: 1   MPPTTAALP-NSPEFTVTELSSALKRTVEDAYGHVRVRGEISGFRGPHSSGHCYFALKDE 59

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            ++I+A+IWKG   ++ F P+EG+E +  GK+TT+PGSSKYQI+IE++ P+G G L+  +
Sbjct: 60  GAKIEAVIWKGVHGRMRFKPQEGLEVIATGKLTTYPGSSKYQIVIEAIEPAGIGALMALM 119

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           E+RK+KL  EGLF +  K  +P++P++I V+TSPTGAVIRDIL R+  RFP RV+++PVK
Sbjct: 120 EERKRKLGAEGLFDEARKQLLPYLPEVIGVVTSPTGAVIRDILHRLQDRFPRRVLVWPVK 179

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQGD   ++IA AI   N L EG + PRPD++I+ARGGGS+EDLW FN+E++VRA A+S 
Sbjct: 180 VQGDGSAEQIAAAIHGFNALPEGGSIPRPDLLIVARGGGSLEDLWSFNEEIVVRAAADSM 239

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP+ISA+GHETD TL D+AAD RAPTPT AAEMAVPV+  L   +  L  R      R  
Sbjct: 240 IPLISAVGHETDITLIDFAADKRAPTPTAAAEMAVPVRAELFVEVGQLGHRAMLCFQRGQ 299

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           + + + L +  +ALP++   L+  R RLD     L   L       +R F      +   
Sbjct: 300 ERRRSELRAATRALPSAAALLAIPRQRLDGAAAALPRALRANSHAHHRRFATACAGLTLK 359

Query: 361 FLIHNIQKNRQHILEKQQHIEQ-----IVKQHLRYIFLEKKEKIAILHMLREQTKNRIFY 415
            L   +    Q +    + ++      +  +  R+  L+ + K + L  ++ Q +  +  
Sbjct: 360 VLRAQVAHATQRLAVNGERLKHCARAGLRHRRDRFAALDARFKASKLANVQAQ-RKALAR 418

Query: 416 LHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQ 475
                ++L  R    L   ++     V+   ++L + +Y+  L RG+  ++D     +  
Sbjct: 419 DRERTQRLAERARRALLIALQRQQARVASCGQLLGALSYRGVLARGFALVRDAQGLAVHA 478

Query: 476 KRNLATKTRILINFFDGQANAIVINKAPPKEQP---------TKKCQLHNNKREKQGTQG 526
              +    R+ + F DG+  A    ++    +                   +  K   QG
Sbjct: 479 AAAIDPGARLSLEFADGRIGATADGESAAAPRSKPAAKPATAKPASTTTAKRVSKSVDQG 538

Query: 527 ELF 529
            LF
Sbjct: 539 SLF 541


>gi|256059060|ref|ZP_05449269.1| exodeoxyribonuclease VII large subunit [Brucella neotomae 5K33]
 gi|261323005|ref|ZP_05962202.1| exodeoxyribonuclease 7 large subunit [Brucella neotomae 5K33]
 gi|261298985|gb|EEY02482.1| exodeoxyribonuclease 7 large subunit [Brucella neotomae 5K33]
          Length = 511

 Score =  430 bits (1105), Expect = e-118,   Method: Composition-based stats.
 Identities = 211/496 (42%), Positives = 309/496 (62%), Gaps = 2/496 (0%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           +      S +  EYSVSE+S  LK  VE    HV VRGEISGYRG HSSGHAYF+LKD+ 
Sbjct: 4   DSSFPGASSNVAEYSVSEISGALKRTVEDTFGHVRVRGEISGYRGPHSSGHAYFALKDDR 63

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           +R++A+IW+G+++++ F PEEG+E +  GK+TT+PGSSKYQI+IE + P+G+G L+  LE
Sbjct: 64  ARLEAVIWRGSMSRLRFRPEEGMEVIATGKLTTYPGSSKYQIVIEQMEPAGAGALMALLE 123

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           +RK++L  EGLF    K  +PF+P++I V+TSPTGAVIRDI+ RIS R+PLRVI++PV+V
Sbjct: 124 ERKQRLAAEGLFDPALKQLLPFMPRVIGVVTSPTGAVIRDIIHRISDRYPLRVIVWPVRV 183

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QGD C  E+A A+   NTL +    PRPD++I+ARGGGS+EDLW FNDE++VRA+A S I
Sbjct: 184 QGDTCGPEVATAVNGFNTLPDDGLIPRPDVLIVARGGGSLEDLWGFNDEIVVRAVAASHI 243

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETDWTL D AAD+RAPTPTGAAEMAVPVK  LQ+SL +  ARL++ + R   
Sbjct: 244 PVISAVGHETDWTLIDLAADMRAPTPTGAAEMAVPVKADLQASLASQSARLSSAMSRFFD 303

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            K     +  +A+P++DQ L+  R R D     L   L +   +K  HF+    ++    
Sbjct: 304 QKRQAHRAAARAMPSADQLLALPRRRFDEAASRLTRALFVNTQKKRVHFDGHARQLSPRL 363

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIK 421
           L   + +  + +    Q + + ++  LR        +   L    E    R     + ++
Sbjct: 364 LQRRLVELERGVTMLGQRLPRALEAFLRERRTAFTHRANRLSP--EPILRRTRLTGSTLE 421

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLAT 481
           +L  R +  +   I+          R++++ +Y++ L+RG+  + D     + Q   ++ 
Sbjct: 422 QLDRRRDQAVRLLIERVKRRSQELDRLMRTLSYESVLERGFAVVFDAQGKPVKQAAAVSP 481

Query: 482 KTRILINFFDGQANAI 497
              + + F DG    +
Sbjct: 482 GDALSVRFRDGDVGVV 497


>gi|163844893|ref|YP_001622548.1| exodeoxyribonuclease VII large subunit [Brucella suis ATCC 23445]
 gi|189037853|sp|A9WZ60|EX7L_BRUSI RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|163675616|gb|ABY39726.1| exodeoxyribonuclease VII, large subunit [Brucella suis ATCC 23445]
          Length = 511

 Score =  429 bits (1104), Expect = e-118,   Method: Composition-based stats.
 Identities = 210/496 (42%), Positives = 308/496 (62%), Gaps = 2/496 (0%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           +      S +  EYSVSE+S  LK  VE    HV VRGEISGYRG HSSGHAYF+LKD+ 
Sbjct: 4   DSSFPGASSNVAEYSVSEISGALKRTVEDTFGHVRVRGEISGYRGPHSSGHAYFALKDDR 63

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           +R++A+IW+G+++++ F PEEG+E +  GK+TT+PGSSKYQI+IE + P+G+G L+  LE
Sbjct: 64  ARLEAVIWRGSMSRLRFRPEEGMEVIATGKLTTYPGSSKYQIVIEQMEPAGAGALMALLE 123

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           +RK++L  EGLF    K  +PF+P++I V+TSPTGAVIRDI+ RIS R+PLRVI++PV+V
Sbjct: 124 ERKQRLAAEGLFDPALKQLLPFMPRVIGVVTSPTGAVIRDIIHRISDRYPLRVIVWPVRV 183

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QGD C  E+A A+   NTL +     RPD++I+ARGGGS+EDLW FNDE++VRA+A S I
Sbjct: 184 QGDTCGPEVATAVNGFNTLPDDGPILRPDVLIVARGGGSLEDLWGFNDEIVVRAVAASHI 243

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETDWTL D AAD+RAPTPTGAAEMAVPVK  LQ+SL +  ARL++ + R   
Sbjct: 244 PVISAVGHETDWTLIDLAADMRAPTPTGAAEMAVPVKADLQASLASQSARLSSAMSRFFD 303

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            K     +  +A+P++DQ L+  R R D     L   L +   +K  HF+    ++    
Sbjct: 304 QKRQAHRAAARAMPSADQLLALPRRRFDEAASRLTRALFVNTQKKRVHFDGHARQLSPRL 363

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIK 421
           L   + +  + +    Q + + ++  LR        +   L    E    R     + ++
Sbjct: 364 LQRRLVELERGVTMLGQRLPRALEAFLRERRTAFTHRANRLSP--EPILRRTRLTGSTLE 421

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLAT 481
           +L  R +  +   I+          R++++ +Y++ L+RG+  + D     + Q   ++ 
Sbjct: 422 QLDRRRDQAVRLLIERVKRRSQELDRLMRTLSYESVLERGFAVVFDAQGKPVKQAAAVSP 481

Query: 482 KTRILINFFDGQANAI 497
              + + F DG    +
Sbjct: 482 GDALSVRFRDGDVGVV 497


>gi|23500501|ref|NP_699941.1| exodeoxyribonuclease VII large subunit [Brucella suis 1330]
 gi|31563165|sp|Q8FVR1|EX7L_BRUSU RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|23464131|gb|AAN33946.1| exodeoxyribonuclease VII, large subunit [Brucella suis 1330]
          Length = 511

 Score =  429 bits (1103), Expect = e-118,   Method: Composition-based stats.
 Identities = 211/496 (42%), Positives = 308/496 (62%), Gaps = 2/496 (0%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           +      S +  EYSVSE+S  LK  VE    HV VRGEISGYRG HSSGHAYF+LKD+ 
Sbjct: 4   DSSFPGASSNVAEYSVSEISGALKRTVEDTFGHVRVRGEISGYRGPHSSGHAYFALKDDR 63

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           +R++A+IW+G+++++ F PEEG+E +  GK+TT+PGSSKYQI+IE + P+G+G L+  LE
Sbjct: 64  ARLEAVIWRGSMSRLRFRPEEGMEVIATGKLTTYPGSSKYQIVIEQMEPAGAGALMALLE 123

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           +RK++L  EGLF    K  +PF+P++I V+TSPTGAVIRDI+ RIS R+PLRVI++PV+V
Sbjct: 124 ERKQRLAAEGLFDPALKQLLPFMPRVIGVVTSPTGAVIRDIIHRISDRYPLRVIVWPVRV 183

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QGD C  E+A A+   NTL +    PRPD++I+ARGGGS+EDLW FNDE++VRA+A S I
Sbjct: 184 QGDTCGPEVATAVNGFNTLPDDGPIPRPDVLIVARGGGSLEDLWGFNDEIVVRAVAASHI 243

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETDWTL D AAD+RAPTPTGAAEMAVPVK  LQ+SL +  ARL++ + R   
Sbjct: 244 PVISAVGHETDWTLIDLAADMRAPTPTGAAEMAVPVKADLQASLASQSARLSSAMSRFFD 303

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            K     +  +A+P++DQ L+  R R D     L   L +   +K  HF+    ++    
Sbjct: 304 QKRQAHRAAARAMPSADQLLALPRRRFDEAASRLTRALFVNTQKKRVHFDGHARQLSPRL 363

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIK 421
           L   + +  + +    Q + + ++  LR        +   L    E    R     + ++
Sbjct: 364 LQRRLVELERGVTMLGQRLPRALEAFLRERRTAFTHRANRLSP--EPILRRTRLTGSTLE 421

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLAT 481
           +L  R +  +   I+          R++++ +Y++ L+RG+  + D     + Q   +  
Sbjct: 422 QLDRRRDQAVRLLIERVKRRSQELDRLMRTLSYESVLERGFAVVFDAQGKPVKQAAAVLP 481

Query: 482 KTRILINFFDGQANAI 497
              + + F DG    +
Sbjct: 482 GDALSVRFRDGDVGVV 497


>gi|254720127|ref|ZP_05181938.1| exodeoxyribonuclease VII large subunit [Brucella sp. 83/13]
 gi|265985133|ref|ZP_06097868.1| exodeoxyribonuclease 7 large subunit [Brucella sp. 83/13]
 gi|306839035|ref|ZP_07471855.1| exodeoxyribonuclease VII, large subunit [Brucella sp. NF 2653]
 gi|264663725|gb|EEZ33986.1| exodeoxyribonuclease 7 large subunit [Brucella sp. 83/13]
 gi|306405858|gb|EFM62117.1| exodeoxyribonuclease VII, large subunit [Brucella sp. NF 2653]
          Length = 511

 Score =  429 bits (1103), Expect = e-118,   Method: Composition-based stats.
 Identities = 209/496 (42%), Positives = 307/496 (61%), Gaps = 2/496 (0%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           +      S +  EYSVSE+S  LK  VE    HV VRGEISGYRG HSSGHAYF+LKD+ 
Sbjct: 4   DSSFPGASSNVAEYSVSEISGALKRTVEDTFGHVRVRGEISGYRGPHSSGHAYFALKDDR 63

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           +R++A+IW+G++ ++ F PEEG+E +  GK+TT+PGSSKYQI+IE + P+G+G L+  LE
Sbjct: 64  ARLEAVIWRGSMGRLRFRPEEGMEVIATGKLTTYPGSSKYQIVIEQMEPAGAGALMALLE 123

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           +RK++L  EGLF    K  +PF+P++I V+TSPTGAVIRDI+ RIS R+PL VI++PV+V
Sbjct: 124 ERKQRLAAEGLFDPALKQLLPFMPRVIGVVTSPTGAVIRDIIHRISDRYPLGVIVWPVRV 183

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QGD C  E+A A+   N L +  + PRPD++I+ARGGGS+EDLW FNDE++VRA+A S I
Sbjct: 184 QGDTCGPEVATAVNGFNALPDDGSIPRPDVLIVARGGGSLEDLWGFNDEIVVRAVAASHI 243

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETDWTL D AAD+RAPTPTGAAEMAVPVK  LQ++L +  ARL++ + R   
Sbjct: 244 PVISAVGHETDWTLIDLAADMRAPTPTGAAEMAVPVKADLQAALASQSARLSSAMSRFFD 303

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            K     +  +A+P++DQ L+  R R D     L   L +   +K  HF+    ++   F
Sbjct: 304 QKRQAHRAAARAMPSADQLLALPRRRFDEAASRLTRALFVNTQKKRVHFDGHARQLSPRF 363

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIK 421
           L   + +  + +    Q + + ++  LR        +   L    E    R     + ++
Sbjct: 364 LQRRLVELERGVTMLGQRLPRALEAFLRERRTAFTHRANRLSP--EPILRRTRLTGSTLE 421

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLAT 481
           +L  R +  +   I+          R++ + +Y++ L+RG+  + D     + Q   ++ 
Sbjct: 422 QLDRRRDQAVRLLIERVKRRSQELDRLMSTLSYESVLERGFAVVFDAQGKPVKQAGAVSP 481

Query: 482 KTRILINFFDGQANAI 497
              + + F DG    +
Sbjct: 482 GDALSVRFRDGDVGVV 497


>gi|91978566|ref|YP_571225.1| exodeoxyribonuclease VII large subunit [Rhodopseudomonas palustris
           BisB5]
 gi|91685022|gb|ABE41324.1| Exodeoxyribonuclease VII large subunit [Rhodopseudomonas palustris
           BisB5]
          Length = 536

 Score =  429 bits (1103), Expect = e-118,   Method: Composition-based stats.
 Identities = 205/532 (38%), Positives = 308/532 (57%), Gaps = 6/532 (1%)

Query: 4   FSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSR 63
            + +   +  E++VSELS  LK  VE +  HV VRGEISG+RG HSSGH YF+LKD  ++
Sbjct: 5   LAPETLANVGEFTVSELSQALKRTVEDSYGHVRVRGEISGFRGAHSSGHCYFALKDESAK 64

Query: 64  IDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKR 123
           I+A+IWKG   ++ F P+EG+E +  GK+TT+PGSSKYQI+IE+L P+G G L+  +E+R
Sbjct: 65  IEAVIWKGVAGRMRFKPQEGLEVIATGKLTTYPGSSKYQIVIEALEPAGVGALMALMEER 124

Query: 124 KKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQG 183
           KKKL  EGLF +  K  +P++P +I V+TSPTGAVIRDIL R+  RFP RV+++PVKVQG
Sbjct: 125 KKKLGAEGLFDEARKQLLPWLPDVIGVVTSPTGAVIRDILHRLEDRFPRRVLVWPVKVQG 184

Query: 184 DECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPI 243
           +   +++A AI   N L EG   PRPD++I+ARGGGS+EDLW FN+E++VRA A S IP+
Sbjct: 185 EGSAEQVAAAIHGFNALPEGGPIPRPDLLIVARGGGSLEDLWSFNEEIVVRAAAESMIPL 244

Query: 244 ISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYK 303
           ISA+GHETD TL D+AAD RAPTPT AAEMAVPV+  L   + +   R+     R    +
Sbjct: 245 ISAVGHETDVTLIDFAADKRAPTPTAAAEMAVPVRAELFVEVQSFSRRMMLCWTRGQDSR 304

Query: 304 INTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLI 363
            N L +  +ALP + + L+  R RLD     L   L       +R F      I  + L 
Sbjct: 305 RNELRAAARALPAASELLAIPRQRLDTAAAGLPRALRANTHAHHRRFAKAAAGITLNVLR 364

Query: 364 HNIQKNRQHILEKQQHIE---QIVKQHLRYIFLEKKEKIAILHMLREQTKN-RIFYLHTH 419
             +  + Q +    + ++   +   +H R  F     ++    +  EQ +  +I      
Sbjct: 365 AQVSHSAQRLGITGERLKHGARATLRHRRDRFDGLAIRLQASKLANEQAQRMQIARERER 424

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
           +++L  R    L+  +      ++ + ++L + +Y+  L RG+  ++D + + +     +
Sbjct: 425 MQRLAERARRALTTLLDRQQARLTQSGKLLTALSYRGVLARGFALVRDADGHAVHAAAAV 484

Query: 480 ATKTRILINFFDGQANAIVINKAP--PKEQPTKKCQLHNNKREKQGTQGELF 529
           +   ++ + F DG+ +          P +  T   +    +  K   QG LF
Sbjct: 485 SAGAQLSVEFADGRVSVTADGGHAGEPAKPTTPASKPTQKRTPKPVDQGSLF 536


>gi|254712538|ref|ZP_05174349.1| exodeoxyribonuclease VII large subunit [Brucella ceti M644/93/1]
 gi|254715610|ref|ZP_05177421.1| exodeoxyribonuclease VII large subunit [Brucella ceti M13/05/1]
 gi|261217358|ref|ZP_05931639.1| exodeoxyribonuclease 7 large subunit [Brucella ceti M13/05/1]
 gi|261320231|ref|ZP_05959428.1| exodeoxyribonuclease 7 large subunit [Brucella ceti M644/93/1]
 gi|260922447|gb|EEX89015.1| exodeoxyribonuclease 7 large subunit [Brucella ceti M13/05/1]
 gi|261292921|gb|EEX96417.1| exodeoxyribonuclease 7 large subunit [Brucella ceti M644/93/1]
          Length = 511

 Score =  428 bits (1100), Expect = e-117,   Method: Composition-based stats.
 Identities = 211/496 (42%), Positives = 309/496 (62%), Gaps = 2/496 (0%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           +      S +  EYSVSE+S  LK  VE    HV VRGEISGYRG HSSGHAYF+LKD+ 
Sbjct: 4   DSSFPGASSNVAEYSVSEISGALKRTVEDTFGHVRVRGEISGYRGPHSSGHAYFALKDDR 63

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           +R++A+IW+G+++++ F PEEG+E +  GK+TT+PGSSKYQI+IE + P+G+G L+  LE
Sbjct: 64  ARLEAVIWRGSMSRLRFRPEEGMEVIATGKLTTYPGSSKYQIVIEQMEPAGAGALMALLE 123

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           +RK++L  EGLF    K  +PF+P++I V+TSPTGAVIRDI+ RIS R+PLRVI++PV+V
Sbjct: 124 ERKQRLAAEGLFDPALKQLLPFMPRVIGVVTSPTGAVIRDIIHRISDRYPLRVIVWPVRV 183

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QGD C  E+A A+   NTL +    PRPD++I+ARGGGS+EDLW FNDE++VRA+A S I
Sbjct: 184 QGDTCGPEVATAVNGFNTLPDDGPIPRPDVLIVARGGGSLEDLWGFNDEIVVRAVAASHI 243

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETDWTL D AAD+RAPTPTGAAEMAVPVK  LQ+SL +  ARL++ + R   
Sbjct: 244 PVISAVGHETDWTLIDLAADMRAPTPTGAAEMAVPVKADLQASLASQSARLSSAMSRFFD 303

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            K     +  +A+P++DQ L+  R R D     L   L +   +K  HF+    ++    
Sbjct: 304 QKRQAHRAAARAMPSADQLLALPRRRFDEAASRLTRALFVNTQKKRVHFDGHARQLSPRL 363

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIK 421
           L   + +  + +    Q + + ++  LR        +   L    E    R     + ++
Sbjct: 364 LQRRLVELERGVTMLGQRLPRALEAFLRERRTAFTHRANRLSP--EPILRRTRLTGSTLE 421

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLAT 481
           +L  R +  +   I+          R++++ +Y++ L+RG+  + D     + Q   ++ 
Sbjct: 422 QLDRRRDQAVRLLIERVKRRSQELDRLMRTLSYESVLERGFAVVFDAQGKPVKQAAAVSP 481

Query: 482 KTRILINFFDGQANAI 497
              + + F DG    +
Sbjct: 482 GNALSVRFRDGDVGVV 497


>gi|148557887|ref|YP_001257710.1| exodeoxyribonuclease VII large subunit [Brucella ovis ATCC 25840]
 gi|158513787|sp|A5VV55|EX7L_BRUO2 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|148369172|gb|ABQ62044.1| exodeoxyribonuclease VII, large subunit [Brucella ovis ATCC 25840]
          Length = 511

 Score =  428 bits (1099), Expect = e-117,   Method: Composition-based stats.
 Identities = 211/496 (42%), Positives = 309/496 (62%), Gaps = 2/496 (0%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           +      S +  EYSVSE+S  LK  VE    HV VRGEISGYRG HSSGHAYF+LKD+ 
Sbjct: 4   DSSFPGASSNVAEYSVSEISGALKRTVEDMFGHVRVRGEISGYRGPHSSGHAYFALKDDR 63

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           +R++A+IW+G+++++ F PEEG+E +  GK+TT+PGSSKYQI+IE + P+G+G L+  LE
Sbjct: 64  ARLEAVIWRGSMSRLRFRPEEGMEVIATGKLTTYPGSSKYQIVIEQMEPAGAGALMALLE 123

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           +RK++L  EGLF    K  +PF+P++I V+TSPTGAVIRDI+ RIS R+PLRVI++PV+V
Sbjct: 124 ERKQRLAAEGLFDPALKQLLPFMPRVIGVVTSPTGAVIRDIIHRISDRYPLRVIVWPVRV 183

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QGD C  E+A A+   NTL +    PRPD++I+ARGGGS+EDLW FNDE++VRA+A S I
Sbjct: 184 QGDTCGPEVATAVNGFNTLPDDGPIPRPDVLIVARGGGSLEDLWGFNDEIVVRAVAASHI 243

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETDWTL D AAD+RAPTPTGAAEMAVPVK  LQ+SL +  ARL++ + R   
Sbjct: 244 PVISAVGHETDWTLIDLAADMRAPTPTGAAEMAVPVKADLQASLASQSARLSSAMSRFFD 303

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            K     +  +A+P++DQ L+  R R D     L   L +   +K  HF+    ++    
Sbjct: 304 QKRQAHRAAARAMPSADQLLALPRRRFDEAASRLTRALFVNTQKKRVHFDGHARQLSPRL 363

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIK 421
           L   + +  + +    Q + + ++  LR        +   L    E    R     + ++
Sbjct: 364 LQRRLVELERGVTMLGQRLPRALEAFLRERRTAFTHRANRLSP--EPILRRTRLTGSTLE 421

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLAT 481
           +L  R +  +   I+          R++++ +Y++ L+RG+  + D     + Q   ++ 
Sbjct: 422 QLDRRRDQAVRLLIERVKRRSQELDRLMRTLSYESVLERGFAVVFDAQGKPVKQAAAVSP 481

Query: 482 KTRILINFFDGQANAI 497
              + + F DG    +
Sbjct: 482 DDALSVRFRDGDVGVV 497


>gi|126729213|ref|ZP_01745027.1| exodeoxyribonuclease VII, large subunit [Sagittula stellata E-37]
 gi|126710203|gb|EBA09255.1| exodeoxyribonuclease VII, large subunit [Sagittula stellata E-37]
          Length = 513

 Score =  426 bits (1096), Expect = e-117,   Method: Composition-based stats.
 Identities = 185/529 (34%), Positives = 289/529 (54%), Gaps = 16/529 (3%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M+      + + PE+SVSELS  +K ++E     V VRGE+ G      SGH Y  LKD+
Sbjct: 1   MDLIDDGTNGNTPEFSVSELSGAVKRVIEGEFGFVRVRGEV-GRVSRPRSGHVYLDLKDD 59

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            S I  ++WKG  ++++  PEEG+E +  G++TTFPG SKYQI++E + P+G+G L+  L
Sbjct: 60  RSVISGVMWKGVASRLQTQPEEGMEVVATGRLTTFPGQSKYQIVLEDIRPAGAGALMAML 119

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           EKRK  L  EGLF    K P+P++P+II V+TSP+GAVIRDIL R+  RFP +V+I+PV 
Sbjct: 120 EKRKAALAAEGLFDAGRKKPLPYLPEIIGVVTSPSGAVIRDILHRLRDRFPRKVLIWPVA 179

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQG  C  E+A AI   N  + G T PRPD++I+ARGGGS+EDLW FN+E++ RA A S 
Sbjct: 180 VQGAACAPEVARAIEGFNRFQPGGTLPRPDLLIVARGGGSVEDLWGFNEEVVARAAAASH 239

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP+ISA+GHETD TL D+ +D RAPTP+ AAE+AVPV+  L + + +  AR+   +   +
Sbjct: 240 IPLISAVGHETDTTLIDFVSDRRAPTPSAAAELAVPVRMELAAQIRDFGARMTRAMGLRV 299

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           +++   L  L +ALP  ++ +   R RLD +   L   L   + R+       +  ++  
Sbjct: 300 EHRGQRLRDLARALPRPEELVEGPRQRLDVMGDRLPAALTRAVDRQRLRLTETVGSLRPA 359

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420
            L   +   R  + E+   +   + + ++      + + A L          I      +
Sbjct: 360 ILRRAVSVERGRMDERSARLGPALARAVKVRRDTLEARAARLSP--RAILRDIGTGRERL 417

Query: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480
            +L  R++   + +I+     +    R+ ++ +Y+ TL+RG+  +   +   +T +    
Sbjct: 418 DRLSQRLDAAQAARIQDTRQRLEALARLAETLSYRATLERGFAVVWSDSG-VVTSRAAAD 476

Query: 481 TKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
             T + + F DG+             +           + K   QG LF
Sbjct: 477 EATGLEVEFSDGRM------------KLGGAAPARRKAKRKPPEQGSLF 513


>gi|158424009|ref|YP_001525301.1| exodeoxyribonuclease VII large subunit [Azorhizobium caulinodans
           ORS 571]
 gi|172047959|sp|A8I6A9|EX7L_AZOC5 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|158330898|dbj|BAF88383.1| exodeoxyribonuclease VII large subunit [Azorhizobium caulinodans
           ORS 571]
          Length = 537

 Score =  426 bits (1094), Expect = e-117,   Method: Composition-based stats.
 Identities = 199/533 (37%), Positives = 296/533 (55%), Gaps = 7/533 (1%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M    +  + + PE++VSELS+ L+  VE    HV VRGEISGYRG HSSGHAYFS+KD 
Sbjct: 6   MTDLPETRA-NAPEWTVSELSFALRRTVEDAYGHVRVRGEISGYRGPHSSGHAYFSIKDE 64

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            +R+DA+IWK    +++  PEEG+E + +GK+TT+PG S YQI+IESL  +G+G ++  L
Sbjct: 65  GARLDAVIWKSAFARLKLRPEEGLEVVAVGKLTTYPGKSGYQIVIESLEFAGAGAIMAML 124

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           E+RK++L  EGLF    K  +PF+PK+I V+TSPTGAVIRDIL R+S RFP +VI++PV+
Sbjct: 125 EERKRRLAAEGLFDAARKQELPFLPKVIGVVTSPTGAVIRDILHRLSDRFPRQVIVWPVR 184

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQG+    E+A AI   N L EG   PRPD++I+ARGGGS+EDL  F+DE +VRA A S 
Sbjct: 185 VQGETSAAEVAEAIRGFNALPEGGPIPRPDVLIVARGGGSLEDLLGFSDEAVVRAAAESF 244

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP++SA+GHETD TL D+AAD+RAPTPT AAEM VPV+  L + +     RL+    RL+
Sbjct: 245 IPLVSAVGHETDVTLIDFAADVRAPTPTAAAEMVVPVRADLLAGIDAYGERLSAAPRRLL 304

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           + +     +L + LP +D  L+  R RLD     L   L          F  +  R  + 
Sbjct: 305 ERRRADFRALARHLPTADALLAVPRQRLDAAGERLPRALRANAAAHRLAFEAVRTRHSAS 364

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKN----RIFYL 416
                + + +  +      ++  +   +           A     R  +       +   
Sbjct: 365 AFRLRLARAQDRVAALGGRLQWGLTGLVSRRSERLSAMTARFGSARAASLRAHVLHLSRC 424

Query: 417 HTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQK 476
              +  L TR +  + H ++     ++   ++L++ +Y+  L RG+  ++D     +   
Sbjct: 425 RERLSVLSTRAQRAVRHDLRERTNRLAAMEQLLKALSYRGVLARGFALVRDAQGGAVRAA 484

Query: 477 RNLATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
             +    R+ + F DG+     + +  P E P         + +    Q  LF
Sbjct: 485 GAVVPGARLELEFADGRLGVQALGEGAPVEPPQAARPSKGARTK--AAQPSLF 535


>gi|114705932|ref|ZP_01438835.1| exodeoxyribonuclease VII large subunit protein [Fulvimarina pelagi
           HTCC2506]
 gi|114538778|gb|EAU41899.1| exodeoxyribonuclease VII large subunit protein [Fulvimarina pelagi
           HTCC2506]
          Length = 532

 Score =  425 bits (1093), Expect = e-117,   Method: Composition-based stats.
 Identities = 206/532 (38%), Positives = 298/532 (56%), Gaps = 5/532 (0%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M+        +  E++VSE+S  LK  VE    HV VRGE+SGYRG HSSGHAYF+LKD+
Sbjct: 1   MSLLDNDPPSNVAEFTVSEISISLKRTVEDAFGHVRVRGEVSGYRGPHSSGHAYFALKDD 60

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            +RIDA+IW+G+ + + F P+EG+E +  G++TT+PGSSKYQI+IE + P+G+G L+  L
Sbjct: 61  KARIDAVIWRGSFSNLAFKPQEGLEIIATGRLTTYPGSSKYQIVIEDIKPAGAGALMALL 120

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           ++R++KL  EGLF+ + K  +PF+P++I V+TSPTGAVIRDI  RI+ RFP+ V+++PVK
Sbjct: 121 DERRRKLEAEGLFAPERKKRLPFLPRVIGVVTSPTGAVIRDIRHRITDRFPVHVLVWPVK 180

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQG+     +A AI   N  +     PRPD++I+ARGGGS+EDLW FNDE +VRA A+S 
Sbjct: 181 VQGEGSGDAVARAITGFNAFEPDGPIPRPDVLIVARGGGSLEDLWGFNDEAVVRAAADSD 240

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP+ISA+GHETDWTL D+ AD RAPTPTGAAE+AVPV+  L + +    AR  N I R +
Sbjct: 241 IPLISAVGHETDWTLIDHVADRRAPTPTGAAEIAVPVRAELLADVAAFHARQGNAISRRL 300

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
            +    +    +ALP+ D  L+  R RLD     L     +++    + F  +  R+   
Sbjct: 301 DHDRRQVVQTARALPSPDMLLALPRRRLDDAASGLGSQFLLVVSESRQTFGGVAARLSLS 360

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420
            L   I++ R  +       EQ +   L       +   A L  +    K R       +
Sbjct: 361 TLEGAIREKRGSLRHAALEAEQAMAGRLSRQRQLFQRITANLQPIG--LKARSEAARLKL 418

Query: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480
             +  R +   +   +     +  T R+      K  L+RGYT I+   +  IT    L 
Sbjct: 419 DTVSERFDRARTRLTEDRRERLRQTWRVASGLGPKRVLERGYTIIRGEGDVPITDPALLP 478

Query: 481 TKTRILINFF-DGQANAIVINKAPPKEQPTKKCQLHNNKREKQGT--QGELF 529
             T   + F  + +  A+   +A P        +        +    QG LF
Sbjct: 479 PGTAFAVEFAGNNRIGALASGEAAPGSTRPAAPRKRKKATPPEAERAQGSLF 530


>gi|84499997|ref|ZP_00998263.1| exodeoxyribonuclease VII, large subunit [Oceanicola batsensis
           HTCC2597]
 gi|84391931|gb|EAQ04199.1| exodeoxyribonuclease VII, large subunit [Oceanicola batsensis
           HTCC2597]
          Length = 521

 Score =  425 bits (1092), Expect = e-116,   Method: Composition-based stats.
 Identities = 189/522 (36%), Positives = 292/522 (55%), Gaps = 17/522 (3%)

Query: 11  DHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           +  E++VSELS  +K  +ES   HV VR E+ G      SGH YF LKD+ + + A+ WK
Sbjct: 14  NAHEFTVSELSGAVKRAIESGFGHVRVRAEV-GRVSRPRSGHMYFDLKDDRAVLSAVSWK 72

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           G + +++  PEEG+E +  G++TTFPG SKYQ+I++++ P+G+G L+  LEKRK  L  E
Sbjct: 73  GQVARMQVQPEEGMEVIATGRMTTFPGQSKYQLIVDNVEPAGAGALMALLEKRKAMLRAE 132

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEI 190
           GLF+ + K P+P++P+++ V+TSP+GAVIRDIL R+  RFP+ V+I+PV VQG  C  E+
Sbjct: 133 GLFAAERKRPLPYLPRVVGVVTSPSGAVIRDILHRLRDRFPVHVLIWPVAVQGQTCAAEV 192

Query: 191 ANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHE 250
           + AI   N L      PRPD++I+ARGGGSIEDLW FN+E++ RA A+S IP+ISA+GHE
Sbjct: 193 SRAIAGFNRLSPAGAVPRPDLLIVARGGGSIEDLWGFNEEIVARAAASSEIPLISAVGHE 252

Query: 251 TDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSL 310
           TD TL D+ +D RAPTPT AAE+AVPV+  L   + ++ ARL     + I  +   L+ L
Sbjct: 253 TDTTLIDFVSDRRAPTPTAAAELAVPVRAELTGWVADMRARLIRAQGQAILSRRQRLSDL 312

Query: 311 LKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNR 370
            +ALP  ++    +R +LD     L + L   +  +    +     ++   L   I ++R
Sbjct: 313 ARALPRPERLTETARQKLDTWGERLPNALRRGVAARRVALSDCSGALRPGLLRRRIAEDR 372

Query: 371 QHILEKQQHIEQIVK---QHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRI 427
           Q + ++   +   +       R  F     ++    + RE  + R       ++KL  R 
Sbjct: 373 QRVADRGARLPSSMTRNVMQHRRQFETCAARLQPATLRRETLRQR-----EALEKLANRF 427

Query: 428 EFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILI 487
                  ++S    ++   R+ ++  Y+ TL RGY  ++D N   +T+K        + I
Sbjct: 428 AEAARRSVESRRDRLATLDRLRETLGYRETLARGYAVVRDGNGAVMTRKAQAEQAESLAI 487

Query: 488 NFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
            F DG  +            P  + +    ++E    QG LF
Sbjct: 488 EFADGTLD--------QGASPAPRKKPSAGRKEPPPEQGSLF 521


>gi|84686140|ref|ZP_01014035.1| Exonuclease VII, large subunit [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84665667|gb|EAQ12142.1| Exonuclease VII, large subunit [Rhodobacterales bacterium HTCC2654]
          Length = 545

 Score =  423 bits (1086), Expect = e-116,   Method: Composition-based stats.
 Identities = 202/532 (37%), Positives = 293/532 (55%), Gaps = 14/532 (2%)

Query: 3   PFSQ-----KNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSL 57
           P S      +   + PE++VSELS  +K ++E    HV +RGE+ G      SGH Y  L
Sbjct: 23  PMSDLIEDLEPGGNAPEFTVSELSGAVKRMIEGEFGHVRIRGEV-GRVSRPRSGHIYLDL 81

Query: 58  KDNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLL 117
           KD+ + I  +IWKG   ++   PEEG+E +  G++TTFPG SKYQI+I+ + P+G+G L+
Sbjct: 82  KDDRAVISGVIWKGVSARLATQPEEGMEVVATGRLTTFPGQSKYQIVIDDIAPAGAGALM 141

Query: 118 TALEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIF 177
             LEKRK  L  EGLF+ + K PIP++P+II V+TSP+GAVIRDIL R+  RFP +V+I+
Sbjct: 142 AMLEKRKAALTAEGLFAQERKKPIPYLPEIIGVVTSPSGAVIRDILHRLRDRFPRKVLIW 201

Query: 178 PVKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIA 237
           PV VQG+ C  E+  AI   N L  G   PRPD+II+ARGGGS+EDLW FN+E +VRA A
Sbjct: 202 PVAVQGERCAPEVTRAIQGFNALTPGGALPRPDLIIVARGGGSVEDLWGFNEESVVRAAA 261

Query: 238 NSSIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIII 297
            S IP+ISA+GHETD TL DYAAD RAPTPT AAEMAVPV+  L +    L +RL + + 
Sbjct: 262 ASDIPLISAVGHETDTTLIDYAADRRAPTPTAAAEMAVPVRRELMAYTAELGSRLTSALT 321

Query: 298 RLIKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRI 357
           + I  +   L  L +ALP ++  L   R RLDR    L   L   +  +    N     +
Sbjct: 322 QGITRRAQRLTDLSRALPRAETLLETPRQRLDRAGDRLPAALIAKVRGEEVRLNRASGGL 381

Query: 358 KSDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLH 417
           +   L + +   R+ + ++   +   + + +     E       L   R           
Sbjct: 382 RPSVLTNRVTVLRERVADRAGRLGYALARPVEAGKRELARLSPRLDPARIDEAR--VRKE 439

Query: 418 THIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKR 477
              + L  R+  + + +I+     +    R+  +  Y  TLKRGY  ++  + + +T + 
Sbjct: 440 REFEALCARLSRVGTGQIEGWQKRLDALERMRVTLGYTETLKRGYAVVRG-DGDVVTTRE 498

Query: 478 NLATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
             A    + I F DG+ +  VI       +PT K +     +++   QG LF
Sbjct: 499 AAAHAGALEIEFHDGRLD--VIGGGGGSAKPTAKAK---KSKDEPPEQGTLF 545


>gi|118590626|ref|ZP_01548027.1| exodeoxyribonuclease VII large subunit [Stappia aggregata IAM
           12614]
 gi|118436602|gb|EAV43242.1| exodeoxyribonuclease VII large subunit [Stappia aggregata IAM
           12614]
          Length = 520

 Score =  423 bits (1086), Expect = e-116,   Method: Composition-based stats.
 Identities = 200/524 (38%), Positives = 301/524 (57%), Gaps = 5/524 (0%)

Query: 6   QKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRID 65
            +   +  E+SVSE+S+ +K  +E    +V VRGE+ G      SGH Y  LKD+ S + 
Sbjct: 2   SETQSNVAEFSVSEISFSIKRTMEEAFGYVRVRGEL-GRISRPGSGHIYLDLKDDRSVLS 60

Query: 66  AIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKK 125
            +IW+G+ +K++  PE+G+E +  GKITTFPG SKYQ++I+SL P+G+G L+  LE+RKK
Sbjct: 61  GVIWRGSASKLKIQPEQGLEVIATGKITTFPGQSKYQMVIDSLEPAGAGALMALLEERKK 120

Query: 126 KLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDE 185
           KL  EGLF+++ K P+P +P++I VITSPTGAVIRDIL RIS RFPL V+++PV+VQG+ 
Sbjct: 121 KLAAEGLFAEERKRPLPPLPRVIGVITSPTGAVIRDILHRISDRFPLHVLVWPVRVQGET 180

Query: 186 CPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIIS 245
              E+AN I   N L+ G   PRPD++I+ARGGGSIEDLW FN+E +VRA ++S IP+IS
Sbjct: 181 SGAEVANGIRGFNALQPGGPIPRPDVLIVARGGGSIEDLWGFNEEAVVRAASDSQIPLIS 240

Query: 246 AIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKIN 305
           A+GHETDWTL D AADLRAPTPTGAAE AVPVK  L + + +   RLN+ ++R +  +  
Sbjct: 241 AVGHETDWTLIDLAADLRAPTPTGAAEFAVPVKAELMAMVDDRSRRLNSGLVRFVTTRRT 300

Query: 306 TLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHN 365
            L +   ALP     L+  R + D L   LE  L +       H+ +   R+    L   
Sbjct: 301 ELRAASAALPAPQDLLALPRQKFDTLASSLERALIVSTRTHRTHYQNFAGRLSPLLLSRL 360

Query: 366 IQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLIT 425
             K RQ +++  +  ++ ++  +       +     L   R     +       +  L  
Sbjct: 361 TTKARQDLIQASERKQRALQVAVSQKRHSFEALAVRLTPSR--LAQQTTLGTERLSGLGE 418

Query: 426 RIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRI 485
           R+      ++      +    ++L+S +YK+ L RGY  ++D +   +     +A+   +
Sbjct: 419 RLNRAYLARLSQEKARLDGLQKLLKSLSYKDVLARGYAVVRDDSGQPVRSAGAVASGAAL 478

Query: 486 LINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
            I   DG  +A+ ++ +   +    K +     +     QG LF
Sbjct: 479 SIELADGTVDAVALSDSAGPK--PAKAKKQPAGKGPATNQGSLF 520


>gi|159184239|ref|NP_353300.2| exodeoxyribonuclease VII large subunit [Agrobacterium tumefaciens
           str. C58]
 gi|23814089|sp|Q8UIM4|EX7L_AGRT5 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|159139567|gb|AAK86085.2| exodeoxyribonuclease VII large subunit [Agrobacterium tumefaciens
           str. C58]
          Length = 532

 Score =  422 bits (1085), Expect = e-116,   Method: Composition-based stats.
 Identities = 241/532 (45%), Positives = 335/532 (62%), Gaps = 3/532 (0%)

Query: 1   MNP-FSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKD 59
           M+  FS     +  E+SVSELS  +K  VE+    V VRGEISGYRG HSSGHAYFSLKD
Sbjct: 1   MSDIFSHTALSNLAEFSVSELSGSIKRTVETAFEQVRVRGEISGYRGPHSSGHAYFSLKD 60

Query: 60  NHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTA 119
           + +RIDA+IWKGT ++++F PEEG+E +  GKITTFPGSSKYQI+IESL P+G+G L+  
Sbjct: 61  DRARIDAVIWKGTFSRLKFRPEEGMEVIATGKITTFPGSSKYQIVIESLEPAGAGALMAL 120

Query: 120 LEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPV 179
           LE R+++L  EGLF    K P+PF+P++I V+TSPTGAVIRDIL RIS RFP+ V+++PV
Sbjct: 121 LEDRRRRLAAEGLFDSARKRPLPFMPRVIGVVTSPTGAVIRDILHRISDRFPVHVVVWPV 180

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
           KVQG+   +E+ANAI   N LK G    RPD++I+ARGGGS+EDLW FNDE++VRA A S
Sbjct: 181 KVQGEGSGEEVANAIRGFNALKPGGDIARPDVLIVARGGGSLEDLWSFNDEIVVRAAAES 240

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
            IP+ISA+GHETD TL DYAAD+RAPTPTGAAEMAVPV+  L++ L  L ARL+  + R 
Sbjct: 241 EIPLISAVGHETDTTLIDYAADVRAPTPTGAAEMAVPVRAELEAQLSGLAARLSGSVSRQ 300

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
           +  +   + +L++ALP+ DQ L+  R R D     L   LE+    K R F    + ++ 
Sbjct: 301 MDNRRQGVRALVRALPSLDQLLALPRRRFDEAASGLGRGLELTTLNKRRAFERSASGLRP 360

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH 419
           + L++ ++ +RQ I E+    E +V++ L           + L  L  +   ++      
Sbjct: 361 ETLLNGLKHHRQRITERMHRAETLVERRLLQGKGRVDSFDSALRSLPARLLGQLERQKER 420

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
           +     R +  + H++    + ++   RILQS +YKN L RGY  I+D  N  +T+   +
Sbjct: 421 VVTAARRADTAVLHRMAQNRSGLAAHDRILQSLSYKNVLNRGYAVIRDEENRPLTRAAAI 480

Query: 480 ATKTRILINFFDGQANAIVINKAPPKEQ--PTKKCQLHNNKREKQGTQGELF 529
           A+   + + F DG+ +AI   +  P  +     K +         G QG LF
Sbjct: 481 ASGAAVSMEFADGRVSAITTGEGTPAPETAAAPKKKPAKPASSDPGNQGNLF 532


>gi|182678223|ref|YP_001832369.1| exodeoxyribonuclease VII, large subunit [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|259646285|sp|B2IJK8|EX7L_BEII9 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|182634106|gb|ACB94880.1| exodeoxyribonuclease VII, large subunit [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 549

 Score =  422 bits (1085), Expect = e-116,   Method: Composition-based stats.
 Identities = 206/542 (38%), Positives = 304/542 (56%), Gaps = 16/542 (2%)

Query: 4   FSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSR 63
                S + PE +VSELS  LK  +E     V +RGEIS YRG HSSGHAYF LKD ++R
Sbjct: 8   MLPPPSTNSPELTVSELSAALKRTLEDRFGIVRLRGEISNYRGPHSSGHAYFCLKDQNAR 67

Query: 64  IDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKR 123
           IDA+IWK T  +++  PEEG+E +  GKITT+ G S YQI++E++ P+G G L+   E R
Sbjct: 68  IDAVIWKTTFMRLKVKPEEGLEVIATGKITTYAGKSSYQIVVEAIEPAGLGALMALFEAR 127

Query: 124 KKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQG 183
           +++L  EGLF ++ K  +PF+P +I VITSPTGAVIRDIL RI+ RFP  V+++PV+VQG
Sbjct: 128 RRQLASEGLFDEERKRALPFLPAVIGVITSPTGAVIRDILHRITERFPRPVLLWPVRVQG 187

Query: 184 DECPKEIANAILQLNTLKEGRTCP--RPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           +    E++ AI   N L      P  RPD++I+ARGGGS+EDLW FN+E +VRA A SSI
Sbjct: 188 ETAAAEVSAAIEGFNALPVTGQGPLHRPDLLIVARGGGSLEDLWGFNEENVVRAAAASSI 247

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+I+AIGHETDWTL DYAADLRAPTPTGAAE AVPV+  L +SL +L+ R      RL++
Sbjct: 248 PLIAAIGHETDWTLIDYAADLRAPTPTGAAEKAVPVRADLLTSLNDLQRRHAGAAYRLLE 307

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            + + L +L +ALP +D  L+  R RLDR    L         ++      + +R+    
Sbjct: 308 RRRSDLRALARALPQADSLLATPRQRLDRTATRLATACLRAQDQRGLVLGRLAHRLSRQA 367

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQ----TKNRIFYLH 417
              ++ +  Q +    + + +  +                L     Q     + R+    
Sbjct: 368 PHASLARLGQKLEAFGRGLGRACEIAQERRRQSLLHLGIRLTQNFTQGIRVERERVHGRR 427

Query: 418 THIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKR 477
             +  L  R+   +S  +      ++   ++ +S +Y   L RG+  ++D     + +  
Sbjct: 428 QKLASLDNRLRQAMSLTLSQRQARLANLAQLTRSLSYHAVLARGFALVRDETGQPLRRAA 487

Query: 478 NLATKTRILINFFDG----QANAIVINKAPPKEQPTKKC------QLHNNKREKQGTQGE 527
           ++     + + F DG     A A+V    P   +PT+K          ++++ K+  Q +
Sbjct: 488 DIIENHVLTLEFSDGCRQAVAGALVATDPPVDPKPTRKPVQKSSSPKPSSRKPKKSQQED 547

Query: 528 LF 529
           LF
Sbjct: 548 LF 549


>gi|110632544|ref|YP_672752.1| exodeoxyribonuclease VII large subunit [Mesorhizobium sp. BNC1]
 gi|123354046|sp|Q11LY8|EX7L_MESSB RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|110283528|gb|ABG61587.1| Exodeoxyribonuclease VII large subunit [Chelativorans sp. BNC1]
          Length = 519

 Score =  421 bits (1083), Expect = e-115,   Method: Composition-based stats.
 Identities = 225/530 (42%), Positives = 318/530 (60%), Gaps = 12/530 (2%)

Query: 1   MNPFSQKNS-LDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKD 59
           M    + +S  +  EYSVSE+S+ LK  +E    HV VRGEISG+RG HSSGH YFSLKD
Sbjct: 1   MEEAKKDDSLSNVAEYSVSEISHALKRTIEDTFGHVRVRGEISGFRGAHSSGHCYFSLKD 60

Query: 60  NHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTA 119
             +R++A+IWK T  ++ F P+EG+E +  G++TTFPGSSKYQI+IESL P+G+G L+  
Sbjct: 61  ERARMEAVIWKTTFARLRFPPQEGLEVIATGRLTTFPGSSKYQIVIESLEPAGAGALMAL 120

Query: 120 LEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPV 179
           LE+RK+KL  EGLF++  K P+PF+P +I V+TSPTGAVIRDI+ RI+ RFP+ V+++PV
Sbjct: 121 LEERKRKLAAEGLFAESRKRPLPFMPHVIGVVTSPTGAVIRDIIHRITDRFPVHVVVWPV 180

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
           +VQG+    E+A AI   N L+ G T PRPDI+I+ARGGGS+EDLW FNDE +VRA A S
Sbjct: 181 RVQGETTGAEVAAAISGFNALQPGGTIPRPDILIVARGGGSLEDLWGFNDEAVVRAAAAS 240

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
           +IP+ISA+GHETDWTL D AAD RAPTPTGAAE+AVPVK  L++++  L ARL   I R 
Sbjct: 241 AIPLISAVGHETDWTLIDLAADRRAPTPTGAAEVAVPVKAELEANIARLSARLKGAISRC 300

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
           +  +     SL +ALP+ DQ  +  R R D     L   L+     K  H N +   I  
Sbjct: 301 LDRRRQETRSLARALPSPDQLFALPRRRFDEAAGRLGRALQTSTQGKRLHLNAVRVSIA- 359

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH 419
             L   I + R+   +  + +  + +  +R+         A +      T  RI  L   
Sbjct: 360 -TLDRRIAQARRDANQCGERLPLVYQGLVRHRRARFDRDAARVSP--RVTLQRITTLGER 416

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
           +K  I R +  +S +++   T      R+ +S +YK+ L+RG+  ++D  +  + +  ++
Sbjct: 417 LKIAIARKDRAVSLRVERARTVYEQAVRLAESLSYKSVLERGFALVRDGEDRPLKRASDV 476

Query: 480 ATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
                + + F DG   AI   K+             +    + G QG LF
Sbjct: 477 KPGETLRLQFADGNIGAISTGKSSNT-------NRKSAPAREPGKQGSLF 519


>gi|114763003|ref|ZP_01442433.1| exodeoxyribonuclease VII, large subunit [Pelagibaca bermudensis
           HTCC2601]
 gi|114544327|gb|EAU47335.1| exodeoxyribonuclease VII, large subunit [Roseovarius sp. HTCC2601]
          Length = 510

 Score =  419 bits (1076), Expect = e-115,   Method: Composition-based stats.
 Identities = 192/536 (35%), Positives = 282/536 (52%), Gaps = 33/536 (6%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M+     ++ + PE+SVSELS  +K  +E    HV V+GE+ G      SGH Y  LKD+
Sbjct: 1   MDLL-DDDTGNTPEFSVSELSGAVKRTIEGEFGHVRVKGEV-GRVSRPRSGHIYLDLKDD 58

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            S I  ++WKG   ++E  PEEG+E +  G++TTFPG SKYQI+IE + P+G G L+  L
Sbjct: 59  RSVISGVVWKGVSARLETQPEEGMEVVATGRLTTFPGQSKYQIVIEDIRPAGLGALMAML 118

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           EKRK +L  EGLF    K P+P++P+II V+TSP+GAVIRDIL R+  RFP +V+I+PV 
Sbjct: 119 EKRKAQLQAEGLFDPARKQPLPYLPEIIGVVTSPSGAVIRDILHRLRDRFPRKVLIWPVA 178

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQG  C  E+A AI   N L  G   PRPD++I+ARGGGS+EDLW FN+E++ RA A S 
Sbjct: 179 VQGKSCAPEVARAIEGFNALSPGGAMPRPDLLIVARGGGSVEDLWGFNEEIVARAAAASD 238

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP+ISA+GHETD TL DY +D RAPTP+ AAE+AVPV+  L        AR+   + + I
Sbjct: 239 IPLISAVGHETDTTLIDYVSDRRAPTPSAAAEIAVPVRMELLGWTGEAGARMTRAMGQRI 298

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           + +   L  L +ALP ++  L   R RLD L   L   L     ++    +     ++  
Sbjct: 299 ELRSQRLRDLSRALPRAETLLDQPRQRLDLLGERLPRGLIRGTEQRRVVLSDAAGALRPS 358

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420
            L   I   R+ +  +   +                             +  +      +
Sbjct: 359 LLSRVIAHGRESLGRRTDRLS------------------------LRPIEREMRQGRERL 394

Query: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480
             L  R++   + ++++   ++   TR+L++ +YK TL+RGY  ++   N  +T+K    
Sbjct: 395 ATLTRRLDEAGTRRLETPRGTLDGLTRLLETLSYKGTLQRGYAVVRSGENEILTRKSAAE 454

Query: 481 TKTRILINFFDGQA-------NAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
               + I F DG+         +   +      +          K      QG LF
Sbjct: 455 AAASLEIEFADGRLSLGAPGAASAPASAPTSAARSKPAAARQKRKPTDTPDQGSLF 510


>gi|319782228|ref|YP_004141704.1| exodeoxyribonuclease VII large subunit [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317168116|gb|ADV11654.1| exodeoxyribonuclease VII, large subunit [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 543

 Score =  419 bits (1076), Expect = e-115,   Method: Composition-based stats.
 Identities = 216/549 (39%), Positives = 320/549 (58%), Gaps = 26/549 (4%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M+  + ++  +  EY+VSE+S  LK  VE    +V VRGEISGYRG HSSGHAYF+LKD+
Sbjct: 1   MSEVASESRTNAAEYTVSEISGALKRTVEDVFGNVRVRGEISGYRGPHSSGHAYFALKDD 60

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            +R+DA++WKGT+++++F PEEG+E +  GK+TT+PG S YQI+I++L P+G+G L+  L
Sbjct: 61  RARLDAVVWKGTMSRLKFRPEEGMEVIATGKLTTYPGKSNYQIVIDNLEPAGAGALMALL 120

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           E+RK++L  EGLF    K  +PF+P++I V+TSPTG+VIRDI+ RI  RFPL V+++PV+
Sbjct: 121 EERKRRLQAEGLFDTGRKRLLPFMPRVIGVVTSPTGSVIRDIIHRIKDRFPLHVLVWPVR 180

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQG+    E+  A+   N L       RPD++I+ARGGGS+EDLW FNDE + RA+A S 
Sbjct: 181 VQGETSGAEVTAAVNGFNALAWDGAIQRPDLLIVARGGGSLEDLWGFNDEALARAVAASG 240

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP+ISA+GHETDWTL D  AD+RAPTPTGAAE+AVPVK  L+++L +L ARL   ++R  
Sbjct: 241 IPVISAVGHETDWTLIDLVADVRAPTPTGAAEIAVPVKADLEATLASLGARLKAAVLRNF 300

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           + K     +  +ALP+ DQ L+  R RLD     L   L +   RK   F     ++   
Sbjct: 301 ERKRQAARAAARALPSPDQLLALPRRRLDEATSRLGRGLLVSTERKRARF--FAVKLTPA 358

Query: 361 FLIHNIQKNR----QHILEKQ--------------QHIEQIVKQHLRYIFLEKKEKIAIL 402
            L   I + R    +++L  Q                    + +  R      K+++A+L
Sbjct: 359 MLSQRIAEARRTNERNLLRAQGALRAMARARRAELNRAADQLPKCARASLQRHKQQLAML 418

Query: 403 HML--REQTKNRIFYLHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKR 460
                 E T  R       +  L  R    +  +++     V    R++ S ++K  L R
Sbjct: 419 QGRITIEPTARRQRVQRDLLTALTRRGTQAVVLRLERLRGRVVQADRLMASLSHKAVLAR 478

Query: 461 GYTSIQDTNNNFITQKRNLATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKRE 520
           G+  ++D +   + Q  ++A+   + + F DG A+A+ I+         K       K +
Sbjct: 479 GFALVRDADGAVVKQAADVASGMALSLEFADGTADAVAISGT----AKPKAVAKPAAKAK 534

Query: 521 KQGTQGELF 529
           + G QG LF
Sbjct: 535 EPGNQGSLF 543


>gi|217976587|ref|YP_002360734.1| exodeoxyribonuclease VII, large subunit [Methylocella silvestris
           BL2]
 gi|217501963|gb|ACK49372.1| exodeoxyribonuclease VII, large subunit [Methylocella silvestris
           BL2]
          Length = 521

 Score =  419 bits (1076), Expect = e-115,   Method: Composition-based stats.
 Identities = 200/530 (37%), Positives = 283/530 (53%), Gaps = 13/530 (2%)

Query: 4   FSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSR 63
             +  + + PE +VSELS  LK  +E     V +RGEIS YRG HSSGHAYF LKD  +R
Sbjct: 1   MPEPVASNAPELTVSELSNALKRTIEDRFGFVRLRGEISNYRGPHSSGHAYFCLKDAGAR 60

Query: 64  IDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKR 123
           IDA+IWKG   ++   PEEG+E +  GKITTFPG S YQII+E++ P+G G L+   E+R
Sbjct: 61  IDAVIWKGVFGRLRVKPEEGLEVIATGKITTFPGKSSYQIIVEAIEPAGVGALMALFEER 120

Query: 124 KKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQG 183
           ++KL  EGLF +  K  +PF+P  + VITSPTGAVIRDIL RI  RFP  V+++PV+VQG
Sbjct: 121 RRKLAAEGLFDEARKKALPFLPLRVGVITSPTGAVIRDILHRIKDRFPRHVLVWPVRVQG 180

Query: 184 DECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPI 243
           +    E+A AI     L E     RP +II+ARGGGS+EDLW FN+E++VRA+A S+IP+
Sbjct: 181 ETSAAEVAAAIAGFGALPEDGPLARPHVIIVARGGGSLEDLWSFNEEIVVRAVAASAIPL 240

Query: 244 ISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYK 303
           ISAIGHETDWTL D+AADLRAPTPTGAAE AVPV+  L + + +L  R    + RL+  +
Sbjct: 241 ISAIGHETDWTLIDHAADLRAPTPTGAAEKAVPVRLQLIADVADLSRRHAGAMARLLDRR 300

Query: 304 INTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLI 363
            +   +L +ALP  ++ L+  R +LD   R   + +                R+      
Sbjct: 301 RSEARALSRALPLPEEILALPRQKLDHAGRRFANAILRAHDHYSLALGRAAQRLARQTPR 360

Query: 364 HNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLR----EQTKNRIFYLHTH 419
             + +  + +   QQ +++                   L   R       + R       
Sbjct: 361 ARMARAGEKLAGLQQRMQRSAVIGRERRAAALNSLGERLINARLSRARAEQERTAAARHR 420

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
           +  L  R+   +  KI +    +    ++ +S  YKN L RG+  ++D   N +     +
Sbjct: 421 LDVLGPRLLRAVHEKIAARRAELRRLDQLRESLGYKNVLARGFALVRDAEGNPLRLAAAI 480

Query: 480 ATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
                + + F DG           P                ++ +QG LF
Sbjct: 481 TDGALLDLQFADG---------HKPAVAGAAPGAPRKTSASRKPSQGSLF 521


>gi|115526606|ref|YP_783517.1| exodeoxyribonuclease VII large subunit [Rhodopseudomonas palustris
           BisA53]
 gi|115520553|gb|ABJ08537.1| Exodeoxyribonuclease VII large subunit [Rhodopseudomonas palustris
           BisA53]
          Length = 546

 Score =  419 bits (1076), Expect = e-115,   Method: Composition-based stats.
 Identities = 207/546 (37%), Positives = 299/546 (54%), Gaps = 17/546 (3%)

Query: 1   MN-PFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKD 59
           M+ P   +   + PE++V+ELS  LK  VE    HV VRGEI+G+RG HSSGH YFSLKD
Sbjct: 1   MSKPSVSEPLGNSPEFTVTELSSALKRTVEDAYGHVRVRGEITGFRGAHSSGHCYFSLKD 60

Query: 60  NHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTA 119
           + ++I+A+IWKG   ++ F P+EG+E +  GK+TT+PGSSKYQI+IE++ P+G G L+  
Sbjct: 61  DGAKIEAVIWKGVHGRMRFKPQEGLEVIATGKLTTYPGSSKYQIVIEAIEPAGVGALMAL 120

Query: 120 LEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPV 179
           +E+RK+KL  EGLF +  K  +P++P++I V+TSPTGAVIRDIL R+  RFP RV+++PV
Sbjct: 121 MEERKRKLGAEGLFDEARKQLLPYLPEVIGVVTSPTGAVIRDILHRLQDRFPRRVLVWPV 180

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
           +VQG+   +++A AI   N L EG   PRPD++I+ARGGGS+EDLW FN+E++VRA A S
Sbjct: 181 RVQGEGSAEQVAAAIHGFNALSEGGAIPRPDLLIVARGGGSLEDLWSFNEEIVVRAAAES 240

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
            IP+ISA+GHETD TL D+AAD RAPTPT AAEMAVPV+  L   +     R+     R 
Sbjct: 241 MIPLISAVGHETDITLIDFAADKRAPTPTAAAEMAVPVRAELFVEVSARNRRMMLCWQRG 300

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
            + +   L +  +ALP+    L+    RLD     L   L       +R F      +  
Sbjct: 301 QERRRTELRAATRALPSGGALLAIPTQRLDGAAAALPRALRANTHAHHRRFAQASAGLTL 360

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILH----MLREQTKNRIFY 415
             L   +    Q +      ++   +  LR          A L        +  + RI  
Sbjct: 361 RVLRAQVAHAAQRLDVNGARLKHCARAALRQRRDRFDALAARLKTSKLANAQAQRARIAR 420

Query: 416 LHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQ 475
                ++L  R    LS  I+     V+   ++L + +Y+  L RG+  ++D     +  
Sbjct: 421 EQERTQRLTERSRRALSILIERHRARVTHAGQLLGALSYRGVLARGFALVRDAQGAALHA 480

Query: 476 KRNLATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHN------------NKREKQG 523
             ++A    + + F DG+  A       P +  TK                   +  K  
Sbjct: 481 AASVAAGAHLTLEFADGRIGATADADGRPAQASTKATMSARSDAKPAKPAAAVKRVAKPV 540

Query: 524 TQGELF 529
            QG LF
Sbjct: 541 GQGSLF 546


>gi|288958827|ref|YP_003449168.1| exodeoxyribonuclease VII large subunit [Azospirillum sp. B510]
 gi|288911135|dbj|BAI72624.1| exodeoxyribonuclease VII large subunit [Azospirillum sp. B510]
          Length = 578

 Score =  418 bits (1073), Expect = e-114,   Method: Composition-based stats.
 Identities = 187/529 (35%), Positives = 289/529 (54%), Gaps = 9/529 (1%)

Query: 5   SQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRI 64
             +   + PE++V +L+  LK  +E     V VRGEIS  +  HSSGH Y  LKD+ + I
Sbjct: 55  EPRPGSNLPEFTVGDLARRLKRSIEEEFGFVRVRGEISQPK-KHSSGHCYMRLKDDTAVI 113

Query: 65  DAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRK 124
           +A+ W+GT+ K+   PEEG+E +V G++TT+PG S+YQ+I+ES+  +G G LL  LE+RK
Sbjct: 114 EAVCWRGTMAKLAIRPEEGLEVIVTGRMTTYPGRSQYQLIVESMELAGEGALLKMLEERK 173

Query: 125 KKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGD 184
           ++L  EGLF    K PIPF+P +I V+TSPTGAVIRDIL R++ RFP  V+++PV VQG+
Sbjct: 174 RRLTAEGLFDPARKKPIPFLPDVIGVVTSPTGAVIRDILHRLNDRFPRHVLLWPVAVQGE 233

Query: 185 ECPKEIANAILQLNTLKEGRTC----PRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
               E+  AI   N ++ G       PRPD+II+ARGGGS+EDL  FN+E +VRA A S+
Sbjct: 234 RAAAEVTAAIEGFNRIQPGGPQGSRVPRPDLIIVARGGGSLEDLMAFNEESVVRAAAASA 293

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP+ISA+GHETD TL D+A+DLRAPTPT AAEMAVPV+  L + +++ E RL     R +
Sbjct: 294 IPLISAVGHETDTTLIDFASDLRAPTPTAAAEMAVPVRGELLAQILDDERRLIACASRAV 353

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
             + N +  L + L +    L     RLD     L      ++ R+      +  +++  
Sbjct: 354 ADRRNRVEGLARGLGDPRALLEGHAQRLDDRAERLNLAASALLERRRTRVGELAAKLR-- 411

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420
                + +  Q +  + + ++  ++  +       +     L       +  +      +
Sbjct: 412 HPREKLAQAGQRLASESRALDSALRHAVTTAGGRFERVAGRLSP--TPARAMLAEGERRV 469

Query: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480
             L  R++   +  +     +++   ++L+S++YK  L RG+  I+D +   +T      
Sbjct: 470 ADLAPRLDRSHAKGVADKAAALASLGQLLESYSYKGVLARGFALIEDRDGRPVTGADQAT 529

Query: 481 TKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
               + I F D    A  I+   PK +   + +    K      QG LF
Sbjct: 530 PGLAVTIVFADDAKVAATIDGGAPKPESKPEKKAEPRKPRPIPVQGSLF 578


>gi|296446110|ref|ZP_06888058.1| exodeoxyribonuclease VII, large subunit [Methylosinus trichosporium
           OB3b]
 gi|296256304|gb|EFH03383.1| exodeoxyribonuclease VII, large subunit [Methylosinus trichosporium
           OB3b]
          Length = 526

 Score =  416 bits (1070), Expect = e-114,   Method: Composition-based stats.
 Identities = 198/527 (37%), Positives = 282/527 (53%), Gaps = 20/527 (3%)

Query: 3   PFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHS 62
           P       + PE SVSEL+  LK  VE    HV VRGEI+ YRG HSSGH YFSLKD ++
Sbjct: 20  PIGAPPQSNVPELSVSELANALKRTVEDRFGHVRVRGEITNYRGPHSSGHVYFSLKDQNA 79

Query: 63  RIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEK 122
           R+DA+IWK T  ++   P+EG+E +  GKITTFPG S YQI+I++L P+G+G L+  L++
Sbjct: 80  RLDAVIWKTTFFRLRVKPQEGLEVVATGKITTFPGKSSYQIVIDTLEPAGAGALMALLDE 139

Query: 123 RKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQ 182
           R+K+L  EGLF  + K P+PF+P ++ V+TSPTGAVIRDIL R+  RFP RV+++PV+VQ
Sbjct: 140 RRKRLAAEGLFDAERKRPLPFLPAVVGVVTSPTGAVIRDILHRLLDRFPRRVLVWPVRVQ 199

Query: 183 GDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIP 242
           G+ C  E+  AI   N L  G   PRPD++I+ARGGGS+EDLW FN+E++VRA A S+IP
Sbjct: 200 GESCAAEVTAAIEGFNALPPGGPIPRPDVLIVARGGGSLEDLWGFNEEIVVRAAAASAIP 259

Query: 243 IISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKY 302
           ++SAIGHETD TL D+ +DLRAPTPTGAAE  VPV+  L      L  RL+    RL+  
Sbjct: 260 LVSAIGHETDTTLIDFVSDLRAPTPTGAAEKCVPVRAELIEQTAVLARRLSGAERRLLDA 319

Query: 303 KINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFL 362
               L SL + LP   Q L     R DR    L   L   +  +    +H+ + +     
Sbjct: 320 HRRHLVSLQRVLPAGPQLLMHPFQRSDRAGERLRAALRRALDARRLRLSHLTHVLARHSP 379

Query: 363 IHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKK 422
              + +  + +      + Q +   +                     +         +  
Sbjct: 380 QAELARASERLKGLHARLRQGLSARMALA------------------RREADGAQRRVDH 421

Query: 423 LITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATK 482
              R+       I      +    ++ +   Y++ L RG+  ++D     +   R++   
Sbjct: 422 AEQRLRSAYFRIIADRQARLDRLDQLRRMLGYESVLARGFALVRDEQGTVLRLARDVTPG 481

Query: 483 TRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
             + I F D    A     APP+     + +   +K    G QG LF
Sbjct: 482 MAMAIQFADSAVRARAEGDAPPEPPAPPRPKRGKDKT--GGGQGTLF 526


>gi|298293951|ref|YP_003695890.1| exodeoxyribonuclease VII large subunit [Starkeya novella DSM 506]
 gi|296930462|gb|ADH91271.1| exodeoxyribonuclease VII, large subunit [Starkeya novella DSM 506]
          Length = 514

 Score =  416 bits (1069), Expect = e-114,   Method: Composition-based stats.
 Identities = 206/528 (39%), Positives = 297/528 (56%), Gaps = 18/528 (3%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           +  ++    + P+++VSELS  LK  VE    HV VRGEISGYRG HSSGHAYFSLKD +
Sbjct: 3   DTTTESPISNAPDWTVSELSGALKRTVEDAFGHVRVRGEISGYRGPHSSGHAYFSLKDQN 62

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           +R+DA++WKG   +++  PEEG+E + IG+ITTFPG S YQI+I+ L  +G+G ++  LE
Sbjct: 63  ARLDAVVWKGVFGRLKVRPEEGLEVVAIGRITTFPGKSSYQIVIDQLEFAGAGAIMAMLE 122

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           +RK++L  EGLF+ + K   PF+P +I V+TSPTGAVIRDIL R+S RFP  V+++PV+V
Sbjct: 123 ERKRRLAAEGLFAGERKRRPPFLPVVIGVVTSPTGAVIRDILHRLSDRFPRHVLVWPVRV 182

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QGD C  E+  AI   N L  G   PRPD++I+ARGGGS+EDL  F++E +VRA A S+I
Sbjct: 183 QGDTCGAEVTAAIRGFNALTPGGPIPRPDVLIVARGGGSLEDLLGFSEESVVRAAAESAI 242

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETD TL D+AAD+RAPTPT AAEMAVPV+  L + +  L ARL     R + 
Sbjct: 243 PLISAVGHETDVTLIDFAADVRAPTPTAAAEMAVPVRADLIAEVAGLHARLRACFARGLD 302

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            +   L SL + LP++D  L+  R RLD   + L   L+               R+    
Sbjct: 303 RRATDLRSLSRLLPSADALLALPRQRLDIAGQRLPRALKANAAAHRLALTRAEGRLAPQR 362

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIK 421
           L   +++ R+        +                     L       + RI      + 
Sbjct: 363 LAVLVERRRERFELFAGRLSSA------------------LRANANAHRERIDRARERVN 404

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLAT 481
            +  R+   L    +     +    +++Q+ +YK  L RGY  ++D N   +     +A+
Sbjct: 405 GVHARLAPCLRRGHEERARKLRSLEQLMQALSYKGVLARGYALVRDANGEPLHAAAEVAS 464

Query: 482 KTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
              + I F DG+ +A+   +  P   P +K          + +Q  LF
Sbjct: 465 GQALEIEFRDGRVSAVATGEGTPPRPPARKPAKPRGALPDEDSQPTLF 512


>gi|300024096|ref|YP_003756707.1| exodeoxyribonuclease VII large subunit [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299525917|gb|ADJ24386.1| exodeoxyribonuclease VII, large subunit [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 488

 Score =  415 bits (1066), Expect = e-114,   Method: Composition-based stats.
 Identities = 190/526 (36%), Positives = 282/526 (53%), Gaps = 49/526 (9%)

Query: 6   QKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRID 65
            +   + PE+SVSELS  +K  +E    +V +RGEISGYRG H+SGH YF+LKD+ ++I+
Sbjct: 10  ARPGANAPEFSVSELSGAIKRALEDGFGYVRLRGEISGYRGPHASGHCYFALKDDRAKIE 69

Query: 66  AIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKK 125
           A+IWKG+  ++ F PEEG+E +  GKITTFPGSSKYQI+IE L P+G+G L+  LE+RK+
Sbjct: 70  AVIWKGSFGRLRFKPEEGMEVVAQGKITTFPGSSKYQIVIEQLEPAGAGALMALLEERKR 129

Query: 126 KLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDE 185
           K   EGLF +  K P PF+PK++ ++TSPTGAVIRD+L   + RFP  V+++PV+VQG+ 
Sbjct: 130 KFAAEGLFEEARKKPRPFLPKVVGIVTSPTGAVIRDMLHGFNERFPTCVLLWPVRVQGEG 189

Query: 186 CPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIIS 245
              E+A AI   N L+ G   PRPD++I+ARGGGS+EDLW FN+E++VRA A S IP+IS
Sbjct: 190 SAAEVAAAIRGFNALEIGGKIPRPDVLIVARGGGSLEDLWSFNEEIVVRAAAESRIPLIS 249

Query: 246 AIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKIN 305
           A+GHETDWTL D  AD RAPTPT AAE AVP    L  +L   + R    I R++     
Sbjct: 250 AVGHETDWTLIDLVADARAPTPTKAAEWAVPKYSELIEALDKFQLRKRTAIRRVLADTRT 309

Query: 306 TLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHN 365
            L +  + LP     ++  R R D + R L   L             +  R+ +  ++  
Sbjct: 310 HLKASSRGLPKLQDLIALPRQRFDAVDRRLSRALLANTRAHGTRLARVSGRLSAQPIVQK 369

Query: 366 IQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLIT 425
             + R+ +   ++   Q +   +                                     
Sbjct: 370 HSRCRERLDVLERRAGQALINRV------------------------------------- 392

Query: 426 RIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRI 485
                +  +       +   + +L+S  Y++ L RG+  ++D     + Q R+++    +
Sbjct: 393 ----AVRRR------DLDGKSALLKSLGYQSVLSRGFALVRDETGVTVRQARSVSPGAAL 442

Query: 486 LINFFDGQANAIVINKAP--PKEQPTKKCQLHNNKREKQGTQGELF 529
            + F DG+   +           +     +    K   +G QG LF
Sbjct: 443 SVQFSDGRIGVVADGDPATGTGAESAAGTKPPRQKTRTRGGQGSLF 488


>gi|307941763|ref|ZP_07657118.1| exodeoxyribonuclease VII, large subunit [Roseibium sp. TrichSKD4]
 gi|307775371|gb|EFO34577.1| exodeoxyribonuclease VII, large subunit [Roseibium sp. TrichSKD4]
          Length = 524

 Score =  414 bits (1063), Expect = e-113,   Method: Composition-based stats.
 Identities = 202/522 (38%), Positives = 298/522 (57%), Gaps = 5/522 (0%)

Query: 10  LDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIW 69
            +  E+SVSE+S+ +K  +E    +V VRGE+ G      SGH Y  LKD  + +  +IW
Sbjct: 6   SNVAEFSVSEISFSIKRAMEDTFGYVRVRGEL-GRISRPGSGHIYLDLKDERAVLSGVIW 64

Query: 70  KGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLE 129
           +G  +K++  PE+G+E +  GKITTFPG SKYQ++I+SL P+G+G L+  LE+RKKKL  
Sbjct: 65  RGVASKLKIQPEQGLEVIATGKITTFPGQSKYQMVIDSLEPAGAGALMALLEERKKKLAA 124

Query: 130 EGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKE 189
           EGLFS++ K  +P +P++I V+TSPTGAVIRDIL RIS RFPL V+++PV+VQG+    E
Sbjct: 125 EGLFSEERKQRLPHLPRVIGVVTSPTGAVIRDILHRISDRFPLHVLVWPVRVQGETSGAE 184

Query: 190 IANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGH 249
           +AN I   N+L+ G   PRPD+I++ARGGGSIEDLW FN+E +VRA A S IP+ISA+GH
Sbjct: 185 VANGIRGFNSLQAGGPIPRPDLIVVARGGGSIEDLWGFNEEAVVRAAAASEIPLISAVGH 244

Query: 250 ETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNS 309
           ETDWTL D AADLRAPTPTGAAE+AVPVK  L + + +L  RL + + R I  +   L +
Sbjct: 245 ETDWTLIDLAADLRAPTPTGAAEIAVPVKAELLALVDDLSRRLYSGLNRSIANRRTELRA 304

Query: 310 LLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKN 369
              ALP     L+  R R D     LE  L +        F+ +  R+    L   +   
Sbjct: 305 AGAALPAPRDLLALPRQRFDTAAGSLERALIVNTRSHRSGFDGVSARLSPLLLTRGLSHA 364

Query: 370 RQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEF 429
              +        + ++  ++          + L   R + ++ +      +K L  R++ 
Sbjct: 365 HDRLTALVDRQSRALQVTVQSKRQTYSAVASRLTPDRLRQQSALGL--ERLKTLSERMDR 422

Query: 430 ILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINF 489
              +++      +    ++L S +YK  L RGY  ++D +   +    ++    +++I  
Sbjct: 423 AYGNRLAQDKARLDGLDKLLNSLSYKEVLSRGYAVVRDKSGTPVRSATDVPAGEKLVIEL 482

Query: 490 FDGQANAIVINK--APPKEQPTKKCQLHNNKREKQGTQGELF 529
            DG  +A+ ++   A   E+   K      K  K  TQG LF
Sbjct: 483 SDGLIDAMAVSANSASKTEKKAPKKPAAKPKNNKPETQGNLF 524


>gi|163737651|ref|ZP_02145068.1| exodeoxyribonuclease VII, large subunit [Phaeobacter gallaeciensis
           BS107]
 gi|161389177|gb|EDQ13529.1| exodeoxyribonuclease VII, large subunit [Phaeobacter gallaeciensis
           BS107]
          Length = 521

 Score =  413 bits (1062), Expect = e-113,   Method: Composition-based stats.
 Identities = 189/541 (34%), Positives = 283/541 (52%), Gaps = 39/541 (7%)

Query: 2   NPFS-QKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           +P    +   + PE++VSE+S  +K  +E     + V+GE+ G      SGH Y+ +KD+
Sbjct: 7   DPAPSDRPGQNAPEFTVSEISGEVKRTLEGTFGRIRVKGEV-GRVFKARSGHLYYDIKDD 65

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            S +    WKG +  +  +PEEG+E +V G++T F G SKY + ++ +  +G G L+  L
Sbjct: 66  RSVLACTTWKGQIASLSVVPEEGLEVVVTGRLTAFGGQSKYNMNVDEVAVAGQGALMALL 125

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           EKRKK+L  EGLF+ + K P+P++P+II V+TSP+GAVIRDIL R+  RFP +V+++PV 
Sbjct: 126 EKRKKQLEAEGLFAPERKKPLPYLPQIIGVVTSPSGAVIRDILHRLRDRFPRKVLVWPVA 185

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQG  C  E+A AI   N L  G   PRPD+II+ARGGGSIEDLW FN+E + RA+ANS 
Sbjct: 186 VQGANCAPEVARAIEGFNQLTPGGALPRPDLIIVARGGGSIEDLWGFNEETVARAVANSQ 245

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP+ISA+GHETD TL D+ +D RAPTPT AAE+AVPV+  L     N  ARL     + +
Sbjct: 246 IPLISAVGHETDTTLIDFVSDRRAPTPTAAAELAVPVRLELLGWTENQGARLVRSAGQAV 305

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           + +   LN L +ALP  D  L   R RLDR+   L   L   + R+    +     ++  
Sbjct: 306 QQRRQRLNDLARALPKPDTLLETPRQRLDRVSERLPDALIRGVERRRLRLSEAAAALRPS 365

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420
            L   +   +  +      +                             +  +   H  I
Sbjct: 366 TLRQLVGARQDRLRNLSSRLT------------------------LRPIQQDLARQHDRI 401

Query: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480
            +L  R+E + + ++      +  T R L+  +YK TL+RGY  ++  +   IT+    A
Sbjct: 402 GQLTQRLEAVQTQRLDRHRQRLEATGRQLEILSYKATLERGYAVVRSDDG-VITRATEAA 460

Query: 481 TKTRILINFFDGQANAIV------INKAPPKEQPTKKCQLHNNK------REKQGTQGEL 528
           T+ R+ I F D + +             PP ++ +      +        +     QG L
Sbjct: 461 TQPRLRIEFADAEIDVTPAEAGGGDGGTPPAKRSSAPKSEASKPGKRPSGKAPPDDQGSL 520

Query: 529 F 529
           F
Sbjct: 521 F 521


>gi|83942803|ref|ZP_00955264.1| exodeoxyribonuclease VII, large subunit [Sulfitobacter sp. EE-36]
 gi|83846896|gb|EAP84772.1| exodeoxyribonuclease VII, large subunit [Sulfitobacter sp. EE-36]
          Length = 511

 Score =  413 bits (1062), Expect = e-113,   Method: Composition-based stats.
 Identities = 195/530 (36%), Positives = 289/530 (54%), Gaps = 20/530 (3%)

Query: 1   MNPFSQ-KNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKD 59
           M+     +   + PE++V+ELS  +K ++E    HV +RGE+ G      SGH Y  LKD
Sbjct: 1   MDLIDDPREGQNSPEFTVTELSGAIKRVIEGEFGHVRIRGEV-GRVSRPRSGHIYLDLKD 59

Query: 60  NHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTA 119
           + S I  +IWKG   ++E  PEEG+E +  G+ITTF G SKYQI+IE + P+G G L+  
Sbjct: 60  DSSVISGVIWKGVSARLETQPEEGMEVIATGRITTFGGQSKYQIVIEDIKPAGMGALMAL 119

Query: 120 LEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPV 179
           LEKRK  L  EGLF+ + K P+P++P++I V+TSP+GAVIRDIL R+  RFP +V+I+PV
Sbjct: 120 LEKRKAALAAEGLFAPERKRPLPYLPEVIGVVTSPSGAVIRDILHRLRDRFPRKVLIWPV 179

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
            VQG +C  E+A AI   N L  G   PRPD++I+ARGGGS+EDLW FN+E++ RA A S
Sbjct: 180 AVQGAKCAPEVARAIAGFNALTPGGALPRPDLLIVARGGGSVEDLWGFNEEIVARAAAAS 239

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
            IP+ISA+GHETD TL DY +D RAPTPT AAE+AVPV+  L + L   EAR+   + + 
Sbjct: 240 DIPLISAVGHETDTTLIDYVSDKRAPTPTAAAELAVPVRHELVALLDGQEARMTQALSQG 299

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
           +  +   L  + +ALP  D  L   R RLD     L   L   + ++  H + I   ++ 
Sbjct: 300 LARRDQRLRDMARALPRPDSLLDGPRQRLDMRGARLGPALTAGVQKRKVHLSDISGALRP 359

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH 419
             L  ++Q  ++ +                    +++ +  I     +  +         
Sbjct: 360 ATLRRSLQTEQRRLAALADRFRPEALGR----EQKRRLEGLIARFRPDALEQDRKRKEEA 415

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
            + L  R+      + +  H  ++   R+ +  +YK+TL RGY  ++  +   +T K+  
Sbjct: 416 FQSLARRLSDAGQRQTQGWHKQIAGLDRLHEMLSYKSTLARGYAVVRG-DGGVVTTKQAA 474

Query: 480 ATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
              + + I F DG+    +   A PK+ P K              QG LF
Sbjct: 475 QDASALEIEFIDGKMK--IGGGAAPKKTPKKAP-----------EQGSLF 511


>gi|221638251|ref|YP_002524513.1| exodeoxyribonuclease VII large subunit [Rhodobacter sphaeroides
           KD131]
 gi|254783706|sp|B9KM14|EX7L_RHOSK RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|221159032|gb|ACM00012.1| Exodeoxyribonuclease 7 large subunit [Rhodobacter sphaeroides
           KD131]
          Length = 519

 Score =  413 bits (1061), Expect = e-113,   Method: Composition-based stats.
 Identities = 193/534 (36%), Positives = 283/534 (52%), Gaps = 22/534 (4%)

Query: 1   MNPF--SQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLK 58
           M+        S + PE++VSELS  +K ++E     V VRGEI G     +SGH YF LK
Sbjct: 1   MSDLFEDPAPSRNTPEFTVSELSGAVKRVIEGEFGLVRVRGEI-GRVSRPASGHLYFDLK 59

Query: 59  DNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLT 118
           D+ + + AI WKG   ++   PEEG+E +  G++TTFPG SKYQII+E + P+G+G L+ 
Sbjct: 60  DDRAVMAAICWKGQAGRLSVRPEEGMEVVATGRMTTFPGQSKYQIIVEDMAPAGAGALMA 119

Query: 119 ALEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFP 178
            LEKR+  L  EGLF    K P+P++P++I V+TSP+GAVIRDIL R+  RFP  V+I+P
Sbjct: 120 MLEKRRAALAAEGLFDAARKRPLPYLPRVIGVVTSPSGAVIRDILHRLRDRFPSHVLIWP 179

Query: 179 VKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIAN 238
           V VQG++C  E+A AI   N L EG   PRPD++I+ARGGGS+EDLW FN+E++VRA A 
Sbjct: 180 VAVQGEKCAPEVAAAIRGFNALPEGGPIPRPDLLIVARGGGSLEDLWGFNEEIVVRAAAE 239

Query: 239 SSIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIR 298
           S IP+ISA+GHETD TL D+AAD RAPTPT AAEMAVPV+  L + L    ARL+     
Sbjct: 240 SRIPLISAVGHETDTTLIDHAADRRAPTPTAAAEMAVPVRLELLAGLDGQGARLSRCAAE 299

Query: 299 LIKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIK 358
            I+ +   L  L +ALP  +  ++    R D     L   L   +  +      +   ++
Sbjct: 300 TIRRRDQRLRDLARALPRLESLVAGPSQRFDLWSGRLSGALGQSVAARRARLEPLGAHLR 359

Query: 359 SDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHT 418
              L   + + +  + ++ + +E  + +         +   A L     +          
Sbjct: 360 PRLLADLVARQKDRLGDRTRSLETCLGRRAERARDRFEALSARLAPAFARLIAETERATR 419

Query: 419 H----IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFIT 474
                +  L  R++     ++      +    R+ Q+  Y+ TLKRGY  ++  +   +T
Sbjct: 420 RDAATLGTLAARLDAAPEARLARLSDRLEALDRLRQTLGYRETLKRGYAVVR-ADGAVVT 478

Query: 475 QKRNLATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGEL 528
            K    T   + I F DG+ +                       +E+   QG L
Sbjct: 479 TKAEAGTAAVLEIEFQDGRLSV--------------GRGKTRKPKEEPPAQGSL 518


>gi|170747101|ref|YP_001753361.1| exodeoxyribonuclease VII, large subunit [Methylobacterium
           radiotolerans JCM 2831]
 gi|170653623|gb|ACB22678.1| exodeoxyribonuclease VII, large subunit [Methylobacterium
           radiotolerans JCM 2831]
          Length = 566

 Score =  413 bits (1061), Expect = e-113,   Method: Composition-based stats.
 Identities = 209/547 (38%), Positives = 295/547 (53%), Gaps = 20/547 (3%)

Query: 3   PFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHS 62
           P +   + + PE+SV EL+  LK  +E    HV +RGEISGYRG H SGHAYFSLKD  +
Sbjct: 18  PPTSVLNANQPEWSVGELAGALKRTLEDAFGHVRLRGEISGYRGQHGSGHAYFSLKDGQA 77

Query: 63  RIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEK 122
           RIDA++WKG   ++   P+EG+E +  G+ITTF G S YQI+IESL P+G G  +  LE+
Sbjct: 78  RIDAVVWKGVFGRLRQRPQEGLEVVATGRITTFAGKSSYQIVIESLEPAGLGAWMALLEE 137

Query: 123 RKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQ 182
           RKK+L  EGLF+  HK PIP++P+++ V+TSPTGAVIRDIL R+  RFP  V+++PV+VQ
Sbjct: 138 RKKQLAAEGLFAPDHKRPIPYLPRVVGVVTSPTGAVIRDILHRLEDRFPRPVLVWPVRVQ 197

Query: 183 GDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIP 242
           GD   +E+A AI   N L  G   PRPD++I+ARGGGSIEDLW FN+E +VRA   S+IP
Sbjct: 198 GDGAAEEVAAAIRGFNALPAGGPIPRPDVLIVARGGGSIEDLWAFNEECVVRAAFASAIP 257

Query: 243 IISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKY 302
           +ISA+GHETD TL DY +D RAPTPTGAAEMAVPV+  L +++ +L AR    + R I  
Sbjct: 258 LISAVGHETDTTLIDYVSDRRAPTPTGAAEMAVPVRADLIATVADLAARGRGAVGRRIDR 317

Query: 303 KINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFL 362
             + L +L +ALP++D  L+  R RLD     L   L     R       +++R+     
Sbjct: 318 DRSDLRALGRALPSADALLAAKRQRLDLAEARLAPALAAGASRHRARLQLLLDRMARRSP 377

Query: 363 IHNIQKNRQHILEKQQH----IEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHT 418
              +   R  +          +   V++    +    +  +       E+ +        
Sbjct: 378 DVALANARARLARIDHRPLHALRNDVQRKGEALIQLGRRLVVAREASLERARALQARRTD 437

Query: 419 HIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRN 478
            +  L  R+    +  I+     +     +L S +Y+  L RGY  ++D     + +   
Sbjct: 438 RLLALSERLAQAGARGIERRRDRLDGLAGLLGSLSYRAVLDRGYVLVRDAAGLPVRRAAA 497

Query: 479 LATKTRILINFFDGQANAIVINKAPP-----KEQPTK-----------KCQLHNNKREKQ 522
            A   R+ + F DG   A+      P       +P K                   R   
Sbjct: 498 AAAAQRLSLQFADGTVTAVPDGTDDPSLPVDPSRPAKPGRRGGAAAPAAPGKRTGTRPAA 557

Query: 523 GTQGELF 529
             QG LF
Sbjct: 558 TRQGSLF 564


>gi|332560275|ref|ZP_08414597.1| exodeoxyribonuclease VII large subunit [Rhodobacter sphaeroides
           WS8N]
 gi|332277987|gb|EGJ23302.1| exodeoxyribonuclease VII large subunit [Rhodobacter sphaeroides
           WS8N]
          Length = 519

 Score =  412 bits (1060), Expect = e-113,   Method: Composition-based stats.
 Identities = 193/534 (36%), Positives = 282/534 (52%), Gaps = 22/534 (4%)

Query: 1   MNPF--SQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLK 58
           M+        S + PE++VSELS  +K ++E     V VRGEI G     +SGH YF LK
Sbjct: 1   MSDLFEDPAPSRNTPEFTVSELSGAVKRVIEGEFGLVRVRGEI-GRVSRPASGHLYFDLK 59

Query: 59  DNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLT 118
           D+ + + AI WKG   ++   PEEG+E +  G++TTFPG SKYQII+E + P+G+G L+ 
Sbjct: 60  DDRAVMAAICWKGQAGRLSVRPEEGMEVVATGRMTTFPGQSKYQIIVEDMAPAGAGALMA 119

Query: 119 ALEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFP 178
            LEKR+  L  EGLF    K+P+PF+P++I V+TSP+GAVIRDIL R+  RFP  V+I+P
Sbjct: 120 MLEKRRAALAAEGLFDAARKHPLPFLPRVIGVVTSPSGAVIRDILHRLRDRFPSHVLIWP 179

Query: 179 VKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIAN 238
           V VQG++C  E+A AI   N L EG   PRPD++I+ARGGGS+EDLW FN+E++VRA A 
Sbjct: 180 VAVQGEKCAPEVAAAIRGFNALPEGGPIPRPDLLIVARGGGSLEDLWGFNEEIVVRAAAE 239

Query: 239 SSIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIR 298
           S IP+ISA+GHETD TL D+AAD RAPTPT AAEMAVPV+  L + L    ARL+     
Sbjct: 240 SRIPLISAVGHETDTTLIDHAADRRAPTPTAAAEMAVPVRLELLAGLDGQGARLSRCAAE 299

Query: 299 LIKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIK 358
            I+ +   L  L +ALP  +  ++    R D     L   L   +  +      +   ++
Sbjct: 300 TIRRRDQRLRDLARALPRLESLVAGPSQRFDLWSGRLSGALGQSVAARRARLEPLGAHLR 359

Query: 359 SDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHT 418
              L   + + +  + ++ + +E  + +             A L     +          
Sbjct: 360 PRLLADLVARQKDRLGDRTRSLETCLGRRAERARDRFDALSARLAPAFARLIAETERATR 419

Query: 419 H----IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFIT 474
                +  L  R++     ++      +    R+ Q+  Y+ TLKRGY  ++  +   +T
Sbjct: 420 RDAATLGTLAARLDAAPEARLARLSDRLEALDRLRQTLGYRETLKRGYAVVR-ADGAVLT 478

Query: 475 QKRNLATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGEL 528
            K        + I F DG+ +                       +E+   QG L
Sbjct: 479 TKAEAGAAAMLEIEFQDGRLSV--------------GRGKTRKPKEEPPAQGSL 518


>gi|77462391|ref|YP_351895.1| exodeoxyribonuclease VII large subunit [Rhodobacter sphaeroides
           2.4.1]
 gi|123757775|sp|Q3J5E0|EX7L_RHOS4 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|77386809|gb|ABA77994.1| Exodeoxyribonuclease VII large subunit [Rhodobacter sphaeroides
           2.4.1]
          Length = 519

 Score =  412 bits (1059), Expect = e-113,   Method: Composition-based stats.
 Identities = 193/534 (36%), Positives = 282/534 (52%), Gaps = 22/534 (4%)

Query: 1   MNPF--SQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLK 58
           M+        S + PE++VSELS  +K ++E     V VRGEI G     +SGH YF LK
Sbjct: 1   MSDLFEDPAPSRNTPEFTVSELSGAVKRVIEGEFGLVRVRGEI-GRVSRPASGHLYFDLK 59

Query: 59  DNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLT 118
           D+ + + AI WKG   ++   PEEG+E +  G++TTFPG SKYQII+E + P+G+G L+ 
Sbjct: 60  DDRAVMAAICWKGQAGRLSVRPEEGMEVVATGRMTTFPGQSKYQIIVEDMAPAGAGALMA 119

Query: 119 ALEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFP 178
            LEKR+  L  EGLF    K+P+PF+P++I V+TSP+GAVIRDIL R+  RFP  V+I+P
Sbjct: 120 MLEKRRAALAAEGLFDAARKHPLPFLPRVIGVVTSPSGAVIRDILHRLRDRFPSHVLIWP 179

Query: 179 VKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIAN 238
           V VQG++C  E+A AI   N L EG   PRPD++I+ARGGGS+EDLW FN+E++VRA A 
Sbjct: 180 VAVQGEKCAPEVAAAIRGFNALPEGGPIPRPDLLIVARGGGSLEDLWGFNEEIVVRAAAE 239

Query: 239 SSIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIR 298
           S IP+ISA+GHETD TL D+AAD RAPTPT AAEMAVPV+  L + L    ARL+     
Sbjct: 240 SRIPLISAVGHETDTTLIDHAADRRAPTPTAAAEMAVPVRLELLAGLDGQVARLSRCAAE 299

Query: 299 LIKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIK 358
            I+ +   L  L +ALP  +  ++    R D     L   L   +  +      +   ++
Sbjct: 300 TIRRRDQRLRDLARALPRLESLVAGPSQRFDLWSGRLSGALGQSVAARRARLEPLGAHLR 359

Query: 359 SDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHT 418
              L   + + +  + ++ + +E  + +             A L     +          
Sbjct: 360 PRLLADLVARQKDRLGDRTRSLETCLGRRAERARDRFDALSARLAPAFARLIAETERATR 419

Query: 419 H----IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFIT 474
                +  L  R++     ++      +    R+ Q+  Y+ TLKRGY  ++  +   +T
Sbjct: 420 RDAATLGTLAARLDAAPEARLARLSDRLEALDRLRQTLGYRETLKRGYAVVR-ADGAVLT 478

Query: 475 QKRNLATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGEL 528
            K        + I F DG+ +                       +E+   QG L
Sbjct: 479 TKAEAGAAAMLEIEFQDGRLSV--------------GRGKTRKPKEEPPAQGSL 518


>gi|304393145|ref|ZP_07375073.1| exodeoxyribonuclease VII, large subunit [Ahrensia sp. R2A130]
 gi|303294152|gb|EFL88524.1| exodeoxyribonuclease VII, large subunit [Ahrensia sp. R2A130]
          Length = 558

 Score =  412 bits (1059), Expect = e-113,   Method: Composition-based stats.
 Identities = 209/553 (37%), Positives = 303/553 (54%), Gaps = 28/553 (5%)

Query: 5   SQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRI 64
           +     +  E SVSELS  LK  VE    HV VRGEISGYRG HSSGH+YF+LKD+ +RI
Sbjct: 6   NASKDTNALEVSVSELSGKLKRTVEDQFGHVRVRGEISGYRGPHSSGHSYFALKDDRARI 65

Query: 65  DAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRK 124
           DAIIWKG   K+   PEEG+E +  GK+TT+PG S YQI+I+ + P+G+G L+  LE+RK
Sbjct: 66  DAIIWKGQNAKLAHKPEEGLEVIASGKLTTYPGRSSYQIVIDHIEPAGAGALMALLEQRK 125

Query: 125 KKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGD 184
           K L  EGLF+D+ K  IPF+P++I V+TSPTGAVIRDIL R+  R+P+ VI++PV+VQG+
Sbjct: 126 KALASEGLFADERKQLIPFMPRVIGVVTSPTGAVIRDILHRLMDRYPVHVIVWPVRVQGE 185

Query: 185 ECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPII 244
              +E+AN + QLN   +G   P+PD+II+ARGGGS+EDLW FNDE +VR++A S IP+I
Sbjct: 186 TSGREVANGVYQLNRFGDGTDWPKPDLIIVARGGGSLEDLWGFNDEALVRSVAASDIPVI 245

Query: 245 SAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKI 304
           SA+GHETDWTL DYAADLR PTPT AAE AVP+K  L++ L NL ARL   + R+ + + 
Sbjct: 246 SAVGHETDWTLVDYAADLRMPTPTAAAEKAVPIKADLEAHLANLSARLRAAVSRVAETRR 305

Query: 305 NTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
            +L +  + LP+ D  L+  R   D     L  NL   + R    +      ++   L  
Sbjct: 306 TSLRATSRGLPSLDNLLALPRRAFDEAAAGLGRNLVQRVERASFSYERAAGGLRPLLLEK 365

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAIL---------------------H 403
            +  + + +  + ++ ++ ++   R       ++   L                      
Sbjct: 366 RLAASGELLARQIENHQRALRNATRSKRQRFDDRAGRLSPDVLNRPISMAQRNLSQAANK 425

Query: 404 MLREQTKNRIFYLHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYT 463
           +  E    R+        K   R++ + +  +           R+ +S +YK+ ++RGY 
Sbjct: 426 LRPEPLVQRVSAGRDASNKAFARVDRLTTASLAQAKERFERAERMRESLSYKSVIQRGYA 485

Query: 464 SIQDTNNNFITQKRNLATKTRILINFFDGQANAIVINKAPPKEQPTKKCQL-------HN 516
            ++D     +    N+A    I +   DG   A V +          +            
Sbjct: 486 VLRDDAGALVDNASNVAVGDNIHVEMRDGSFGANVTDTNAAPPAKVAQSATVSKPKTPKK 545

Query: 517 NKREKQGTQGELF 529
             +     QG LF
Sbjct: 546 AAKPPATDQGNLF 558


>gi|85706860|ref|ZP_01037951.1| Exonuclease VII, large subunit [Roseovarius sp. 217]
 gi|85668653|gb|EAQ23523.1| Exonuclease VII, large subunit [Roseovarius sp. 217]
          Length = 497

 Score =  412 bits (1058), Expect = e-113,   Method: Composition-based stats.
 Identities = 196/531 (36%), Positives = 284/531 (53%), Gaps = 36/531 (6%)

Query: 1   MNPFSQKN--SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLK 58
           M+          + PE+SVS+LS  +K ++E   SHV VRGE+ G      SGH Y  LK
Sbjct: 1   MSDLIDDPDEGGNAPEFSVSDLSGAIKRMIEGEFSHVRVRGEL-GRISRPRSGHIYLDLK 59

Query: 59  DNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLT 118
           D+ + +  IIWKG   ++   PEEG+E +  G++TTFPG S+YQIIIE + P+G G L+ 
Sbjct: 60  DDSAVLAGIIWKGVATRLAVQPEEGMEVVATGRLTTFPGQSRYQIIIEDMKPAGMGALMA 119

Query: 119 ALEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFP 178
            LEKRK  L  EGLF+ + K  +P++P II V+TSP+GAVIRDIL R+  RFP +V+I+P
Sbjct: 120 MLEKRKAALAAEGLFAPERKQALPYLPDIIGVVTSPSGAVIRDILHRLRDRFPRKVLIWP 179

Query: 179 VKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIAN 238
           V VQGD+C  E+A AI   N +  G   PRPD+II+ARGGGS+EDLW FN+E++VRA A 
Sbjct: 180 VAVQGDKCAPEVARAIRGFNAMTPGGALPRPDLIIVARGGGSVEDLWGFNEEIVVRAAAE 239

Query: 239 SSIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIR 298
           S IP+ISA+GHETD TL D+A+D RAPTPT AAE+AVPV+  L + +    ARL++ + +
Sbjct: 240 SVIPLISAVGHETDTTLIDFASDKRAPTPTAAAELAVPVRMDLLAWVEGQGARLSHALSQ 299

Query: 299 LIKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIK 358
            +  +   L  L +ALP +D  L   R RLD L   L   L   +  +  H +     ++
Sbjct: 300 GVSLRGQRLRDLARALPRADVLLDGPRQRLDALGERLPAALIRSVQVRRVHLSETAGALR 359

Query: 359 SDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHT 418
              L   ++ +R+ +      +                                I     
Sbjct: 360 PALLRRAVEGDRRRLQATAARL------------------------NVHALNRDITQKRR 395

Query: 419 HIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRN 478
            + ++  R   +   +++     +S   R+ ++  YK TLKRGY  ++  +   +T ++ 
Sbjct: 396 ELDRMSARFSEVAGRQVRGWQDRLSALERLRETLGYKATLKRGYAVVRG-DGAVVTTRKA 454

Query: 479 LATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
            A    + I F DG  +  V    P    P          +     QG LF
Sbjct: 455 AAGAAVLEIEFADGMLD--VSGTGPAVPIP------KVKPKTPPEGQGSLF 497


>gi|163740774|ref|ZP_02148167.1| exodeoxyribonuclease VII, large subunit [Phaeobacter gallaeciensis
           2.10]
 gi|161385765|gb|EDQ10141.1| exodeoxyribonuclease VII, large subunit [Phaeobacter gallaeciensis
           2.10]
          Length = 521

 Score =  411 bits (1057), Expect = e-112,   Method: Composition-based stats.
 Identities = 189/541 (34%), Positives = 283/541 (52%), Gaps = 39/541 (7%)

Query: 2   NPFS-QKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           +P    +   + PE++VSE+S  +K  +E     + V+GE+ G      SGH Y+ +KD+
Sbjct: 7   DPAPSDRPGQNAPEFTVSEISGEVKRTLEGTFGRIRVKGEV-GRVFKARSGHLYYDIKDD 65

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            S +    WKG +  +  +PEEG+E +V G++T F G SKY + ++ +  +G G L+  L
Sbjct: 66  RSVLACTTWKGQIASLSVVPEEGLEVVVTGRLTAFGGQSKYNMNVDEVAVAGQGALMALL 125

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           EKRKK+L  EGLF+ + K P+P++P+II V+TSP+GAVIRDIL R+  RFP +V+++PV 
Sbjct: 126 EKRKKQLEAEGLFAPERKKPLPYLPQIIGVVTSPSGAVIRDILHRLRDRFPRKVLVWPVA 185

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQG  C  E+A AI   N L  G   PRPD+II+ARGGGSIEDLW FN+E + RA+ANS 
Sbjct: 186 VQGANCAPEVARAIEGFNQLTPGGALPRPDLIIVARGGGSIEDLWGFNEETVARAVANSQ 245

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP+ISA+GHETD TL D+ +D RAPTPT AAE+AVPV+  L     N  ARL     + +
Sbjct: 246 IPLISAVGHETDTTLIDFVSDRRAPTPTAAAELAVPVRLELLGWTENQGARLVRSAGQAV 305

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           + +   LN L +ALP  D  L   R RLDR+   L   L   + R+    +     ++  
Sbjct: 306 QQRRQRLNDLARALPKPDTLLETPRQRLDRVSERLPDALIRGVERRRLRLSEAAAALRPS 365

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420
            L   +   +  +      +                             +  +   H  I
Sbjct: 366 TLRQLVGARQDRLRNLSSRLT------------------------LRPIQQDLARQHDRI 401

Query: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480
            +L  R+E + + ++      +  T R L+  +YK TL+RGY  ++  +   IT+    A
Sbjct: 402 GQLTQRLEAVQTQRLDRHRQRLEATGRQLEILSYKATLERGYAVVRSDDG-VITRAAEAA 460

Query: 481 TKTRILINFFDGQANAIV------INKAPPKEQPTKKCQLHNNK------REKQGTQGEL 528
           T+ R+ I F D + +             PP +  +      +        + +   QG L
Sbjct: 461 TQPRLRIEFADAEIDVTPAEAGGGDGVTPPAKSSSAPKSEASKPGKRPSGKAQPDDQGSL 520

Query: 529 F 529
           F
Sbjct: 521 F 521


>gi|163733311|ref|ZP_02140754.1| exodeoxyribonuclease VII, large subunit, putative [Roseobacter
           litoralis Och 149]
 gi|161393099|gb|EDQ17425.1| exodeoxyribonuclease VII, large subunit, putative [Roseobacter
           litoralis Och 149]
          Length = 513

 Score =  411 bits (1056), Expect = e-112,   Method: Composition-based stats.
 Identities = 180/530 (33%), Positives = 284/530 (53%), Gaps = 18/530 (3%)

Query: 1   MNPFSQK-NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKD 59
           M+         + PE++VSE+S  +K  +E     V VRGE+S       SGH Y+ +KD
Sbjct: 1   MDLLDDPTPGQNTPEFTVSEISGAVKRTLEGEFGRVRVRGEVS-RVIKARSGHMYYDIKD 59

Query: 60  NHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTA 119
           + +++    WKG + ++  +PEEG+E +V G+IT +   SKY + ++ +  +G G L+  
Sbjct: 60  DRNQLSCTTWKGQVARLSVIPEEGLEVVVTGRITAYGAQSKYNMNVDEVAVAGKGALMAL 119

Query: 120 LEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPV 179
           LEKRKK+L  EGLF    K P+P++P+II V+TSPTGAVIRDIL R+  RFP +V+I+PV
Sbjct: 120 LEKRKKQLEAEGLFEASRKRPLPYLPEIIGVVTSPTGAVIRDILHRLRDRFPRKVLIWPV 179

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
            VQG++C  E+A AI   N L  G   PRPD+II+ARGGGS+EDLW FN+E + RA A S
Sbjct: 180 AVQGEKCAPEVAAAIAGFNALVPGGALPRPDLIIVARGGGSVEDLWGFNEESVARAAAAS 239

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
            IP+ISA+GHETD TL D+ +D RAPTPT AAE+AVPV+  L + +   +AR+   + + 
Sbjct: 240 DIPLISAVGHETDTTLIDFVSDKRAPTPTAAAELAVPVRHELIAWVEQQDARMRQALSQG 299

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
           +  +   L  + +ALP  D  L   R  +D     L   L   + R+      +   ++ 
Sbjct: 300 LTRRDQRLRDVARALPRPDSLLESPRQLVDTRGARLAPALMSGVQRRKIRLADVSGSLRP 359

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH 419
             L   +Q   + + EK + ++  + + L     + + ++          +        H
Sbjct: 360 AMLTRAVQAEDRQLKEKARRLQPALLRALATRKEQLETRVRR--YRPAVLEQDYRRKKQH 417

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
            + ++ R+  +    + +    +    R+ ++ +YK TL RG+  ++ ++   +T  +  
Sbjct: 418 FEDVVQRLGKVGEQNLDAARRKLDALGRLNETLSYKATLARGFAVVR-SDGAVVTDSKTA 476

Query: 480 ATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
            T + + I F DG+    V  K   K+   K              QG LF
Sbjct: 477 KTASSLEIQFADGRV--TVGGKTASKKSAGK-----------PPEQGSLF 513


>gi|148253225|ref|YP_001237810.1| exodeoxyribonuclease VII large subunit [Bradyrhizobium sp. BTAi1]
 gi|146405398|gb|ABQ33904.1| Exodeoxyribonuclease VII large subunit [Bradyrhizobium sp. BTAi1]
          Length = 536

 Score =  411 bits (1056), Expect = e-112,   Method: Composition-based stats.
 Identities = 204/538 (37%), Positives = 297/538 (55%), Gaps = 11/538 (2%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M P       + PE++VSELS  LK  VE    HV VRGEI+G+RG HSSGH YF+LKD 
Sbjct: 1   MPPAEALP--NAPEFTVSELSSALKRTVEDQFGHVRVRGEITGFRGPHSSGHCYFALKDE 58

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            ++I+A+IWKG   ++ F P+EG+E +  GK+TT+P SSKYQI+IE+L P+G G L+  +
Sbjct: 59  SAKIEAVIWKGVHGRMRFKPQEGLEVIATGKLTTYPNSSKYQIVIEALEPAGIGALMALM 118

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           E+RK+KL  EGLF    K  +P++P++I V+TSPTGAVIRDIL R+  RFP  V+++PVK
Sbjct: 119 EERKRKLGAEGLFDPARKQLLPWLPEVIGVVTSPTGAVIRDILHRLEDRFPRHVLVWPVK 178

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQG+   +++A AI   N L E    PRPD++I+ARGGGS+EDLW FN+E++VRA A S 
Sbjct: 179 VQGEGSAEQVAAAIRGFNDLPEDGPIPRPDVLIVARGGGSLEDLWSFNEEIVVRAAAESM 238

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP+ISA+GHETD TL D+AAD RAPTPT AAEMAVPV+  L   + +L  R++    R  
Sbjct: 239 IPLISAVGHETDVTLIDFAADKRAPTPTAAAEMAVPVRSELMQEVASLARRVSVCWQRSQ 298

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           + + N L +  +ALP + + L+  R RLD     L   L+      +R F     ++   
Sbjct: 299 EGRRNELRAAARALPGAAELLAIPRQRLDSAAASLPRALKTNTNVHFRQFAAASAKLTLR 358

Query: 361 FLIHNIQKNRQHILEKQQHIE---QIVKQHLRYIFLEKKEKIAILHMLREQTKNR-IFYL 416
            L   I +    ++   + +    + +    R  F     +     +   Q K + I   
Sbjct: 359 VLHGQIAQADHRLIVSSERLSLSARALLHRRRERFEALDARFKASRLAYAQAKRQAIERE 418

Query: 417 HTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQK 476
               ++L  R    L+  I      V    ++L + +Y++ L RG+  ++D   + + Q 
Sbjct: 419 RDRTERLADRAARALATSISRLSARVDHAGQLLAALSYRSVLARGFALVRDDAGHPLHQA 478

Query: 477 RNLATKTRILINFFDGQANAIVINKAPPKEQPT-----KKCQLHNNKREKQGTQGELF 529
            ++     + I F DG   A                  +       +      QG LF
Sbjct: 479 ASIGPNAALSIEFADGVVAATAAAGRAAPVAAPPKTARETKPAAAKRSPDPADQGSLF 536


>gi|126461268|ref|YP_001042382.1| exodeoxyribonuclease VII large subunit [Rhodobacter sphaeroides
           ATCC 17029]
 gi|158513432|sp|A3PGZ4|EX7L_RHOS1 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|126102932|gb|ABN75610.1| Exodeoxyribonuclease VII large subunit [Rhodobacter sphaeroides
           ATCC 17029]
          Length = 519

 Score =  411 bits (1055), Expect = e-112,   Method: Composition-based stats.
 Identities = 194/534 (36%), Positives = 282/534 (52%), Gaps = 22/534 (4%)

Query: 1   MNPF--SQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLK 58
           M+        S + PE++VSELS  +K ++E     V VRGEI G     +SGH YF LK
Sbjct: 1   MSDLFEDPAPSRNTPEFTVSELSGAVKRVIEGEFGLVRVRGEI-GRVSRPASGHLYFDLK 59

Query: 59  DNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLT 118
           D+ + + AI WKG   ++   PEEG+E +  G++TTFPG SKYQII+E + P+G+G L+ 
Sbjct: 60  DDRAVMAAICWKGQAGRLSVRPEEGMEVVATGRMTTFPGQSKYQIIVEDMAPAGAGALMA 119

Query: 119 ALEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFP 178
            LEKR+  L  EGLF    K P+PF+P++I V+TSP+GAVIRDIL R+  RFP  V+I+P
Sbjct: 120 MLEKRRAALAAEGLFDAGRKRPLPFLPRVIGVVTSPSGAVIRDILHRLRDRFPSHVLIWP 179

Query: 179 VKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIAN 238
           V VQG++C  E+A AI   NTL EG   PRPD++I+ARGGGS+EDLW FN+E++VRA A 
Sbjct: 180 VAVQGEKCAPEVAAAIRGFNTLPEGGPIPRPDLLIVARGGGSLEDLWGFNEEIVVRAAAE 239

Query: 239 SSIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIR 298
           S IP+ISA+GHETD TL D+AAD RAPTPT AAEMAVPV+  L + L    ARL+     
Sbjct: 240 SRIPLISAVGHETDTTLIDHAADRRAPTPTAAAEMAVPVRLELLAGLDGQGARLSRCAAE 299

Query: 299 LIKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIK 358
            I+ +   L  L +ALP  +  ++    R D     L   L   +  +      +   ++
Sbjct: 300 TIRRRDQRLRDLARALPRLESLVAGPSQRFDLWSGRLSGALGQSVAARRARLEPLGAHLR 359

Query: 359 SDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHT 418
              L   + + +  + ++ + +E  + +             A L     +          
Sbjct: 360 PRLLADLVARQKDRLGDRTRSLETCLGRRAERARDRFDALSARLAPAFARLIAETERASR 419

Query: 419 H----IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFIT 474
                +  L  R++     ++      +    R+ Q+  Y+ TLKRGY  ++  +   +T
Sbjct: 420 RDAATLGTLAARLDAAPEARLARLSDRLEALDRLRQTLGYRETLKRGYAVVR-ADGAVLT 478

Query: 475 QKRNLATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGEL 528
            K        + I F DG+ +                       +E+   QG L
Sbjct: 479 TKAEAGAAAMLEIEFQDGRLSV--------------GRGKTRKPKEEPPAQGSL 518


>gi|260427057|ref|ZP_05781036.1| exodeoxyribonuclease VII, large subunit [Citreicella sp. SE45]
 gi|260421549|gb|EEX14800.1| exodeoxyribonuclease VII, large subunit [Citreicella sp. SE45]
          Length = 490

 Score =  410 bits (1054), Expect = e-112,   Method: Composition-based stats.
 Identities = 191/528 (36%), Positives = 271/528 (51%), Gaps = 39/528 (7%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M+     +S + PE+SVSELS  +K ++E    HV V+GE+ G      SGH Y  LKD+
Sbjct: 1   MDLL-DDDSGNTPEFSVSELSGAVKRVIEGEFGHVRVKGEV-GRVSRPRSGHIYLDLKDD 58

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            S I  I+WKG   ++E  PEEG+E +  G++TTFPG SKYQI+IE + P+G G L+  L
Sbjct: 59  RSVIAGIVWKGVAARLETQPEEGMEVVATGRLTTFPGQSKYQIVIEDIRPAGLGALMAML 118

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           EKRK  L  EGLF    K P+P++P++I V+TSP+GAVIRDIL R+  RFP +V+I+PV 
Sbjct: 119 EKRKALLQAEGLFDASRKRPLPYLPEVIGVVTSPSGAVIRDILHRLRDRFPRKVLIWPVA 178

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQG  C  E+  AI   N L  G   PRPD++I+ARGGGS+EDLW FN+E + RA A S 
Sbjct: 179 VQGQNCAPEVVRAIEGFNALSPGGALPRPDLLIVARGGGSVEDLWGFNEEAVARAAAASQ 238

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP+ISA+GHETD TL D+ +D RAPTPT AAE+AVPV+  L S       R+   + + I
Sbjct: 239 IPLISAVGHETDTTLIDFVSDRRAPTPTAAAEIAVPVRMELLSWTGEAGVRMTRAMGQRI 298

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           + +   L  L +ALP ++  L   R RLD L   L   L     ++    + +   ++  
Sbjct: 299 EVRSQRLRDLSRALPRAETLLDQPRQRLDLLGDRLPRALIRGTEQRRVALSDVAGALRPS 358

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420
            L   I   R+ +  +   +                             +  I      +
Sbjct: 359 LLTRVIAHGRESLGRRTDRLS------------------------LRPIEREIAQGRDRL 394

Query: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480
             L  R+E   + ++      +   +R+L++ +YK TL RGY  ++      +T K    
Sbjct: 395 ATLSRRLEESATRRLDDPARKLDGLSRLLETLSYKGTLARGYAVVRSAEGTILTHKAAAQ 454

Query: 481 TKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGEL 528
               + I F DG+                        K      QG L
Sbjct: 455 NAAGLEIEFSDGRF-------------ALGGKARPKRKDTPAPEQGSL 489


>gi|299134218|ref|ZP_07027411.1| exodeoxyribonuclease VII, large subunit [Afipia sp. 1NLS2]
 gi|298590965|gb|EFI51167.1| exodeoxyribonuclease VII, large subunit [Afipia sp. 1NLS2]
          Length = 480

 Score =  409 bits (1052), Expect = e-112,   Method: Composition-based stats.
 Identities = 202/525 (38%), Positives = 288/525 (54%), Gaps = 48/525 (9%)

Query: 5   SQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRI 64
           + +   +  E++VSELS  LK  VE    HV VRGEISG+RG H+SGH YF+LKD  ++I
Sbjct: 4   AAETLSNATEFTVSELSSALKRTVEDTYGHVRVRGEISGFRGPHASGHCYFALKDESAKI 63

Query: 65  DAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRK 124
           +A+IWKG   ++   P+EG+E +  GK+TT+PGSSKYQI+IE++ P+G G L+  +E+RK
Sbjct: 64  EAVIWKGVHGRMRVKPQEGLEVIATGKLTTYPGSSKYQIVIEAIEPAGIGALMALMEERK 123

Query: 125 KKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGD 184
           KKL  EGLF +  K  +P++P++I VITSPTGAVIRDIL R+  RFP RV+++PV+VQG+
Sbjct: 124 KKLAAEGLFDESRKQLLPWLPEVIGVITSPTGAVIRDILHRLEDRFPRRVLVWPVRVQGE 183

Query: 185 ECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPII 244
              +++A AI   N L+EG   PRPD++I+ARGGGS+EDLW FN+E++VRA A S IP+I
Sbjct: 184 GSAEQVAAAIEGFNALEEGGPIPRPDLLIVARGGGSLEDLWSFNEEIVVRAAAASMIPLI 243

Query: 245 SAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKI 304
           SA+GHETD TL D+AAD RAPTPT AAEMAVPV+  L   + +L  R      R  +++ 
Sbjct: 244 SAVGHETDITLIDFAADKRAPTPTAAAEMAVPVRADLAIEISSLARRSFACWQRGQEHRR 303

Query: 305 NTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
           + L S  + LP     L+  R R DR   +L   L        R  + I  R+    L  
Sbjct: 304 SELRSAARGLPKLTDLLAIPRQRFDRASAQLPRALRANTHVYDRRLSMIAGRLTVTTLRG 363

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + R  +    +   +                          ++  I    T I+   
Sbjct: 364 QIARARDQVNRLSESARRC-------------------------SQQFIALRRTRIQ--- 395

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                               + ++L + +YK  L RG+  ++D     +     +     
Sbjct: 396 -------------------HSAQMLAALSYKGVLSRGFALVRDETGLPLHHAAQVGAGEH 436

Query: 485 ILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
           I I F DG+  A      PP  +   K     +  E +  QG+LF
Sbjct: 437 ISIEFADGRIAATAHG-TPPSAKKVAKPAKTADVPEHKKVQGDLF 480


>gi|220926374|ref|YP_002501676.1| exodeoxyribonuclease VII large subunit [Methylobacterium nodulans
           ORS 2060]
 gi|219950981|gb|ACL61373.1| exodeoxyribonuclease VII, large subunit [Methylobacterium nodulans
           ORS 2060]
          Length = 531

 Score =  409 bits (1050), Expect = e-112,   Method: Composition-based stats.
 Identities = 205/532 (38%), Positives = 289/532 (54%), Gaps = 36/532 (6%)

Query: 2   NPFSQK----NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSL 57
           +P           + PE+SV+EL+  LK  +E    HV +RGEISGYRG HSSGHAYFSL
Sbjct: 31  SPLPASLAVAAPANAPEWSVTELAAALKRTLEDAFGHVRLRGEISGYRGPHSSGHAYFSL 90

Query: 58  KDNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLL 117
           KD  ++IDA+IWKGTL ++   P+EG+E +  G+ITTFPG S YQIIIE+L P+G+G  +
Sbjct: 91  KDGGAKIDAVIWKGTLARLRHRPKEGLEVVATGRITTFPGKSAYQIIIEALEPAGAGAWM 150

Query: 118 TALEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIF 177
             LE+R++ L  EGLF    K P+P++P+++ V+TSPTGAVIRDIL R+  RFP  V+++
Sbjct: 151 ALLEERRRLLAAEGLFDAARKRPLPYLPRVVGVVTSPTGAVIRDILHRLEDRFPRPVLVW 210

Query: 178 PVKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIA 237
           PV+VQG+   +E+A AI   + L      PRPD++I+ARGGGSIEDLW FN+E++VRA A
Sbjct: 211 PVRVQGEGSAEEVAAAIRGFSALAPDGPIPRPDVLIVARGGGSIEDLWSFNEEIVVRAAA 270

Query: 238 NSSIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIII 297
            S+IP+ISA+GHETD TL D+AAD RAPTPTGAAEMAVPV+  L + L  L  R    + 
Sbjct: 271 ESAIPLISAVGHETDVTLIDHAADRRAPTPTGAAEMAVPVRLDLLADLDGLARRHAAALA 330

Query: 298 RLIKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRI 357
           R I+ + + L  L + +P+ +  L+  R RLD     L   L        R    ++  +
Sbjct: 331 RSIERRRSDLRGLARVIPSPEALLAVKRQRLDLAEARLRPALAEGARTAQRRLARLLQAL 390

Query: 358 KSDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLH 417
                   + + R+                            AI H  R   +  +    
Sbjct: 391 ARHPPALRLARARERF-------------------------AAIDHRPRHALERLVAVRS 425

Query: 418 THIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKR 477
             +  L  R+       ++   +  +    +  S  Y+  L RGY  + D     + +  
Sbjct: 426 ERLNGLAQRLAQAQDRDLERRRSRFAGAAALFDSLNYRAVLARGYALVLDAEGRPLAEAE 485

Query: 478 NLATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
                 RI + F DG+  A+V   APP+    K+             QG LF
Sbjct: 486 AARAAGRITVEFQDGKVAAVV-EGAPPRRAAAKRGP------AGPARQGSLF 530


>gi|329851150|ref|ZP_08265907.1| exodeoxyribonuclease VII, large subunit [Asticcacaulis biprosthecum
           C19]
 gi|328839996|gb|EGF89568.1| exodeoxyribonuclease VII, large subunit [Asticcacaulis biprosthecum
           C19]
          Length = 520

 Score =  409 bits (1050), Expect = e-112,   Method: Composition-based stats.
 Identities = 192/529 (36%), Positives = 282/529 (53%), Gaps = 14/529 (2%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           ++        + P YSVSEL+  LK  +E    HV +RGEIS     H+SGH Y +LKD+
Sbjct: 6   LSAADSPAGSNAPAYSVSELAGALKRTLEQTYDHVRLRGEISKVT-RHASGHIYLTLKDD 64

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            + ID +IWKG  ++++  P+ G+E +V G+ITTFP SSKYQI+IE +  +G G LL  L
Sbjct: 65  KANIDGVIWKGQASRLQTQPDYGLEVIVTGRITTFPASSKYQIVIEQMEVAGVGALLAQL 124

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           E+ K+KL  EGLF  + K P+P+ P+ I VITSPTGAVIRDIL RI  R+P RVI++PV 
Sbjct: 125 ERLKQKLNAEGLFRPERKKPLPYAPRTIGVITSPTGAVIRDILHRIRDRWPCRVIVWPVV 184

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQGD  P +I NA+       E    PRPD+II+ARGGGS+EDLW FNDE + RA+   S
Sbjct: 185 VQGDAAPPQIINALRGF----ESGAVPRPDVIIVARGGGSVEDLWPFNDEALARAVFACS 240

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP+ISA+GHETD TL D+ +D RAPTPTGAAE+A PV   L++   +LE R    + R +
Sbjct: 241 IPVISAVGHETDTTLIDHVSDRRAPTPTGAAELATPVIGELRALAADLERRRQACMSRGL 300

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           + +   L  L +ALP     +  ++ RLD + + L  +L   +   +  F     R+   
Sbjct: 301 ETRREKLALLARALPRPTDLIDSAQQRLDFVAQRLTGSLSQNLNLHHNAFTKASARLSPL 360

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420
            L   ++ +RQ +    Q +   +K H+             L     + +  I   H  +
Sbjct: 361 LLTRQVEHSRQRLDHAGQRLGGALKSHVDRATSRFAPLEGRLDGALTR-RLAIAQQHARL 419

Query: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480
             L  R+   +   +      +    ++  S +    L  G+  ++    + +TQ   ++
Sbjct: 420 PDLERRMGDAMQRLLSRQSERLQRLDQLRVSLSPTRPLDLGFALVERE-GHVVTQAAAVS 478

Query: 481 TKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
               + + F DG+   I    + P +   KK      +       G LF
Sbjct: 479 AGDVLTLTFKDGKTTVIAGEGSAPPKPQPKKPSPPPQQ-------GSLF 520


>gi|312115900|ref|YP_004013496.1| exodeoxyribonuclease VII large subunit [Rhodomicrobium vannielii
           ATCC 17100]
 gi|311221029|gb|ADP72397.1| exodeoxyribonuclease VII, large subunit [Rhodomicrobium vannielii
           ATCC 17100]
          Length = 529

 Score =  408 bits (1049), Expect = e-112,   Method: Composition-based stats.
 Identities = 196/531 (36%), Positives = 286/531 (53%), Gaps = 9/531 (1%)

Query: 4   FSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSR 63
              +   +  E++VSELS+ +K  VE     V +RGEISGYRG HSSGHAY  LKD+ +R
Sbjct: 1   MQAELLSNIAEFTVSELSFAIKRTVEDAYGLVRLRGEISGYRGQHSSGHAYLCLKDDKAR 60

Query: 64  IDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKR 123
           IDA+IW+GT + ++F PEEG+E +V G+ITTFPG S YQI+IE L P+G+G L+  LE+R
Sbjct: 61  IDAVIWRGTFSHLKFKPEEGLEVIVTGRITTFPGKSSYQIVIEQLEPAGAGALMALLEER 120

Query: 124 KKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQG 183
           KKKL  EGLF +  K P+PF P+++ ++TSPTGAVIRD+L   + R P RVI++PV+VQG
Sbjct: 121 KKKLAAEGLFDESRKRPLPFWPEVVGIVTSPTGAVIRDMLHGFTERCPTRVIVWPVRVQG 180

Query: 184 DECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPI 243
           + C  E++ AI   N L      PRPD++I+ARGGGS+EDLW FN+E +VRA A S+IP+
Sbjct: 181 ETCGAEVSAAIRGFNALDGFGPLPRPDLLIVARGGGSLEDLWGFNEEAVVRAAAESAIPL 240

Query: 244 ISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYK 303
           ISA+GHETDWTL D  AD RAPTPT AAE AVP    L   L     R    + R ++  
Sbjct: 241 ISAVGHETDWTLIDLVADARAPTPTKAAEWAVPKHADLIIRLGECIERARRCVRRNLEQL 300

Query: 304 INTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLI 363
                   + LP     L   R RLD     L   L     R    F     R+    + 
Sbjct: 301 RAEFRGAERGLPRPHTLLQVPRQRLDTAGARLGQALIYFTERSRGRFERSAVRLSPRLVA 360

Query: 364 HNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKL 423
             I + R+ +        +  +  +         +   L+     T  +       +  L
Sbjct: 361 RPIVEARERLGRAATFNARAFRDVIVRKRERWTVRAERLNAGLLATPTQ--RGIERLLML 418

Query: 424 ITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKT 483
             R +  +++        ++   ++LQS ++K+ L+RG+  ++D +   I +  +++   
Sbjct: 419 AARADQAVTNLAHRHRQRLAALGQLLQSLSHKSVLERGFALVRDADGRVIRRAASVSAAA 478

Query: 484 RILINFFDGQAN------AIVINKAPPKEQPTKKCQLHNNKREKQGTQGEL 528
            + I F DG             + +  + +   +       ++K G QG L
Sbjct: 479 ALDIEFADGHVQAHRAAADAEADTSASRRRSAAQVPRRATSKDKDG-QGTL 528


>gi|209966855|ref|YP_002299770.1| exodeoxyribonuclease VII, large subunit, putative [Rhodospirillum
           centenum SW]
 gi|259646298|sp|B6IXD4|EX7L_RHOCS RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|209960321|gb|ACJ00958.1| exodeoxyribonuclease VII, large subunit, putative [Rhodospirillum
           centenum SW]
          Length = 523

 Score =  408 bits (1048), Expect = e-111,   Method: Composition-based stats.
 Identities = 186/527 (35%), Positives = 284/527 (53%), Gaps = 10/527 (1%)

Query: 3   PFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHS 62
               +   + PE SV +L+  LK  VE    +V VRGEIS  +  HSSGH Y  LKD  +
Sbjct: 7   DLPPRTGSNLPEMSVGDLARALKRTVEDAYGYVRVRGEISQPK-RHSSGHVYLRLKDETA 65

Query: 63  RIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEK 122
            ++A+ WKG   ++   PEEG+E +  G++TT+PG S+YQ++IE++  +G G LL  LE+
Sbjct: 66  VLEAVCWKGVAARLSVRPEEGMEVVCTGRLTTYPGRSQYQLVIETMELAGEGALLKMLEE 125

Query: 123 RKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQ 182
           RK++L  EGLF+ + K P+PF+P++I V+TSPTGAVIRDIL R++ RFP  V+++PV VQ
Sbjct: 126 RKRRLAAEGLFAPERKKPLPFLPEVIGVVTSPTGAVIRDILHRLADRFPRHVLLWPVAVQ 185

Query: 183 GDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIP 242
           G+    ++A AI   N +  G   PRPD+II+ARGGGS+EDL  FN+E +VRA A S+IP
Sbjct: 186 GEGAADQVARAIAGFNAIAPGGPVPRPDLIIVARGGGSLEDLMPFNEEAVVRAAAASAIP 245

Query: 243 IISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKY 302
           +ISA+GHETD TL D+A+D RAPTPT AAEMAVPV+  L + +++   RL+  + R I  
Sbjct: 246 LISAVGHETDTTLIDFASDRRAPTPTAAAEMAVPVRTELLAQVLDDGRRLHQCLSRAIDT 305

Query: 303 KINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFL 362
           + + +  L + L +    L     RLD     LE +L   + R++     +  R++    
Sbjct: 306 RRSHVEGLGRGLGDPRALLEGCIQRLDDRAERLELSLRTGLERRHAAVQQLGIRLR--HP 363

Query: 363 IHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKK 422
              I           + +     + +             L  L    + +I      +  
Sbjct: 364 REVIGLAAARADAAGRALRAGFDRAVTVEQGRFHRVADRLSPLP--LRRQIDAGRDRLDA 421

Query: 423 LITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATK 482
           L  R+    + ++      +    ++L+S++YK  L+RG+  + D     +T+  + A  
Sbjct: 422 LPPRLAQAHARRLDQAGQRLVALGQLLESYSYKGVLERGFVLVADAEGRPVTRAADTAPG 481

Query: 483 TRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
             + + F DG   A+V   AP      +              QG LF
Sbjct: 482 QPVALRFADGTVGAVVDGAAPGASPAARTRAGKAK-----ADQGSLF 523


>gi|86748982|ref|YP_485478.1| exodeoxyribonuclease VII large subunit [Rhodopseudomonas palustris
           HaA2]
 gi|86572010|gb|ABD06567.1| Exodeoxyribonuclease VII large subunit [Rhodopseudomonas palustris
           HaA2]
          Length = 538

 Score =  407 bits (1046), Expect = e-111,   Method: Composition-based stats.
 Identities = 203/534 (38%), Positives = 304/534 (56%), Gaps = 8/534 (1%)

Query: 4   FSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSR 63
            + +   +  E++VSELS  LK  VE +  HV VRGEISG+RG HSSGH YF+LKD  ++
Sbjct: 5   LAPETLANVGEFTVSELSQALKRTVEDSYGHVRVRGEISGFRGAHSSGHCYFALKDESAK 64

Query: 64  IDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKR 123
           I+A+IWKG   ++ F P+EG+E +  GK+TT+PGSSKYQI+IE+L P+G G L+  +E+R
Sbjct: 65  IEAVIWKGVAGRMRFKPQEGLEVIATGKLTTYPGSSKYQIVIEALEPAGVGALMALMEER 124

Query: 124 KKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQG 183
           K+KL  EGLF +  K  +P++P++I V+TSPTGAVIRDIL R+  RFP RV+++PVKVQG
Sbjct: 125 KRKLGAEGLFDEARKQLLPYLPEVIGVVTSPTGAVIRDILHRLEDRFPRRVLVWPVKVQG 184

Query: 184 DECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPI 243
           +   +++A AI   N L EG   PRPD++I+ARGGGS+EDLW FN+E++VRA A S IP+
Sbjct: 185 EGSAEQVAAAIHGFNALPEGGPIPRPDLLIVARGGGSLEDLWSFNEEIVVRAAAESMIPL 244

Query: 244 ISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYK 303
           ISA+GHETD TL D+AAD RAPTPT AAEMAVPV+  L   + +   R+     R    +
Sbjct: 245 ISAVGHETDVTLIDFAADKRAPTPTAAAEMAVPVRAELFVEVQSYARRMMLCWSRGQDSR 304

Query: 304 INTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLI 363
            N L +  +ALP + + L+  R RLD     L   L       +R +    + I  + L 
Sbjct: 305 RNELRAAARALPAAGELLAIPRQRLDGAASSLPRALRANTHAHHRRYAKAASGITLNVLR 364

Query: 364 HNIQKNRQHILEKQQHIE---QIVKQHLRYIFLEKKEKIAILHMLREQTKN-RIFYLHTH 419
             +  + Q +    + ++   +   +H R  F     ++    +  EQ +  RI      
Sbjct: 365 AQVSHSAQRLGSTGERLKHCTRATLRHRRDRFESLAIRLQASKLANEQAQRMRIARERER 424

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
           + +L  R     +         +  + ++L + +Y+  L RG+  ++D + + +     +
Sbjct: 425 MLRLAERARRAWATLRDRQQARLVQSGKLLTALSYRGVLARGFALVRDADGHALHAAAAV 484

Query: 480 ATKTRILINFFDGQANAIVINKAPPKE----QPTKKCQLHNNKREKQGTQGELF 529
           +   R+ + F DG+           +       T   +    +  K   QG LF
Sbjct: 485 SAGARLSVEFADGRVGVTADGGGATRPDIAKPATPAAKPAPKRVSKPIDQGSLF 538


>gi|254485812|ref|ZP_05099017.1| exodeoxyribonuclease VII, large subunit [Roseobacter sp. GAI101]
 gi|214042681|gb|EEB83319.1| exodeoxyribonuclease VII, large subunit [Roseobacter sp. GAI101]
          Length = 491

 Score =  406 bits (1044), Expect = e-111,   Method: Composition-based stats.
 Identities = 194/530 (36%), Positives = 280/530 (52%), Gaps = 40/530 (7%)

Query: 1   MNPFSQ-KNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKD 59
           M+   +     + PE++V+ELS  +K ++ES   HV +RGE+ G      SGH Y  LKD
Sbjct: 1   MDLIDEPAPGQNSPEFTVTELSSAIKRVIESEFGHVRIRGEV-GRVSRPRSGHIYLDLKD 59

Query: 60  NHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTA 119
           + S I  +IWKG   ++E  PEEG+E +  G+ITTF G SKYQI+IE + P+G G L+  
Sbjct: 60  DASVISGVIWKGVAARLETQPEEGMEVIATGRITTFGGQSKYQIVIEDIKPAGMGALMAL 119

Query: 120 LEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPV 179
           LEKRK  L  EGLF+ + K  +P++P +I V+TSP+GAVIRDIL R+  RFP +V+I+PV
Sbjct: 120 LEKRKAALAAEGLFAPERKRALPYLPDVIGVVTSPSGAVIRDILHRLRDRFPRKVLIWPV 179

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
            VQG +C  E+A AI   N L  G   PRPD++I+ARGGGS+EDLW FN+E++ RA A S
Sbjct: 180 AVQGAKCAPEVARAIEGFNKLTFGGAIPRPDLLIVARGGGSVEDLWGFNEEIVARAAALS 239

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
            IP+ISA+GHETD TL DY +D RAPTPT AAE+AVPV+  L + L   EAR+   + + 
Sbjct: 240 EIPLISAVGHETDTTLIDYVSDKRAPTPTAAAELAVPVRHELVALLDGQEARMTRALSQG 299

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
           +  +   L  + +ALP +D  L   R R+D L   L   L   + ++     +I   ++ 
Sbjct: 300 LARRDQRLRDMARALPRADSLLDGPRQRVDVLGGRLGPALTAGVQKRKVRLANISGVLRP 359

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH 419
             L   +Q  ++ +                                 E            
Sbjct: 360 GTLTRALQSEQRRLAGLSARF------------------------RPEALVQDQKRKAEA 395

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
            + L  R+      +       ++   R+ +  +YK+TL RGY  ++  +   +T K+  
Sbjct: 396 FQSLARRLSDAGLRQTAGWRKQIAGLDRVHEMLSYKSTLARGYAVVRG-DGKLVTTKKAA 454

Query: 480 ATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
              T + I F DG+    V  KA P++   K              QG LF
Sbjct: 455 QDATSLEIEFADGRM--QVGGKAGPRKAAKK-----------PPEQGSLF 491


>gi|159045267|ref|YP_001534061.1| exodeoxyribonuclease 7 large subunit [Dinoroseobacter shibae DFL
           12]
 gi|157913027|gb|ABV94460.1| exodeoxyribonuclease 7 large subunit [Dinoroseobacter shibae DFL
           12]
          Length = 523

 Score =  405 bits (1040), Expect = e-110,   Method: Composition-based stats.
 Identities = 190/533 (35%), Positives = 282/533 (52%), Gaps = 14/533 (2%)

Query: 1   MNPFS----QKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFS 56
           M+ F      +   + PE++VSELS  +K  +E     V VRGEI G      SGH YF 
Sbjct: 1   MSDFDLIDDPQPGQNAPEFTVSELSGAIKRTLEGEFGRVRVRGEI-GRVMRAKSGHLYFD 59

Query: 57  LKDNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTL 116
           LKD  + I+   WKG ++ +  +PEEG+E +  GK++ +  +S+Y I ++ +  +G G L
Sbjct: 60  LKDARAVINCTTWKGQVSGLGVMPEEGLEVVAEGKLSAYAPASRYNINVDRISVAGIGAL 119

Query: 117 LTALEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVII 176
           +  LEKRK  L  EGLF    K P+PF+P++I V+TSP+GAVIRDIL R+  R P +V+I
Sbjct: 120 MAMLEKRKAALTAEGLFEASRKQPLPFLPEVIGVVTSPSGAVIRDILHRLRDRCPRKVLI 179

Query: 177 FPVKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAI 236
           +PV VQG  C  E+ANAI   N L  G   PRPD++I+ARGGGS+EDLW FN+E++VRA 
Sbjct: 180 WPVAVQGQNCAPEVANAIRGFNALGPGGPLPRPDLLIVARGGGSLEDLWGFNEEIVVRAA 239

Query: 237 ANSSIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNII 296
           A S IP+ISA+GHETD TL DYAAD RAPTPT AAE AVPV+  L ++L +L +R+   +
Sbjct: 240 AESDIPLISAVGHETDTTLIDYAADWRAPTPTAAAERAVPVRLDLLAALDSLGSRMLTGL 299

Query: 297 IRLIKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINR 356
              ++ +   +  L +ALP S+  LS  R RLD     L   L      K          
Sbjct: 300 TGGVRARAQRVRDLSRALPRSEDLLSTPRQRLDHATARLPAALRSATQTKRGALTQAAAV 359

Query: 357 IKSDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYL 416
           ++   L   I+  R+ +      +   + + +       + ++A L    E         
Sbjct: 360 LRPRLLAGRIEAERKDLRAASARLGAALPRAVAAQAERLRTRVARL--RGEILTQGRARD 417

Query: 417 HTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQK 476
              ++ L  R+    + ++++   ++    R+  +  Y+ TLKRGY  ++D + + +T  
Sbjct: 418 QQRLEALSARLSRAGTAQVRTWRRTLDGLDRVRATVGYEATLKRGYAVVRDQD-SIVTTA 476

Query: 477 RNLATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
              AT   + + F DG+   I      P              +     QG LF
Sbjct: 477 AAAATHPSLEVQFADGRVTVI------PNASAEGARPRKGRSKSAPDDQGSLF 523


>gi|110679217|ref|YP_682224.1| exodeoxyribonuclease VII large subunit [Roseobacter denitrificans
           OCh 114]
 gi|109455333|gb|ABG31538.1| exodeoxyribonuclease VII, large subunit, putative [Roseobacter
           denitrificans OCh 114]
          Length = 513

 Score =  405 bits (1040), Expect = e-110,   Method: Composition-based stats.
 Identities = 179/530 (33%), Positives = 280/530 (52%), Gaps = 18/530 (3%)

Query: 1   MNPFSQK-NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKD 59
           M+         + PE++VSE+S  +K  +E     V VRGE+S       SGH Y+ +KD
Sbjct: 1   MDLLDDPTPGQNTPEFTVSEISGAVKRTLEGEFGRVRVRGEVS-RVIRARSGHMYYDIKD 59

Query: 60  NHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTA 119
           + +++    WKG + ++  +PEEG+E +V G+IT +   SKY + ++ +  +G G L+  
Sbjct: 60  DRNQLACTTWKGQVARLSVIPEEGLEVVVTGRITAYGAQSKYNMNVDEVAVAGKGALMAL 119

Query: 120 LEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPV 179
           LEKRKK+L  EGLF    K P+P++P+II V+TSPTGAVIRDIL R+  RFP +V+I+PV
Sbjct: 120 LEKRKKQLQAEGLFEASRKRPLPYLPEIIGVVTSPTGAVIRDILHRLRDRFPRKVLIWPV 179

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
            VQG+ C  E+A AI   N L  G   PRPD+II+ARGGGS+EDLW FN+E + RA A S
Sbjct: 180 AVQGERCAPEVAAAIAGFNALAPGGALPRPDLIIVARGGGSVEDLWGFNEESVARAAAAS 239

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
            IP+ISA+GHETD TL DY +D RAPTPT AAE+AVPV+  L + +   +AR+   + + 
Sbjct: 240 DIPLISAVGHETDTTLIDYVSDKRAPTPTAAAELAVPVRHELIAWVEQQDARMRQALSQG 299

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
           +  +   L  + +ALP  D  L   R  +D     L   L   + R+      +   ++ 
Sbjct: 300 LTRRDQRLRDMARALPRPDSLLESPRQLVDTRGARLAPALMSGVQRRKIRLADVSGSLRP 359

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH 419
             L   +Q   + + EK + ++  + + L     + + ++          +        H
Sbjct: 360 AMLTRAVQAEDRQLKEKVRRLQPALLRALATRKEQLETRVRR--YRPAVLEQEYRRKKQH 417

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
              ++ R+  +    + +    +    R+ ++ +YK TL RG+  ++  +   +T  +  
Sbjct: 418 FDDVVHRLGKVGEQNLDAARRKLDALGRLNETLSYKATLARGFAVVR-ADGAVVTDSKTA 476

Query: 480 ATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
            T + + I F DG+     +   P   +   K             QG LF
Sbjct: 477 KTASSLEIQFADGRVT---LGGKPASRKSAGK----------PPEQGSLF 513


>gi|83955626|ref|ZP_00964206.1| exodeoxyribonuclease VII, large subunit [Sulfitobacter sp.
           NAS-14.1]
 gi|83839920|gb|EAP79096.1| exodeoxyribonuclease VII, large subunit [Sulfitobacter sp.
           NAS-14.1]
          Length = 515

 Score =  404 bits (1039), Expect = e-110,   Method: Composition-based stats.
 Identities = 195/530 (36%), Positives = 283/530 (53%), Gaps = 40/530 (7%)

Query: 1   MNPFSQ-KNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKD 59
           M+     +   + PE++V+ELS  +K ++E    HV +RGE+ G      SGH Y  LKD
Sbjct: 25  MDLIDDPREGQNSPEFTVTELSGAIKRVIEGEFGHVRIRGEV-GRVSRPRSGHIYLDLKD 83

Query: 60  NHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTA 119
           + S I  +IWKG   ++E  PEEG+E +  G+ITTF G SKYQI+IE + P+G G L+  
Sbjct: 84  DSSVISGVIWKGVSARLETQPEEGMEVIATGRITTFGGQSKYQIVIEDIKPAGMGALMAL 143

Query: 120 LEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPV 179
           LEKRK  L  EGLF+ + K P+P++P++I V+TSP+GAVIRDIL R+  RFP +V+I+PV
Sbjct: 144 LEKRKAVLAAEGLFAPERKRPLPYLPEVIGVVTSPSGAVIRDILHRLRDRFPRKVLIWPV 203

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
            VQG +C  E+A AI   N L  G   PRPD++I+ARGGGS+EDLW FN+E++ RA A S
Sbjct: 204 AVQGAKCAPEVARAIAGFNALTPGGALPRPDLLIVARGGGSVEDLWGFNEEIVARAAAAS 263

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
            IP+ISA+GHETD TL DY +D RAPTPT AAE+AVPV+  L + L   EAR+   + + 
Sbjct: 264 EIPLISAVGHETDTTLIDYVSDKRAPTPTAAAELAVPVRHELVALLDGQEARMTQALSQG 323

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
           +  +   L  + +ALP  D  L   R RLD     L   L   + ++  H + I   ++ 
Sbjct: 324 LARRDQRLRDMARALPRPDSLLDGPRQRLDMRGARLGPALTAGVQKRKVHLSDISGALRP 383

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH 419
             L  ++Q  ++ +               R                              
Sbjct: 384 ATLRRSLQAEQRRLAALADRFRPDALVQDR------------------------KRKEEA 419

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
            + L  R+      + +  H  ++   R+ +  +YK+TL RGY  ++  +   +T K+  
Sbjct: 420 FQSLARRLSDAGQRQTQGWHKQIAGLDRLHEMLSYKSTLARGYAVVRG-DGGVVTTKQAA 478

Query: 480 ATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
              + + I F DG+    +   A PK+ P K              QG LF
Sbjct: 479 LDASALEIEFIDGKMK--ISGGAAPKKTPKKAP-----------EQGSLF 515


>gi|209886360|ref|YP_002290216.1| exodeoxyribonuclease VII, large subunit [Oligotropha
           carboxidovorans OM5]
 gi|209874556|gb|ACI94352.1| exodeoxyribonuclease VII, large subunit [Oligotropha
           carboxidovorans OM5]
          Length = 486

 Score =  404 bits (1038), Expect = e-110,   Method: Composition-based stats.
 Identities = 199/529 (37%), Positives = 290/529 (54%), Gaps = 52/529 (9%)

Query: 6   QKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRID 65
            ++  +  E++VSELS  LK  VE    HV VRGEISG+RG H+SGH YF+LKD  ++I+
Sbjct: 5   SESLSNTAEFTVSELSSALKRTVEDAYGHVRVRGEISGFRGPHASGHCYFALKDESAKIE 64

Query: 66  AIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKK 125
           A+IWKG   ++   P+EG+E +  GK+TT+PGSSKYQI+IE++ P+G G L+  +E+RK+
Sbjct: 65  AVIWKGVHGRMRVKPQEGLEVIATGKLTTYPGSSKYQIVIEAIEPAGVGALMALMEERKR 124

Query: 126 KLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDE 185
           KL  EGLF D  K  +P++P++I V+TSPTGAVIRDIL R+  RFP RV+++PV+VQG+ 
Sbjct: 125 KLAAEGLFDDARKQLLPWLPEVIGVVTSPTGAVIRDILHRLHDRFPRRVLVWPVRVQGEG 184

Query: 186 CPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIIS 245
             ++IA AI   N L+EG   PRPD++I+ARGGGS+EDLW FN+E++VRA A S IP+IS
Sbjct: 185 SAEQIAAAIEGFNALEEGGAIPRPDLLIVARGGGSLEDLWSFNEEIVVRAAAGSMIPLIS 244

Query: 246 AIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKIN 305
           A+GHETD TL D+AAD RAPTPT AAEMAVPV+  L   + +L  R      R  +++ +
Sbjct: 245 AVGHETDITLIDFAADKRAPTPTAAAEMAVPVRADLAIEISSLARRAFACWQRGHEHRRS 304

Query: 306 TLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHN 365
            L    + LP     L+  R R DR   +L   L        R  + +  R+    L   
Sbjct: 305 ELRGAARGLPRLTDLLAIPRQRFDRAAAQLPRALRANTHVYDRRLSMVTGRLTVTTLRTQ 364

Query: 366 IQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLIT 425
           I ++R  +      + +I K+   +    ++ +                           
Sbjct: 365 IARSRDQV----NRLSEIAKRCSDHFIALRRNR--------------------------- 393

Query: 426 RIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRI 485
                           V  + ++L + +YK+ L RG+  ++D     +     +    RI
Sbjct: 394 ----------------VQHSAQMLAALSYKSVLSRGFALVRDEAGQPLHHAAQVGAGERI 437

Query: 486 LINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGT-----QGELF 529
            I F DG+  A     A P  +     +      +         QG+LF
Sbjct: 438 SIEFADGRIAATTHGPAVPAAKNVSPARKPAKAEKAAKPEPKKVQGDLF 486


>gi|163746079|ref|ZP_02153438.1| exodeoxyribonuclease VII, large subunit, putative [Oceanibulbus
           indolifex HEL-45]
 gi|161380824|gb|EDQ05234.1| exodeoxyribonuclease VII, large subunit, putative [Oceanibulbus
           indolifex HEL-45]
          Length = 524

 Score =  404 bits (1037), Expect = e-110,   Method: Composition-based stats.
 Identities = 191/526 (36%), Positives = 287/526 (54%), Gaps = 24/526 (4%)

Query: 1   MNPFSQ-KNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKD 59
           M+ F       + PE++V+ELS  +K ++E   +HV +RGE+ G      SGH Y  LKD
Sbjct: 1   MDLFDDPAPGANSPEFTVTELSGAIKRVIEGEFAHVRIRGEV-GRVSRPRSGHVYLDLKD 59

Query: 60  NHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTA 119
           + S I  +IWKG   ++E  PEEG+E +  G+ITTF G SKYQI+IE + P+G G L+  
Sbjct: 60  DRSVISGVIWKGVTARLETQPEEGMEVIATGRITTFGGQSKYQIVIEDIKPAGMGALMAL 119

Query: 120 LEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPV 179
           LEKRK  L  EGLF+ + K P+P++P+II V+TSP+GAVIRDIL R+  RFP +V+I+PV
Sbjct: 120 LEKRKAALAAEGLFAPERKRPLPYLPEIIGVVTSPSGAVIRDILHRLRDRFPRKVLIWPV 179

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
            VQG +C  E+  AI   N L  G   PRPD++I+ARGGGS+EDLW FN+E +VRA A S
Sbjct: 180 AVQGAKCAPEVVRAIEGFNRLTPGGALPRPDLLIVARGGGSVEDLWGFNEESVVRAAAAS 239

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
            IP+ISA+GHETD TL D+ +D RAPTPT AAE+AVPV+  L + L    AR+   + + 
Sbjct: 240 DIPLISAVGHETDTTLIDFVSDKRAPTPTAAAELAVPVRHELAAWLEGQGARMRQALSQG 299

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
           +  +   +  + +ALP +D  L   R RLDR   +L   L   +  +     H+   ++ 
Sbjct: 300 LTRRGQRMRDVARALPRADTLLEGPRQRLDRGGEKLAPALIAGVQGRRVKLAHMSGALRP 359

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILH---------MLREQTK 410
             L  ++  +RQ +      ++   +++L+      K ++   H           RE+  
Sbjct: 360 GTLRRHLDADRQRLANLSARLDPAWQRNLKGRNDFLKTRLDRFHPEVLQRQILRRRERLA 419

Query: 411 NR------------IFYLHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTL 458
           +R            +      + +++ R+              +    R L +  Y+ TL
Sbjct: 420 DRTQNFRPEVLSRDLARQDQRLTEVLARLARAGQAAQDRRRRQIDALGRTLGTLGYRETL 479

Query: 459 KRGYTSIQDTNNNFITQKRNLATKTRILINFFDGQANAIVINKAPP 504
            RG+  ++  + N +T      + TR+ I F D +   +    AP 
Sbjct: 480 ARGFAVVRG-DGNVVTSAEAAKSATRLEIEFADDRLEVLHKEDAPS 524


>gi|295690267|ref|YP_003593960.1| exodeoxyribonuclease VII large subunit [Caulobacter segnis ATCC
           21756]
 gi|295432170|gb|ADG11342.1| exodeoxyribonuclease VII, large subunit [Caulobacter segnis ATCC
           21756]
          Length = 510

 Score =  404 bits (1037), Expect = e-110,   Method: Composition-based stats.
 Identities = 179/535 (33%), Positives = 278/535 (51%), Gaps = 31/535 (5%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M   +  N  + P YSVSEL++ LK  +E     V +RGE+S     HS+GH Y ++KD+
Sbjct: 1   MTDLAP-NDSNAPPYSVSELAFALKRTLEDRYGFVRLRGELSKVTH-HSNGHVYLTIKDD 58

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            + ID ++WKG +  +   PE G+E +V GKITT+P  S+YQI+I+S+  +G G LL  L
Sbjct: 59  KAAIDGVVWKGNVRGLGVRPEHGLEVIVTGKITTYPAGSRYQIVIDSMEAAGVGALLAQL 118

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           E+ K KL  EGLF+ + K P+P +P ++ VITSPTGAVIRDIL RI  R+P +V+++PV 
Sbjct: 119 ERLKAKLAAEGLFAPERKRPLPSMPAVVGVITSPTGAVIRDILHRIRDRWPCQVLVWPVV 178

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQGD    +++ A+   N ++ G   PRPDI+I+ARGGGS+EDLW FNDE + R +A S+
Sbjct: 179 VQGDAAAAQVSAAVRGFNAIQPGGPVPRPDILIVARGGGSVEDLWAFNDEALARTVAESA 238

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP+ISA+GHETD TL D+ +D RAPTPT AAEMA PV   L++ + + + RL+    R I
Sbjct: 239 IPLISAVGHETDTTLIDFVSDRRAPTPTAAAEMATPVLGELRALISDFDRRLSRCGARTI 298

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           + +   L S  + LP  +  L+ ++ R D     L+  L        +    +  R+  D
Sbjct: 299 EERRTRLTSAARGLPRPNDLLALAQQRFDMASGRLDAALHRNTAVHAQDLLKVTARLTPD 358

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420
            L          + +  + +     + +  +    +                       +
Sbjct: 359 ALRRQHAAKADRVADLGRRLNACGTRSVERVRDHAR-----------------------L 395

Query: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480
             L TR+      ++      ++   ++  S   +  L+ G+  ++  +   I     LA
Sbjct: 396 PLLWTRLGSAAERRLTRAEDQLTNLDKLRLSLNPRRPLELGFALVRKADGTIIRSAGALA 455

Query: 481 TKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQG------TQGELF 529
               + + F DG+  A++ N+APP                +         QG+LF
Sbjct: 456 LGDHVALQFADGEREAVIGNEAPPSASTPSASTPPRPSPPRPKPAPSSTEQGDLF 510


>gi|254474563|ref|ZP_05087949.1| exodeoxyribonuclease VII, large subunit [Ruegeria sp. R11]
 gi|214028806|gb|EEB69641.1| exodeoxyribonuclease VII, large subunit [Ruegeria sp. R11]
          Length = 521

 Score =  403 bits (1036), Expect = e-110,   Method: Composition-based stats.
 Identities = 185/541 (34%), Positives = 278/541 (51%), Gaps = 39/541 (7%)

Query: 2   NPFS-QKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           +P    +   + PE++VSE+S  +K  +E     + V+GE+ G      SGH Y+ +KD+
Sbjct: 7   DPAPSDRPGQNAPEFTVSEISGEVKRTLEGTFGRIRVKGEV-GRVFKARSGHLYYDIKDD 65

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            S +    WKG ++ +  +PEEG+E +V G++T F G SKY + ++ +  +G G L+  L
Sbjct: 66  RSVLACTTWKGQISSLSVVPEEGLEVVVTGRLTAFGGQSKYNMNVDEVAVAGQGALMALL 125

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           EKRKK+L  EGLF+ + K P+P++P+II V+TSP+GAVIRDIL R+  RFP +V+++PV 
Sbjct: 126 EKRKKQLESEGLFAPERKKPLPYLPQIIGVVTSPSGAVIRDILHRLRDRFPRKVLVWPVA 185

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQG  C  E+A AI   N L  G   PRPD+II+ARGGGSIEDLW FN+E++ RA A S 
Sbjct: 186 VQGANCAAEVARAIDGFNQLTPGGALPRPDLIIVARGGGSIEDLWGFNEEIVARAAAGSQ 245

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP+ISA+GHETD TL D+ +D RAPTPT AAE+AVPV+  L   +    ARL     + +
Sbjct: 246 IPLISAVGHETDTTLIDFVSDRRAPTPTAAAELAVPVRLELLGWVEQQGARLTRGAGQAV 305

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           + +   LN L +ALP  D  L   R RLD++   L   L   + R+    +     ++  
Sbjct: 306 QIRRQRLNDLSRALPKPDTLLETPRQRLDQVSYRLPDALIRGVDRRRLKLSEAAASLRPA 365

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420
            L   +Q  R  +      +                             +  +      +
Sbjct: 366 TLRQLVQGRRDGLKNLSSRLS------------------------LRPIEREVARQGDRL 401

Query: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480
            +L  R+  + S +++     +  T R L+  +YK TL RGY  ++  ++  +T+     
Sbjct: 402 TQLAQRMNALQSQRLQQARRGLDATGRQLEILSYKATLDRGYAVVRHGSD-VVTRAAGAR 460

Query: 481 TKTRILINFFDGQANA----------IVINKAPPKEQPTKKCQLHNN--KREKQGTQGEL 528
               + I F DG+              V         P+K           +  G QG L
Sbjct: 461 GADHLRIEFADGEIAVHPDGSDAGAKTVQQSTAQTSAPSKPAARKPKADPGQDDGGQGTL 520

Query: 529 F 529
           F
Sbjct: 521 F 521


>gi|257464609|ref|ZP_05628980.1| exodeoxyribonuclease VII large subunit [Actinobacillus minor 202]
 gi|257450269|gb|EEV24312.1| exodeoxyribonuclease VII large subunit [Actinobacillus minor 202]
          Length = 486

 Score =  401 bits (1030), Expect = e-109,   Method: Composition-based stats.
 Identities = 138/492 (28%), Positives = 251/492 (51%), Gaps = 12/492 (2%)

Query: 12  HPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKG 71
           +   +V++L+Y ++H++E+ L  + + GEIS +     SGH Y +LKD ++++   ++K 
Sbjct: 2   NNILTVTQLNYSVRHLLETELGQIWLTGEISNF-SQPVSGHWYLTLKDENAQVRCAMFKM 60

Query: 72  TLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEG 131
             +++ F P+ G++ LV   ++ +     YQ+IIES+ P+G G L    E+ K KL  +G
Sbjct: 61  KNSRVTFYPQNGMQVLVRASVSLYEPRGDYQLIIESMQPAGEGLLQQQFEQLKMKLAAQG 120

Query: 132 LFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEI 190
           LF+ +HK  +P   K + +ITS +GA ++DIL  +  R P L V+I+P  VQG E  ++I
Sbjct: 121 LFAQEHKKALPDFVKRVGIITSSSGAALQDILNILKRRDPSLAVVIYPTLVQGKEATQDI 180

Query: 191 ANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHE 250
              I   N  +E       D++I+ RGGGS+EDLW FN+E +  AI  S IPIISA+GHE
Sbjct: 181 VQTIDLANRRQE------CDVLIVGRGGGSLEDLWCFNEEAVAYAIYRSEIPIISAVGHE 234

Query: 251 TDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSL 310
           TD T+AD+ ADLRAPTP+ AAE+    ++ L   L +    +N    R+   K+     L
Sbjct: 235 TDVTIADFVADLRAPTPSAAAELVSRDQQELIRQLQHHFNMVNLAFDRIWHEKLTHFQQL 294

Query: 311 LKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQK 368
              L   +  + L   + R ++L   +E +++ ++  ++     +  R++       +  
Sbjct: 295 NLRLNAQHPSKYLHVFKIRFEQLAYRMEKSVKSLLSTRHNQLTQVFLRLQPHHPKRKLDV 354

Query: 369 NRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIE 428
            R+ + +++  + Q + Q+L     + +     +         +I     +I  L  ++ 
Sbjct: 355 QREQLAQREGRLHQQMSQYLSRKKQDWENLTKRIESSP--LPYQIGKRQQYIAHLAQQLN 412

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
           + +  +    +         L   +    L RGY+  Q +  + +T  + +A   +++  
Sbjct: 413 YAMDKRYLKEYQRFQALCTRLDGLSPLKILGRGYSITQTSKGHILTNAKEVAVGDKLITQ 472

Query: 489 FFDGQANAIVIN 500
              GQ  + V+ 
Sbjct: 473 LETGQIISEVVE 484


>gi|119386735|ref|YP_917790.1| exodeoxyribonuclease VII, large subunit [Paracoccus denitrificans
           PD1222]
 gi|119377330|gb|ABL72094.1| Exodeoxyribonuclease VII large subunit [Paracoccus denitrificans
           PD1222]
          Length = 519

 Score =  401 bits (1030), Expect = e-109,   Method: Composition-based stats.
 Identities = 190/533 (35%), Positives = 280/533 (52%), Gaps = 18/533 (3%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M  F    + +  E++VSE+S  +K ++E     V VRGEI G     SSGH YF LKD+
Sbjct: 1   MELFEDTPASNAHEFTVSEISGAVKRVLEGEFGRVRVRGEI-GRVSRPSSGHLYFDLKDD 59

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            + I A+ WKG   ++   PEEGIE +  G++TTFPG SKYQ+I+E + P+G+G L+  L
Sbjct: 60  RAVIAAVTWKGQAARLSTRPEEGIEVIATGRLTTFPGQSKYQLIVEEIEPAGAGALMMML 119

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           EK +K L  EGLF +  K P+P++P++I V+TSP+GAVIRDIL R+  RFP  V+I+PV 
Sbjct: 120 EKCRKALAAEGLFDESRKRPLPYLPRVIGVVTSPSGAVIRDILHRLRDRFPTHVLIWPVA 179

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQG+ C  ++  AI   N L      PRPD+II+ARGGGS+EDLW FN+E +VRA A+S 
Sbjct: 180 VQGEGCASQVTAAIRGFNALPSDGPLPRPDLIIVARGGGSLEDLWGFNEEAVVRAAADSL 239

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP+ISA+GHETD TL D+A+D RAPTPT AAEMAVPV+  L + L  ++AR+        
Sbjct: 240 IPLISAVGHETDTTLIDFASDRRAPTPTAAAEMAVPVRAELAARLTEIQARMMRAAQTRN 299

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           + +   L+ L +AL       + +R R D     LE  L   +  +    N +   +   
Sbjct: 300 QRQRQRLSDLGRALGRPQALTAPARQRFDLFAERLEPALRGFVRARRDRLNAL--PLSLS 357

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQ----TKNRIFYL 416
            L   ++  R  +  + Q +   + +  +       +  + L   R +       +I   
Sbjct: 358 ALRAMLRNRRDALQAQAQRLPLCLARLGQRRSERLTDLGSRLERARARMLADAARQIVRD 417

Query: 417 HTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQK 476
              + +L  R+       +     ++    R+ Q+  Y+ TL+RG+  +   +   +T  
Sbjct: 418 RGTLDRLAARLSAAGGRLLAPRRDALERLDRLRQTLGYRETLRRGFAVVHGPSG-LLTHA 476

Query: 477 RNLATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
              A   R  I F DG+  A           P         K  +   Q  LF
Sbjct: 477 AEAAQTPRFEIEFLDGRMAAR----------PDAPPAKPARKPREPKGQKSLF 519


>gi|16126485|ref|NP_421049.1| exodeoxyribonuclease large subunit [Caulobacter crescentus CB15]
 gi|221235265|ref|YP_002517702.1| exodeoxyribonuclease VII large subunit [Caulobacter crescentus
           NA1000]
 gi|22095679|sp|Q9A649|EX7L_CAUCR RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|254783694|sp|B8GYM1|EX7L_CAUCN RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|13423755|gb|AAK24217.1| exodeoxyribonuclease large subunit [Caulobacter crescentus CB15]
 gi|220964438|gb|ACL95794.1| exodeoxyribonuclease VII large subunit [Caulobacter crescentus
           NA1000]
          Length = 505

 Score =  401 bits (1030), Expect = e-109,   Method: Composition-based stats.
 Identities = 174/530 (32%), Positives = 277/530 (52%), Gaps = 26/530 (4%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M+     +S + P YSVSEL++ LK  +E     V +RGE+S     HS+GH Y ++KD+
Sbjct: 1   MSDLPPTDS-NAPPYSVSELAFALKRTLEDRYGFVRLRGELSKVTH-HSNGHVYLTIKDD 58

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            S ID ++WKG +  +   PE G+E +V GKITT+P  S+YQI+I+S+  +G G LL  L
Sbjct: 59  KSAIDGVVWKGNVRGLGVRPEHGLEVIVTGKITTYPAGSRYQIVIDSMEAAGVGALLAQL 118

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           E+ K KL  EGLF+ + K P+P +P ++ VITSPTGAVIRDIL RI  R+P +V+++P  
Sbjct: 119 ERLKAKLAAEGLFAPERKRPLPSMPAVVGVITSPTGAVIRDILHRIRDRWPCQVLVWPCV 178

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQGD    +++ AI   N ++ G   PRPD++I+ARGGGS+EDLW FNDE + R +A  +
Sbjct: 179 VQGDAAAGQVSAAIRGFNAIQPGGPVPRPDVLIVARGGGSVEDLWAFNDEGLARTVAEGT 238

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP+ISA+GHETD TL D+ +D RAPTPT AAEMA PV   L++ + +L+ RLN    R I
Sbjct: 239 IPLISAVGHETDTTLIDFVSDRRAPTPTAAAEMATPVLAELRALISDLDRRLNRCGARTI 298

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           + +   L S  + LP  +  L+ ++ R D     L+  L+       +    +  R+  +
Sbjct: 299 EERRTRLVSAARGLPRPNDLLALAQQRFDIASGRLDAALDRNTTVHAQSLLKVTARLTPE 358

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420
            L        + + +  + ++   ++    +    +                       +
Sbjct: 359 ALGRQRAVKAERLADLSRRLDLAARRAPDRVAQHAR-----------------------L 395

Query: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480
             L  R+      +++     +    ++ QS   +  L+ G+  ++  +        +L 
Sbjct: 396 PALWDRLNAAGQRRLQRDADRLENLEKLRQSLNPERPLELGFALVRKGDGTLARSAADLV 455

Query: 481 TKTRILINFFDGQANAIVI-NKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
           +  R+ + F  G  +A++     P         +           QG+LF
Sbjct: 456 SGERVNLKFKSGDRDAVIDGEGGPAPAPTAPAPKPRPKPAAPPAGQGDLF 505


>gi|114328962|ref|YP_746119.1| exodeoxyribonuclease VII large subunit [Granulibacter bethesdensis
           CGDNIH1]
 gi|114317136|gb|ABI63196.1| exodeoxyribonuclease VII large subunit [Granulibacter bethesdensis
           CGDNIH1]
          Length = 543

 Score =  400 bits (1028), Expect = e-109,   Method: Composition-based stats.
 Identities = 170/523 (32%), Positives = 271/523 (51%), Gaps = 11/523 (2%)

Query: 11  DHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           + PEYSVS+LS  +K  +E     V VRGE++  +    SGH Y SLKD   +I  ++WK
Sbjct: 25  NIPEYSVSDLSGTIKRTLEGAFGRVRVRGELTEVKRYP-SGHIYLSLKDEGGKIAGVVWK 83

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
             + ++  LPE G+E +  GKI+++   S YQ+II+ +  +G+G LL  +E  +++L EE
Sbjct: 84  FAVPRLGMLPENGVEVVATGKISSYADRSSYQLIIDRMEYAGAGALLARIEMLRQRLAEE 143

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEI 190
           GLF    K  +P +P+++ V++S  GAV++DI   I+ RFP  V+++PV VQG+    +I
Sbjct: 144 GLFDAARKRALPRLPRVVGVVSSEKGAVLQDIRTTIARRFPRTVLLWPVPVQGEGAAAKI 203

Query: 191 ANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHE 250
           A AI     L      PRPD++I+ARGGGS+EDL  FN+E+++RA A   IP+ISA+GHE
Sbjct: 204 AAAIDGFGRLPPDGPVPRPDVLIVARGGGSLEDLMAFNEEIVIRAAAACPIPVISAVGHE 263

Query: 251 TDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSL 310
           TD TL DYA+D RAPTPT AAE+AVP++  L + L +  ARL   + R+ +     L   
Sbjct: 264 TDTTLIDYASDRRAPTPTAAAELAVPMRAELTADLAHKTARLGGALSRMTQGAWLGLAQA 323

Query: 311 LKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNR 370
            + LP+    L  +R RLD     L   L  ++  +     +    ++     H I + R
Sbjct: 324 ERLLPDLPTLLGHARQRLDDRSLRLGMALPGLLAARRAGLRNAA--LRLPRPAHIITQTR 381

Query: 371 QHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFI 430
           QH+   +  +   +   L +     +     L       ++ +       + L  R+   
Sbjct: 382 QHLRGAENSLRVAMPMLLAHKRSALRLHALRLGA---SLRHSLHLHLGDARPLFVRMRAA 438

Query: 431 -LSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINF 489
            L  +++     +      L+S +Y+  L RGY  + D + + +TQ   +A+   + + F
Sbjct: 439 PLPGRLREAQARLDGLCARLESVSYQAVLARGYALVLDHDGHAVTQAARIASGQILTLRF 498

Query: 490 FDGQANAIVI----NKAPPKEQPTKKCQLHNNKREKQGTQGEL 528
            DG+             PP    T   +    K+     QG+L
Sbjct: 499 SDGEKTVQATHNPAGSTPPAGNDTASVKRTARKKSGPQKQGDL 541


>gi|188583526|ref|YP_001926971.1| exodeoxyribonuclease VII, large subunit [Methylobacterium populi
           BJ001]
 gi|179347024|gb|ACB82436.1| exodeoxyribonuclease VII, large subunit [Methylobacterium populi
           BJ001]
          Length = 548

 Score =  400 bits (1028), Expect = e-109,   Method: Composition-based stats.
 Identities = 199/535 (37%), Positives = 276/535 (51%), Gaps = 61/535 (11%)

Query: 9   SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAII 68
             + PE+SV +L+  LK  +E    HV +RGEISGYRG H SGHAYFSLKD  ++IDA++
Sbjct: 61  QANAPEWSVGDLAAALKRTLEDAFGHVRLRGEISGYRGPHGSGHAYFSLKDGSAKIDAVV 120

Query: 69  WKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLL 128
           WKG L ++   P+EG+E +  GKITTF G S YQI+I+S+ P+G G  +  LE+RK+ L 
Sbjct: 121 WKGVLGRLRQKPKEGLEVVATGKITTFAGKSSYQIVIDSMEPAGIGAWMALLEERKRLLA 180

Query: 129 EEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPK 188
            EGLF  + K PIPF+P+++ V+TSPTGAVIRDIL R+  RFP  V+++PV+VQG+    
Sbjct: 181 AEGLFEAERKRPIPFLPRVVGVVTSPTGAVIRDILHRLEDRFPRPVLVWPVRVQGEGAAD 240

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           EIA AI   N L  G   PRPD++I+ARGGGSIEDLW FN+E +VRA A S IP+ISA+G
Sbjct: 241 EIAAAIRGFNALIPGGPIPRPDVLIVARGGGSIEDLWAFNEEAVVRAAAESGIPLISAVG 300

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HETD TL D+A+D RAPTPTGAAEMAVPV+  L + + +L AR    ++R I+ +     
Sbjct: 301 HETDTTLIDFASDRRAPTPTGAAEMAVPVRAELLAQIHDLGARQAGTMLRRIERERADFR 360

Query: 309 SLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQK 368
           +L++A+P +D  L+  R RLD     L   L           N + +R+        + +
Sbjct: 361 ALVRAIPGADAFLAAKRQRLDLADARLRPALAANARDSRERLNRLADRLTRRSPAIALAE 420

Query: 369 NRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIE 428
            R  +                                                       
Sbjct: 421 ARARLAGIDHRPRTA--------------------------------------------- 435

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
             ++  I+     +     +L + +YK  L RGY  ++D +   +      A   R+ + 
Sbjct: 436 --IARIIERRRDRLGAQAGLLGALSYKAVLARGYALVRDADGLPVRSSEAAAAAARLQLQ 493

Query: 489 FFDGQANAIVI----NKAPPKEQPTKKCQLHNNKRE----------KQGTQGELF 529
           F DG   A          PP     K+                       QG LF
Sbjct: 494 FADGAVFARPEEGPAEIPPPPASRPKRAPRRAAPEPARTAAEAVSEPAARQGSLF 548


>gi|260433213|ref|ZP_05787184.1| exodeoxyribonuclease VII, large subunit [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260417041|gb|EEX10300.1| exodeoxyribonuclease VII, large subunit [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 516

 Score =  400 bits (1027), Expect = e-109,   Method: Composition-based stats.
 Identities = 181/531 (34%), Positives = 269/531 (50%), Gaps = 36/531 (6%)

Query: 1   MNPFSQKN--SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLK 58
           M+          + PEY+VSE+S  +K  +E     + VRGE+ G      SGH Y+ +K
Sbjct: 20  MSDLLDDPIPGQNTPEYTVSEISGEVKRTLEGTFGRIRVRGEV-GRVFKARSGHLYYDIK 78

Query: 59  DNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLT 118
           D+ + +    WKG +  +  +PEEG+E +V G++T F   SKY + ++ +  +G G L+ 
Sbjct: 79  DDRNVLACTTWKGQIAGLSVVPEEGLEVVVTGRLTAFGAQSKYNMNVDEVAVAGQGALMA 138

Query: 119 ALEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFP 178
            LEKRKK+L  EGLF+ + K P+PF+P+II V+TSP+GAVIRDIL R+  RFP +V+I+P
Sbjct: 139 LLEKRKKQLESEGLFAPERKKPLPFLPQIIGVVTSPSGAVIRDILHRLRDRFPRKVLIWP 198

Query: 179 VKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIAN 238
           V VQG  C  E+ANAI   N L  G   PRPD+II+ARGGGSIEDLW FN+E++ RA A 
Sbjct: 199 VAVQGANCASEVANAIRGFNRLAPGGALPRPDLIIVARGGGSIEDLWGFNEEIVARAAAA 258

Query: 239 SSIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIR 298
           S IP+ISA+GHETD TL DY +D RAPTPT AAE+AVPV+  L +      ARL+     
Sbjct: 259 SEIPLISAVGHETDTTLIDYVSDRRAPTPTAAAELAVPVRMELLAWTGEQGARLSRAATD 318

Query: 299 LIKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIK 358
            ++ +   L  L +ALP  +  L   R RLD +   L   L+  +  +      +   ++
Sbjct: 319 AVQRRAQRLRDLSRALPRPETLLDGPRQRLDLIADRLAPALQRGVQNRRLQVVELSGHLR 378

Query: 359 SDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHT 418
              L + +   R  +      +                             +  I     
Sbjct: 379 PSTLRNLVAARRDTLRNLSSRLS------------------------IRPIQRDIQQQRD 414

Query: 419 HIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRN 478
            + +L  R+    + ++      +  T R+ ++ +YK TL+RGY  +   +   +T K  
Sbjct: 415 RVNQLAQRMTAAQTLRVDRLRQQLDATDRLRETLSYKATLQRGYAVVHSESG-VVTTKAQ 473

Query: 479 LATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
            +    + I F DG+   +                     +     QG LF
Sbjct: 474 ASKHAALTIEFADGELKTV--------PLSGTTPTAKKPSKPPAPDQGSLF 516


>gi|254460102|ref|ZP_05073518.1| exodeoxyribonuclease VII, large subunit [Rhodobacterales bacterium
           HTCC2083]
 gi|206676691|gb|EDZ41178.1| exodeoxyribonuclease VII, large subunit [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 520

 Score =  400 bits (1027), Expect = e-109,   Method: Composition-based stats.
 Identities = 185/531 (34%), Positives = 283/531 (53%), Gaps = 13/531 (2%)

Query: 1   MNPFSQKN--SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLK 58
           M+          + PE++VSE+S  +K  +E    HV +RGE+ G      SGH YF +K
Sbjct: 1   MSDLIDDPREGANEPEFTVSEISSAVKRTIEGTFDHVRIRGEV-GRVVHARSGHLYFDIK 59

Query: 59  DNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLT 118
           D+ S +    WKG + K+  +PEEG+E +  G++TTFPG SKYQ+ ++ +  +G G L+ 
Sbjct: 60  DDRSVLGCTAWKGQVAKLTVMPEEGMEIIATGRLTTFPGQSKYQMNVQDVAVAGEGALMA 119

Query: 119 ALEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFP 178
            LEKRKKKL  EG+F  + K  IPF+P++I V+TSPTGAVIRDIL R+  RFP +V+I+P
Sbjct: 120 MLEKRKKKLKAEGIFDPERKQNIPFLPEVIGVVTSPTGAVIRDILHRLRDRFPRKVLIWP 179

Query: 179 VKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIAN 238
           V VQG+ C  E+  AI   N    G   PRPD+II+ARGGGSIEDLW FN+E++ RA A 
Sbjct: 180 VAVQGERCAPEVTRAIDGFNAFTPGGALPRPDLIIVARGGGSIEDLWGFNEEIVARAAAG 239

Query: 239 SSIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIR 298
           S+IP+ISA+GHETD TL D+A+D RAPTPT AAE AVPV+  L + L   E R  + +  
Sbjct: 240 SAIPLISAVGHETDTTLIDFASDHRAPTPTAAAERAVPVRAELLARLEETEGRRISAMRA 299

Query: 299 LIKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIK 358
            + ++   L  L +ALP  +  L+ S+ RLD     L + L   I       +     ++
Sbjct: 300 ALNHRGEKLRDLSRALPRREALLAHSQQRLDLASARLPNALMARINLGRTGLSQASGALR 359

Query: 359 SDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHT 418
              L  +++ + + + ++   +   +++      ++ +           +   +I     
Sbjct: 360 PSLLSRSLEASSERVKDRAVRLAPALERKRTTAAIDLQNLSKRFDA--TRVDAQIELRRQ 417

Query: 419 HIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRN 478
            +  ++ R +     +       +    R+  +  YK TL RGY  ++  + + +T ++ 
Sbjct: 418 KLSDVLHRFKQAAHAQQDQQTRKLDALDRLRLTLGYKATLDRGYAVVRSADGDVLTTQKA 477

Query: 479 LATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
             +   + I F DG  N  +    P K   T   +           QG LF
Sbjct: 478 AKSHVALDIEFADGTLN--IGTGRPAKPAKTATVKT------DPKDQGSLF 520


>gi|254441004|ref|ZP_05054497.1| exodeoxyribonuclease VII, large subunit [Octadecabacter antarcticus
           307]
 gi|198251082|gb|EDY75397.1| exodeoxyribonuclease VII, large subunit [Octadecabacter antarcticus
           307]
          Length = 515

 Score =  399 bits (1025), Expect = e-109,   Method: Composition-based stats.
 Identities = 176/530 (33%), Positives = 269/530 (50%), Gaps = 18/530 (3%)

Query: 1   MNPFSQKNSL-DHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKD 59
           M+   +  +  + PE++VSELS  +K  +E    HV VR E+ G      SGH YF LKD
Sbjct: 3   MDLIDEPEAAGNTPEFTVSELSGAVKRTIEGEFGHVRVRAEV-GRVTHARSGHLYFDLKD 61

Query: 60  NHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTA 119
           + + +    WKG +  +  +PEEG+E +V G++TTF   SKYQ+    +  +G G L+  
Sbjct: 62  DRNVLACTTWKGQVADLSVIPEEGMEVVVKGRMTTFGSQSKYQLNATEVAVAGVGALMAM 121

Query: 120 LEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPV 179
           L+KRKK L  EGLF  + K  +PF+P +I VITSPTGAVIRDIL R+  RFP +VI++PV
Sbjct: 122 LDKRKKALEAEGLFGAERKQALPFLPDVIGVITSPTGAVIRDILHRLRDRFPRKVIVWPV 181

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
            VQG +C  ++A AI   N +  G   PRPD+II+ARGGGSIEDLW FN+E++ RA A S
Sbjct: 182 AVQGKDCAPQVARAIDGFNAMTSGGALPRPDLIIVARGGGSIEDLWGFNEEIVARATAAS 241

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
           +IP+ISA+GHETD TL D+ +D RAPTPT AAEMAVPV+  L  ++  + AR +  +   
Sbjct: 242 TIPLISAVGHETDTTLIDFVSDQRAPTPTAAAEMAVPVRLELMVAVDQMGARASRAVTDG 301

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
           +  +   +  L + LP  +Q    ++ R D L  +L+  L   +             ++ 
Sbjct: 302 VTRRKQRVADLARVLPKPEQLTEDAKQRFDYLSEKLDAALIGRVTEGRLRMGEASGLLRP 361

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH 419
             L++ + + R+ +      +   + +       +   +   L                 
Sbjct: 362 SVLVNRLAQGRERMSGLDARLGPALGRKAAQAQRDLDGQARRLRPDVLAVAQ--TRAAKD 419

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
              ++ R+      + +   + +    R+ ++  Y+ TLKRGY  ++  +   +T  +  
Sbjct: 420 FAVMLRRMTTASRTQTQKQRSRLEALDRMRETLGYRETLKRGYAVVRG-DGAVVTSAKAA 478

Query: 480 ATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
              T + I F DG                          +     QG LF
Sbjct: 479 KAATTLDIEFADGTM-------------APAGKPAKLKVKTPPPDQGSLF 515


>gi|192973054|gb|ACF06953.1| exodeoxyribonuclease VII large subunit [uncultured Roseobacter sp.]
          Length = 517

 Score =  399 bits (1025), Expect = e-109,   Method: Composition-based stats.
 Identities = 176/531 (33%), Positives = 273/531 (51%), Gaps = 16/531 (3%)

Query: 1   MNPFSQKN--SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLK 58
           M+          + PE++VSE+S  +K  +E+    + V+GE+ G      SGH YF +K
Sbjct: 1   MSDLIDDPRLGENAPEFTVSEISGAVKRTLEAEFGRIRVKGEV-GRVVQARSGHMYFDVK 59

Query: 59  DNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLT 118
           D  + +    WKG ++K+  LPEEG+E +V GK+T+F G SKY + ++ +  +G G L+ 
Sbjct: 60  DERNALACTTWKGQVSKLSVLPEEGMEVVVSGKMTSFGGQSKYNLNVDDVAVAGVGALMA 119

Query: 119 ALEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFP 178
            LEKRK  L  EGLF    K  +PF+P +I V+TSPTGAVIRDIL R+  RFP +V+++P
Sbjct: 120 MLEKRKTALAAEGLFDPARKQALPFLPDVIGVVTSPTGAVIRDILHRLRDRFPRKVLVWP 179

Query: 179 VKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIAN 238
           V VQG  C  E+A AI   N +  G   PRPD++I+ARGGGSIEDLW FN+E++ RA A 
Sbjct: 180 VAVQGANCAAEVARAIAGFNAMTPGGALPRPDLLIVARGGGSIEDLWGFNEEIVARAAAA 239

Query: 239 SSIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIR 298
           S IP+ISA+GHETD TL D+ +D+RAPTP+ AAE+AVPV+  L +      AR    +  
Sbjct: 240 SEIPLISAVGHETDTTLIDFVSDMRAPTPSAAAELAVPVRLDLLAETRAKGARAAQGLAN 299

Query: 299 LIKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIK 358
           ++  +   L  + +ALP  D     ++ RLD     L   L  ++ ++         +IK
Sbjct: 300 IMARRKQRLADVSRALPRPDSLTQTAQQRLDHWEGRLPLGLRSLVQKQQLRLTASAGQIK 359

Query: 359 SDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHT 418
              L   + +  + +    Q +   + +    +   +  +     +       R+  L  
Sbjct: 360 PSALGRILVQEARQLQALGQRLPAGLDRA--ALSARQMLRACASRLRPAPLAERVARLRK 417

Query: 419 HIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRN 478
            +  L TR+E     +++     +    R+ ++  Y+ TL+RGY  ++      IT    
Sbjct: 418 DLDDLETRLEQTFERQLQRRREQLVACDRLRETLGYRETLRRGYAVVRSGQ-ALITNVAK 476

Query: 479 LATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
                 + I F DG+               +   +     +     QG+LF
Sbjct: 477 AEAAKSLEIEFADGRFAV----------GQSTAARPAGRAKPTPPEQGQLF 517


>gi|83950855|ref|ZP_00959588.1| exodeoxyribonuclease VII, large subunit [Roseovarius nubinhibens
           ISM]
 gi|83838754|gb|EAP78050.1| exodeoxyribonuclease VII, large subunit [Roseovarius nubinhibens
           ISM]
          Length = 519

 Score =  398 bits (1023), Expect = e-108,   Method: Composition-based stats.
 Identities = 184/531 (34%), Positives = 273/531 (51%), Gaps = 14/531 (2%)

Query: 1   MNPFSQKN--SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLK 58
           M+          + PEY+VSE+S  +K  +E N   V VRGE+ G      SGH Y+ +K
Sbjct: 1   MSDLIDDPLPGQNMPEYTVSEISGEVKRTLEGNFGRVRVRGEV-GRVFKARSGHLYYDVK 59

Query: 59  DNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLT 118
           D+ + +    WKG +  +   PEEG+E +V G++T F   SKY + ++ +  +G G L+ 
Sbjct: 60  DDKNVLACTTWKGQVAGLSVEPEEGLEVVVTGRLTAFGAQSKYNLNVDEVAVAGQGALMA 119

Query: 119 ALEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFP 178
            LEKR+K L  EGLF +  K PIP++P+II V+TSP+GAVIRDIL R+  RFP +V+I+P
Sbjct: 120 LLEKRRKALAAEGLFDEGRKRPIPYLPEIIGVVTSPSGAVIRDILHRLRDRFPRKVLIWP 179

Query: 179 VKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIAN 238
           V VQG     E+A AI   N L  G   PRPD+II+ARGGGSIEDLW FN+E++VRA A 
Sbjct: 180 VAVQGQSSAAEVARAIAGFNALTPGGALPRPDLIIVARGGGSIEDLWGFNEEIVVRAAAA 239

Query: 239 SSIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIR 298
           S IP+ISA+GHETD TL D+A+D RAPTPT AAE+AVPV+  L + L    ARL++ +  
Sbjct: 240 SEIPLISAVGHETDTTLIDFASDKRAPTPTAAAELAVPVRLDLLAWLDGQSARLSHALSS 299

Query: 299 LIKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIK 358
            ++ +   L  L +ALP  D  L   R RLD     L   L   +  +    +     ++
Sbjct: 300 GVERRGQRLRDLGRALPRVDSLLDGPRQRLDVWGERLPAALIRSVQMRRVRLSDAAGALR 359

Query: 359 SDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHT 418
              L   ++   Q + +  + +   +               A    +  +    +     
Sbjct: 360 PAALRGKLRDQGQRLTQTGERLGHALGARTERGRERYDAMSARFGRV--EPHEALQRRRE 417

Query: 419 HIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRN 478
            + +L  R   + + +IK     +    R+ ++ +YK TL+RGY  ++  + + I     
Sbjct: 418 DLTRLSDRFGQVGARQIKDWRDRLDALDRLRETLSYKATLERGYAVVRG-DGDLIKSAAA 476

Query: 479 LATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
                 + I F DG             +      +     +   G QG LF
Sbjct: 477 AGRAQNLEIEFADG--------VHKVGQPGAPAPKKPAKPQTPPGDQGSLF 519


>gi|99081786|ref|YP_613940.1| exodeoxyribonuclease VII large subunit [Ruegeria sp. TM1040]
 gi|122397774|sp|Q1GF88|EX7L_SILST RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|99038066|gb|ABF64678.1| Exodeoxyribonuclease VII large subunit [Ruegeria sp. TM1040]
          Length = 502

 Score =  398 bits (1022), Expect = e-108,   Method: Composition-based stats.
 Identities = 188/531 (35%), Positives = 272/531 (51%), Gaps = 31/531 (5%)

Query: 1   MNPFSQKNS--LDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLK 58
           M+      +   + PE+SVSE+S  +K  +E     + VRGE+ G      SGH Y+ +K
Sbjct: 1   MSDLLDDPTPGQNAPEFSVSEISGEVKRTLEGTFGRIRVRGEV-GRVFKARSGHLYYDIK 59

Query: 59  DNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLT 118
           D+ S +    WKG ++ +  +PEEG+E +V G++T F G SKY + ++ +  +G G L+ 
Sbjct: 60  DDRSVLACTTWKGQISGLSVVPEEGLEVVVTGRLTAFGGQSKYNMNVDEVAVAGQGALMA 119

Query: 119 ALEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFP 178
            LEKRK +L  EGLF+ + K P+P++P II VITSP+GAVIRDIL R+  RFP +V+++P
Sbjct: 120 LLEKRKAQLAAEGLFAPERKKPLPYLPGIIGVITSPSGAVIRDILHRLRDRFPRKVLVWP 179

Query: 179 VKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIAN 238
           V VQG     E+A AI   N L  G   PRPD+II+ARGGGSIEDLW FN+E++ RA A 
Sbjct: 180 VAVQGSNSAPEVARAIDGFNALTPGGALPRPDLIIVARGGGSIEDLWGFNEEIVARATAA 239

Query: 239 SSIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIR 298
           S IP+ISA+GHETD TL DY +DLRAPTPT AAE AVPV+  L   + N  AR+ N   R
Sbjct: 240 SDIPLISAVGHETDTTLIDYVSDLRAPTPTAAAEHAVPVRLELLGWVENQGARMANAASR 299

Query: 299 LIKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIK 358
            ++ +   L  + +ALP  D  L   R RLDR+   L + L   + R+    +     ++
Sbjct: 300 AVQLRRQRLGDMARALPRPDTLLETPRQRLDRVSDRLPNALISGVQRRKLTLSDRAASLR 359

Query: 359 SDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHT 418
              L   +   +  +      +                                +     
Sbjct: 360 PATLRGLVSSRQDKLKNLSSRLT------------------------LRPITQDLGRKRD 395

Query: 419 HIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRN 478
            + ++  R+    S +I      +S T R L   +YK TL+RGY  ++D     +T    
Sbjct: 396 ALDRITKRLNTAQSSRIDRQIDRLSATARQLDILSYKATLRRGYAVVRDGA-ALVTSTEG 454

Query: 479 LATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
                 + I F DG  +      AP   + +          +  G QG LF
Sbjct: 455 ARKAAELSIEFADGTFDV---ASAPSTTKKSAPKPAAPKAPKTPGEQGSLF 502


>gi|167645191|ref|YP_001682854.1| exodeoxyribonuclease VII large subunit [Caulobacter sp. K31]
 gi|189037852|sp|B0SY33|EX7L_CAUSK RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|167347621|gb|ABZ70356.1| exodeoxyribonuclease VII, large subunit [Caulobacter sp. K31]
          Length = 528

 Score =  398 bits (1022), Expect = e-108,   Method: Composition-based stats.
 Identities = 184/526 (34%), Positives = 278/526 (52%), Gaps = 7/526 (1%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
              + P YSVSEL++ LK  +E++ + V +RGE+S     H +GH Y ++KD+ S ID +
Sbjct: 6   PDSNAPAYSVSELAFALKRTLETSYAFVRLRGELSKVTH-HGNGHVYLTIKDDKSAIDGV 64

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +WKG +  +   PE G+E +V GKITT+P  S+YQI+IE++  +G G LL  LE+ K KL
Sbjct: 65  VWKGNVRGLGIRPEHGLEVIVTGKITTYPAGSRYQIVIETMEAAGVGALLAQLERLKAKL 124

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECP 187
             EGLF+   K P+P +P ++ VITSPTGAVIRDIL RI  R+P +V+++P  VQGD   
Sbjct: 125 NAEGLFAPDRKRPLPSMPAVVGVITSPTGAVIRDILHRIRDRWPCQVLVWPCVVQGDAAA 184

Query: 188 KEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAI 247
            +++ AI   N L  G   PRPDI+I+ARGGGS+EDLW FNDE + R +A  +IP+ISA+
Sbjct: 185 GQVSAAIRGFNALTPGGPVPRPDILIVARGGGSVEDLWAFNDEGLARTVAEGTIPLISAV 244

Query: 248 GHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTL 307
           GHETD TL D+ +D RAPTPT AAEMA PV   L++ + + + RLNN   R ++ +   L
Sbjct: 245 GHETDTTLIDFVSDRRAPTPTAAAEMATPVLAELRALVSDYDRRLNNCGGRAVEERRTRL 304

Query: 308 NSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQ 367
            S  + LP     L+ ++ RLD L       L+ +     R F     R+    L  N  
Sbjct: 305 TSAARGLPRPADLLALAQQRLD-LAVRGLPRLDDLTAPAERRFKEAAARLD-TALQRNTD 362

Query: 368 KNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRI 427
            + + +L+    +        R     +   +     L  +        H  +  L  R+
Sbjct: 363 IHARDLLKVTARLSPDTLHRQRADAGRRVGDLGRRLDLAARRVPERVAQHARLPALQDRL 422

Query: 428 EFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILI 487
             +   +++     ++   ++ QS      L+ G+  +   +         LA+  R+ +
Sbjct: 423 NAVARRRLERETDRLAGLEKLRQSLNPTRPLELGFALVHKADGGIARSASELASGERVRL 482

Query: 488 NFFDGQANAIVINKA----PPKEQPTKKCQLHNNKREKQGTQGELF 529
            F  G  +A++  ++    PP   P         K      QG LF
Sbjct: 483 QFRQGDRDAVIDGESSGVLPPSAAPAPTRPTPRPKPASSSDQGSLF 528


>gi|154251076|ref|YP_001411900.1| exodeoxyribonuclease VII large subunit [Parvibaculum
           lavamentivorans DS-1]
 gi|171769562|sp|A7HQR0|EX7L_PARL1 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|154155026|gb|ABS62243.1| exodeoxyribonuclease VII, large subunit [Parvibaculum
           lavamentivorans DS-1]
          Length = 477

 Score =  397 bits (1021), Expect = e-108,   Method: Composition-based stats.
 Identities = 205/530 (38%), Positives = 288/530 (54%), Gaps = 56/530 (10%)

Query: 1   MNPFSQKNSL--DHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLK 58
           M P   ++    +  E+SVSE+S+ LK  VE    HV VRGEI+GYRG HSSGH YF LK
Sbjct: 1   MPPSDTQSPAANNAHEFSVSEISFALKKTVEETFGHVRVRGEITGYRGPHSSGHCYFGLK 60

Query: 59  DNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLT 118
           D+ +R+DA+IWKG   K+ F PEEG+E +  GK+TT+PGSSKYQI+I+ L P+G G L+ 
Sbjct: 61  DDKARMDAVIWKGNFGKLRFKPEEGMEVIATGKLTTYPGSSKYQIVIDHLEPAGVGALMA 120

Query: 119 ALEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFP 178
            LE+R+KKL  EGLF+ + K  +PF+P++I V+TSPTGAVIRDIL R+  RFP  VI++P
Sbjct: 121 LLEERRKKLAAEGLFAAERKRALPFLPEVIGVVTSPTGAVIRDILHRLQDRFPRHVIVWP 180

Query: 179 VKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIAN 238
           V+VQG+    E+A AI   N +++G   PRPD++I+ARGGGSIEDLW FN+E++VRA A 
Sbjct: 181 VRVQGETSAAEVAAAIRGFNAMEKGGKTPRPDLLIIARGGGSIEDLWSFNEEIVVRAAAE 240

Query: 239 SSIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIR 298
           S+IP+ISAIGHETD TL D+A+D RAPTPT AAEMAVPV+  L + + +  +RL     R
Sbjct: 241 SAIPLISAIGHETDTTLIDFASDRRAPTPTAAAEMAVPVRAELLADVRDKGSRLIRCEAR 300

Query: 299 LIKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIK 358
            I+     L  L + LP     ++  R R D     L   L      K    + +  R+ 
Sbjct: 301 AIESYRTQLGGLARGLPKLQDLVALPRQRFDTAADRLGRALIRAAEVKRARLSRVEGRLS 360

Query: 359 SDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHT 418
              +   I   R+ + +  Q + +                                    
Sbjct: 361 DRPIRLRIANERKGLPQLLQRLTRAET--------------------------------- 387

Query: 419 HIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRN 478
                          ++     S+  +T++L+S++Y   LKRGY  ++D     I     
Sbjct: 388 --------------RRVADLARSLDGSTKLLESYSYHGVLKRGYAVVRDETGKPIRAGAG 433

Query: 479 LATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGEL 528
                RI I F + + +A+V                    ++  G QG L
Sbjct: 434 QTAGARIEIEFAEDRLDAVV-------APGGTVAPRKAPPKKPGGGQGSL 476


>gi|83591499|ref|YP_425251.1| exodeoxyribonuclease VII large subunit [Rhodospirillum rubrum ATCC
           11170]
 gi|83574413|gb|ABC20964.1| Exodeoxyribonuclease VII large subunit [Rhodospirillum rubrum ATCC
           11170]
          Length = 537

 Score =  397 bits (1019), Expect = e-108,   Method: Composition-based stats.
 Identities = 203/538 (37%), Positives = 290/538 (53%), Gaps = 15/538 (2%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M         + PE SVSELS  LK  +E   S V VRGEIS  +    SGH Y  LKD+
Sbjct: 1   MIDTPNAPVHNLPELSVSELSGALKRTIEEAFSRVRVRGEISQPKV-AGSGHCYLRLKDD 59

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            + IDAIIW+GT+ K+   PEEG+E + IG++TT+PG S YQI+IESL  +G G LL  L
Sbjct: 60  QAVIDAIIWRGTMAKLALRPEEGLEVIAIGRLTTYPGRSSYQIVIESLELAGEGALLKML 119

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           E+R+++L  EGLF    K   PF+P +I VITSPTGAVIRDIL R++ RFP  V+++PV 
Sbjct: 120 EERRRRLAAEGLFDAGRKRRPPFLPSVIGVITSPTGAVIRDILHRLADRFPRPVLVWPVA 179

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQG+    +IA AI   N L  G   PRPD++I+ARGGGS+EDL  FNDE +VRA + S+
Sbjct: 180 VQGEGAAAQIAAAITGFNALPAGGPVPRPDVLIVARGGGSLEDLMAFNDEAVVRAASASA 239

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP+ISA+GHETD TL D+AADLRAPTPTGAAEMAVPV+  L + +     RL+   +RLI
Sbjct: 240 IPLISAVGHETDTTLIDHAADLRAPTPTGAAEMAVPVRLDLLAQVRERGGRLDGATLRLI 299

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           + +   +  L + LP+  + +     RLD     LE  L  ++ R+     H   R++  
Sbjct: 300 EERRLRIEGLGRGLPDLARLIGTFAQRLDDRAERLEAALPRLLDRRADGVFHTAARLRG- 358

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420
                I +    +    + +E  + + LR       ++   L     Q    +      +
Sbjct: 359 -PGEMIARKADALERAGRGLETGLARGLREAASRLDQRADRL--RPGQIARLVAEGSRAL 415

Query: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480
             L  R++ +    +     ++      L + +Y+  L+RGY  ++D     +   R L 
Sbjct: 416 TTLAGRLDDLGRQTLVRRQDTLEGLGARLDNMSYRKVLERGYAVVRDATGAIVPAARGLT 475

Query: 481 TKTRILINFFDGQANAIVIN-------KAPPKEQPTKKCQLHNNKREKQGT---QGEL 528
               ++++F DG+  A +           P  E P         +R +      QG+L
Sbjct: 476 KGDGVVLDFRDGRVAATIGEADPEAIPGQPAPETPPTAAGRSPARRPRSAGEGRQGDL 533


>gi|304320146|ref|YP_003853789.1| Exonuclease VII, large subunit [Parvularcula bermudensis HTCC2503]
 gi|303299049|gb|ADM08648.1| Exonuclease VII, large subunit [Parvularcula bermudensis HTCC2503]
          Length = 550

 Score =  396 bits (1017), Expect = e-108,   Method: Composition-based stats.
 Identities = 177/526 (33%), Positives = 273/526 (51%), Gaps = 10/526 (1%)

Query: 5   SQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRI 64
           +   S +  EYSVSELS  +K  +E    +V VRGE+ G      +GH Y  LKD  + +
Sbjct: 7   ADGGSGNLKEYSVSELSGAVKRTIEDGFGYVRVRGEL-GRVSRSGNGHCYLDLKDERAVL 65

Query: 65  DAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRK 124
            ++IWKG  ++++  PE+G+E +  G++TTF G S+YQ++I++L P+G+G L+   E RK
Sbjct: 66  SSVIWKGGWSRLKVKPEQGMEVIATGRMTTFAGQSRYQLVIDTLEPAGAGALMALFEARK 125

Query: 125 KKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGD 184
           K L  EGLF+ + K P+P +P++I V+TSPTGAVIRDIL R+  RFP+ V+++P  VQG+
Sbjct: 126 KALEAEGLFAAERKRPLPPMPQVIGVVTSPTGAVIRDILHRLRDRFPVHVLVWPAVVQGE 185

Query: 185 ECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPII 244
           +CPK +   +   N L      PRPD++I+ARGGGS+EDLW FNDE + RA+A SSIP+I
Sbjct: 186 QCPKSVVAGVEGFNALPTDGPVPRPDVLIVARGGGSLEDLWGFNDEAVARAVAASSIPVI 245

Query: 245 SAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKI 304
           SAIGHETD TL DY AD RAPTPT AAEMAVPV+  L   L  L  RL   I   ++ + 
Sbjct: 246 SAIGHETDVTLIDYVADRRAPTPTAAAEMAVPVRMDLSGRLDALNVRLTQRIGHHLEAQS 305

Query: 305 NTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
             L S  + L   +  +  +  R DR    L  +L++ + R  +        + +  +  
Sbjct: 306 LALQSAARGLGRKESLIEPAEQRFDRAVSHLTQSLKVRVERATQRMERAAGGLSAALVTA 365

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            +    + +    Q +     +         + K+    +     +  +      +KK+ 
Sbjct: 366 AVAMKAETLKGMSQRLITAPPRRWEQA----RSKVISARLSPHLVRRSLDRGGEEVKKIG 421

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
            R+  +    +      +    R+L S +Y+  L RG+  + D +   I   R +     
Sbjct: 422 GRLGRLTRENVDRKSARLDDQARLLHSLSYQGVLARGFALVLDESQGVIRSPRQMRAGET 481

Query: 485 ILINFFDGQANAIV-----INKAPPKEQPTKKCQLHNNKREKQGTQ 525
             + F +G+                     +K       R+  G+Q
Sbjct: 482 YHLRFAEGEVPVRHLIEGETKGPAAASSAARKTPQAKTSRKSDGSQ 527


>gi|146276686|ref|YP_001166845.1| exodeoxyribonuclease VII large subunit [Rhodobacter sphaeroides
           ATCC 17025]
 gi|166232360|sp|A4WQ76|EX7L_RHOS5 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|145554927|gb|ABP69540.1| Exodeoxyribonuclease VII large subunit [Rhodobacter sphaeroides
           ATCC 17025]
          Length = 519

 Score =  395 bits (1015), Expect = e-108,   Method: Composition-based stats.
 Identities = 192/534 (35%), Positives = 279/534 (52%), Gaps = 22/534 (4%)

Query: 1   MNPF--SQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLK 58
           M+        + + PEY+VSELS  +K ++E     V VRGEI G     +SGH YF LK
Sbjct: 1   MSDLFEDPAPARNTPEYTVSELSGAVKRVIEGEFGLVRVRGEI-GRVSRPASGHLYFDLK 59

Query: 59  DNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLT 118
           D+ + I AI WKG   ++   PEEG+E +  G++TTFPG SKYQII+E + P+G+G L+ 
Sbjct: 60  DDRAVIAAICWKGQAGRLSVRPEEGMEVVATGRMTTFPGQSKYQIIVEDMAPAGAGALMA 119

Query: 119 ALEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFP 178
            LEKR+  L  EGLF    K P+PF+P++I V+TSP+GAVIRDIL R+  RFP  V+I+P
Sbjct: 120 MLEKRRAALAAEGLFDAARKRPLPFLPRVIGVVTSPSGAVIRDILHRLRDRFPSHVLIWP 179

Query: 179 VKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIAN 238
           V VQG++C  E+A AI   N L +G   PRPD++I+ARGGGS+EDLW FN+E++VRA A 
Sbjct: 180 VAVQGEKCAPEVAAAIRGFNALPDGGPIPRPDLLIVARGGGSLEDLWGFNEEIVVRAAAE 239

Query: 239 SSIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIR 298
           S IP+ISA+GHETD TL D+AAD RAPTPT AAEMAVPV+  L + L    ARL+     
Sbjct: 240 SRIPLISAVGHETDTTLIDHAADRRAPTPTAAAEMAVPVRLDLLAGLDGQGARLSRCAAE 299

Query: 299 LIKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIK 358
            I+ +   L  L +ALP  D  ++    R D     L   L   +  +      +   ++
Sbjct: 300 TIRRRDQRLRDLSRALPRLDSLVAGPSQRFDLWSARLSGALGQSVAARRARLEPLGAHLR 359

Query: 359 SDFLIHNIQKNRQHILEKQQHIEQIV---KQHLRYIFLEKKEKIAILHMLREQTKNRIFY 415
              L   + + +  + ++ + +E  +    +  R  F     ++A           R   
Sbjct: 360 PRLLADLVARQKDRLADRGRGLETCLGRRSERARDRFEALSGRLAPAFARLVAESERTNR 419

Query: 416 LHTHIKKLITRIEFIL-SHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFIT 474
                   +          ++      +    R+ Q+  Y+ TL+RGY  ++  +   +T
Sbjct: 420 RDAAALGALAARLEAAPEARLLRLADRLEALDRLRQTLGYRETLRRGYAVVR-ADGEVVT 478

Query: 475 QKRNLATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGEL 528
            K        + I F DG+                   +     + +   QG L
Sbjct: 479 TKTAAERAASLEIEFQDGRLTL--------------GARKPRKGKAEPPAQGSL 518


>gi|254293365|ref|YP_003059388.1| exodeoxyribonuclease VII large subunit [Hirschia baltica ATCC
           49814]
 gi|254041896|gb|ACT58691.1| exodeoxyribonuclease VII, large subunit [Hirschia baltica ATCC
           49814]
          Length = 559

 Score =  395 bits (1015), Expect = e-108,   Method: Composition-based stats.
 Identities = 185/537 (34%), Positives = 278/537 (51%), Gaps = 20/537 (3%)

Query: 10  LDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIW 69
            + PE SVSELS  LK  VE   S+V VRGE+ G   +  SGH Y  LKD+ + ++ I+W
Sbjct: 26  SNSPEMSVSELSNRLKRTVEDAYSYVRVRGEL-GRVTLAKSGHLYVDLKDDKAVLNTIMW 84

Query: 70  KGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLE 129
           KG ++K+ F PEEG+E +  G+++T+PG S YQ+I ES+ P+G G L+  LE+RKKKL  
Sbjct: 85  KGQVSKLPFKPEEGLEVIAEGRLSTYPGRSNYQMIAESMRPAGVGALMQLLEERKKKLAA 144

Query: 130 EGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKE 189
           EGLF+ +HK  +PF+P+ I V+TSPTGAVIRDIL R+  RFP  V+I+P  VQG+    +
Sbjct: 145 EGLFNPEHKKELPFLPETIGVVTSPTGAVIRDILHRVKERFPTHVLIWPALVQGEHAAAQ 204

Query: 190 IANAILQLNTLKE-GRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           +A  I   N +    R   RPD+II+ARGGGS+EDLW FNDE +VRA+  S IPIISA+G
Sbjct: 205 VAGGIRGFNAIGPAARKIKRPDLIIVARGGGSVEDLWPFNDEDVVRAVFESEIPIISAVG 264

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HETD TL D+ +D RAPTPTGAAE+A+PV+  L ++   L AR    + R +      L 
Sbjct: 265 HETDTTLIDFVSDRRAPTPTGAAEIALPVRAELIATTDALGARGKRALQRGVDTSKVELR 324

Query: 309 SLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQK 368
           ++   +P  +  +   R RLD    +L   L+ I+ R         + ++   L   + +
Sbjct: 325 AVTARMPRPEMLVQGVRQRLDYASEKLGFALKDIVVRMRSRLQQASSGLQPLALQREMVR 384

Query: 369 NRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIE 428
            +  +          +++                  L    +N        ++    R  
Sbjct: 385 RKTALDTLYMRASFALRRDAGDRSKLLHGIYGRF--LARDPRNTFGRKQDLVEATFHRST 442

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
             +   I   + ++    R+L S +++N L RG+  +Q  N   +    ++ +  R+ + 
Sbjct: 443 VAMERLIGKKYENLETVNRLLSSVSHENVLARGFVLVQRMNGELVRHASDVDSSERLRLQ 502

Query: 489 FFDGQANAIVINKAPPKEQP----------------TKKCQLHNNKREKQGTQGELF 529
           F D +       K P +                   +   +         G QG+LF
Sbjct: 503 FIDDEVRVTSDPKTPQEAPRIVRETEPQTTQLGGIASAPTKKIVKPPSGSGGQGDLF 559


>gi|259415863|ref|ZP_05739783.1| exodeoxyribonuclease VII, large subunit [Silicibacter sp.
           TrichCH4B]
 gi|259347302|gb|EEW59079.1| exodeoxyribonuclease VII, large subunit [Silicibacter sp.
           TrichCH4B]
          Length = 502

 Score =  395 bits (1015), Expect = e-108,   Method: Composition-based stats.
 Identities = 189/531 (35%), Positives = 277/531 (52%), Gaps = 31/531 (5%)

Query: 1   MNPFSQKNS--LDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLK 58
           M+      S   + PE+SVSE+S  +K  +E +   V VRGE+ G      SGH Y+ +K
Sbjct: 1   MSDLLDDPSPGQNAPEFSVSEISGEIKKTLEGSFGRVRVRGEV-GRVFKARSGHLYYDIK 59

Query: 59  DNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLT 118
           D+ S +    WKG ++ +  +PEEG+E +V G++T F G SKY + ++ +  +G G L+ 
Sbjct: 60  DDRSVLACTTWKGQISGLSVVPEEGLEVVVTGRLTAFGGQSKYNMNVDEVAVAGQGALMA 119

Query: 119 ALEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFP 178
            LEKRK +L  EGLF+ + K P+P++P+II V+TSP+GAVIRDIL R+  RFP +V+++P
Sbjct: 120 LLEKRKAQLASEGLFAPERKKPLPYLPQIIGVVTSPSGAVIRDILHRLRDRFPRKVLVWP 179

Query: 179 VKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIAN 238
           V VQG  C  E+A AI   N L  G   PRPD+II+ARGGGSIEDLW FN+E++ RA+A 
Sbjct: 180 VAVQGSNCAPEVARAIEGFNNLSPGGALPRPDLIIVARGGGSIEDLWGFNEEIVARAVAA 239

Query: 239 SSIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIR 298
           S IP+ISA+GHETD TL DY +DLRAPTPT AAE AVPV+  L   + N  AR+ N   R
Sbjct: 240 SQIPLISAVGHETDTTLIDYVSDLRAPTPTAAAEHAVPVRLELLGWVENQSARMANATSR 299

Query: 299 LIKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIK 358
            ++ +   L  + +ALP  D  L   R RLDR+   L + L   + R+    +     ++
Sbjct: 300 AVQLRRQRLGDVARALPRPDTLLETPRQRLDRVSDRLPNALIAGVQRRKLTLSERAATLR 359

Query: 359 SDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHT 418
              L   ++  +  +      +                             +        
Sbjct: 360 PATLRSLVEARKDRLKNLSSRLT------------------------LRPIQQDTARKRD 395

Query: 419 HIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRN 478
            + ++  R+    + +I+     +S T R L+  +YK TL RGY  ++D +   +T    
Sbjct: 396 ALDRISKRLNAAQTSRIERHADRLSATARQLEILSYKATLSRGYAVVRDGD-ALVTNTLG 454

Query: 479 LATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
                 + I F DG      I       + T          +  G QG LF
Sbjct: 455 ARNAAALSIEFADGTVE---IGANAATPKKTAPKPAAPKPPKTPGEQGSLF 502


>gi|237732486|ref|ZP_04562967.1| exodeoxyribonuclease VII large subunit [Citrobacter sp. 30_2]
 gi|226908025|gb|EEH93943.1| exodeoxyribonuclease VII large subunit [Citrobacter sp. 30_2]
          Length = 457

 Score =  395 bits (1015), Expect = e-108,   Method: Composition-based stats.
 Identities = 144/495 (29%), Positives = 236/495 (47%), Gaps = 53/495 (10%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           +S     ++VS L+  ++ ++E  +  V + GEIS +    SSGH YF+LKD+ +++   
Sbjct: 3   SSQTTSIFTVSRLNQTVRLLLEQEMGQVWISGEISNFT-QPSSGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q K  +P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQFKKSLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANARGE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+                                 
Sbjct: 236 VGHETDVTIADFIADLRAPTPSAAAEIVS------------------------------- 264

Query: 307 LNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNI 366
                    N  + L   ++   RL       ++  I  + R F  + +R++       +
Sbjct: 265 --------RNQLELLRQIQHGQQRLEM----AMDYYIANRTRRFTQLHHRLQQQHPQLRL 312

Query: 367 QKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITR 426
            + +  +   +Q +   ++  ++     ++     L   ++  + RI+   T I++L  R
Sbjct: 313 ARQQTVLERLRQRMNFALENKIKQANQRQQRVSQRLS--QQNPQPRIYRAQTRIQQLEYR 370

Query: 427 IEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRIL 486
           +   +  ++ +           L++ +  +TL RGY+    T+   + Q + + T   + 
Sbjct: 371 LAENIRARLSAQRERFGNVVTHLEAVSPLSTLARGYSVTTATDGKVLKQTKQVKTGDVLT 430

Query: 487 INFFDGQANAIVINK 501
               DG   + V   
Sbjct: 431 TRLSDGWVESEVKGI 445


>gi|90419936|ref|ZP_01227845.1| exodeoxyribonuclease VII, large subunit [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335977|gb|EAS49725.1| exodeoxyribonuclease VII, large subunit [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 545

 Score =  395 bits (1014), Expect = e-107,   Method: Composition-based stats.
 Identities = 212/547 (38%), Positives = 307/547 (56%), Gaps = 20/547 (3%)

Query: 1   MNPFSQKNSL-DHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKD 59
           M+   +   + +  EYSVSE+S  LK  VE    HV +RGE+SGYRG HSSGHAYFSLKD
Sbjct: 1   MSRSPESAPMSNVAEYSVSEISGALKRTVEERFGHVRLRGEVSGYRGPHSSGHAYFSLKD 60

Query: 60  NHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTA 119
           + +RIDA+IW+   +K+ F PEEG+E +  GK+TT+PGSSKYQI+IE + P+G+G L+  
Sbjct: 61  DRARIDAVIWRTAFSKLAFKPEEGLEVVATGKLTTYPGSSKYQIVIEQIEPAGAGALMAL 120

Query: 120 LEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPV 179
           L +R++KL  EGLF+ + K P+PF+P++I V+TSPTGAVIRDI  RI+ RFP+ ++++PV
Sbjct: 121 LNERRRKLEAEGLFAAERKRPLPFMPRVIGVVTSPTGAVIRDIHHRIADRFPVHLLVWPV 180

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
           +VQG+   +E+A AI   NT  E     RPD+II+ARGGGS+EDLW FNDE++VRA A S
Sbjct: 181 RVQGETSGEEVARAIDGFNTFPESGAIARPDLIIVARGGGSLEDLWGFNDEVVVRAAAAS 240

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
           +IP+ISA+GHETDWTL D+AAD+RAPTPTGAAEMAVPV+  L +++  L AR +  + R 
Sbjct: 241 AIPLISAVGHETDWTLIDHAADMRAPTPTGAAEMAVPVRADLLAAVAALAARHSGAVSRR 300

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
           +  +   + +  +ALP+ D  L+  R RLD     L   L + +  K R +  +  R+  
Sbjct: 301 LDQERRAVAATARALPSPDMLLALPRRRLDEASTSLGQCLRVNLSEKRRAYGEVATRLAP 360

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH 419
             L   +++ R  +   Q H    V   ++      +   A L     +   R       
Sbjct: 361 SSLETLLREKRADLRHHQSHAAHAVTGLVQRKRQRFERIAADLQP--HRINARAEAARLR 418

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
           +  L  R+    +        +++   R+  S      L+RGYT ++  +   I +   L
Sbjct: 419 LGTLGERLTAAQALAATGRRQALASAWRVADSLNPMRVLERGYTIVRGPDGEPIVRASGL 478

Query: 480 ATKTRILINFFDGQANAIVINKAP-----------------PKEQPTKKCQLHNNKREKQ 522
                  + F   Q    V    P                   E P  + +     +  +
Sbjct: 479 EPGMAFEVQFAHDQRRGAVATGEPVAGITPAAAGDAAAEPAETEPPKPRAKRRAAAKATE 538

Query: 523 GTQGELF 529
             QG LF
Sbjct: 539 EDQGTLF 545


>gi|240949395|ref|ZP_04753736.1| exodeoxyribonuclease VII large subunit [Actinobacillus minor NM305]
 gi|240296144|gb|EER46800.1| exodeoxyribonuclease VII large subunit [Actinobacillus minor NM305]
          Length = 486

 Score =  395 bits (1014), Expect = e-107,   Method: Composition-based stats.
 Identities = 138/492 (28%), Positives = 251/492 (51%), Gaps = 12/492 (2%)

Query: 12  HPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKG 71
           +   +V++L+Y ++H++E+ L  + + GEIS +     SGH Y +LKD ++++   ++K 
Sbjct: 2   NNILTVTQLNYSVRHLLETELGQIWLTGEISNF-SQPVSGHWYLTLKDENAQVRCAMFKM 60

Query: 72  TLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEG 131
             +++ F P+ G++ LV   ++ +     YQ+IIES+ P+G G L    E+ K KL  +G
Sbjct: 61  KNSRVTFYPQNGMQVLVRASVSLYEPRGDYQLIIESMQPAGEGLLQQQFEQLKMKLAAQG 120

Query: 132 LFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEI 190
           LF+ +HK  +P   K + +ITS +GA ++DIL  +  R P L V+I+P  VQG E  ++I
Sbjct: 121 LFAQEHKKALPDFVKRVGIITSSSGAALQDILNILKRRDPSLAVVIYPTLVQGKEATQDI 180

Query: 191 ANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHE 250
              I   N  +E       D++I+ RGGGS+EDLW FN+E +  AI  S IPIISA+GHE
Sbjct: 181 VQTIDLANRRQE------CDVLIVGRGGGSLEDLWCFNEEAVAYAIYRSEIPIISAVGHE 234

Query: 251 TDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSL 310
           TD T+AD+ ADLRAPTP+ AAE+    ++ L   L +    +N    R+   K+     L
Sbjct: 235 TDVTIADFVADLRAPTPSAAAELVSRDQQELIRQLQHHFNMVNLAFDRIWHEKLTRFQQL 294

Query: 311 LKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQK 368
              L   +  + L   + R ++L   +E +++ ++  +      +  R++       +  
Sbjct: 295 NLRLNAQHPSKYLHVFKIRFEQLAYRMEKSVKSLLSARRNQLTQVFLRLQPHHPQRKLAM 354

Query: 369 NRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIE 428
             + + +++  + Q + Q+L     + +     +         +I     +I +L  ++ 
Sbjct: 355 QCEQLAQREVRLHQQMSQYLSRKKQDWENLTKRIES--TSLPYQIEKKQQYITRLAQQLS 412

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
           + +  +    + S       L   +    L RGY+  Q +  + +T  + +A   +++  
Sbjct: 413 YAMDKRYLKEYQSFQALCTRLDGLSPLKILGRGYSITQTSKGHILTNAKEVAVGDKLITQ 472

Query: 489 FFDGQANAIVIN 500
              GQ  + V+ 
Sbjct: 473 LETGQIISEVME 484


>gi|56696229|ref|YP_166586.1| exodeoxyribonuclease VII large subunit [Ruegeria pomeroyi DSS-3]
 gi|81820092|sp|Q5LTR9|EX7L_SILPO RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|56677966|gb|AAV94632.1| exodeoxyribonuclease VII, large subunit [Ruegeria pomeroyi DSS-3]
          Length = 482

 Score =  394 bits (1013), Expect = e-107,   Method: Composition-based stats.
 Identities = 181/517 (35%), Positives = 266/517 (51%), Gaps = 36/517 (6%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
           PE++V+E+S  +K  +E +   + VRGE+ G      SGH Y+ +KD+ + +    WKG 
Sbjct: 2   PEFTVTEISGEVKRTLEGSFGRIRVRGEV-GRVFQARSGHLYYDIKDDRNVLACTTWKGQ 60

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
           +  +  +PEEG+E +V G++T F   SKY + ++ +  +G G L+  LEKRKK+L  EGL
Sbjct: 61  VASLSVVPEEGLEVVVTGRLTAFGAQSKYNLNVDEVAVAGQGALMALLEKRKKQLEAEGL 120

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F+ + K P+P++P+II VITSP GAVIRDIL R+  RFP +V+I+PV VQG  C  E+A 
Sbjct: 121 FAPERKRPLPYLPQIIGVITSPQGAVIRDILHRLRDRFPRKVLIWPVAVQGANCAPEVAR 180

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N    G   PRPD++I+ARGGGSIEDLW FN+E++ RA A S IP+ISA+GHETD
Sbjct: 181 AIEGFNMFSPGGALPRPDLLIVARGGGSIEDLWGFNEEIVARAAAASQIPLISAVGHETD 240

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            TL D+ +D RAPTPT AAEMAVPV+  L +      ARL+      ++ +   L  L +
Sbjct: 241 TTLIDFVSDRRAPTPTAAAEMAVPVRLELLAWTGEQGARLSRAASDAVQRRAQRLRDLSR 300

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
           ALP  D  L   R RLDR    L   L   + R+      +   ++   L   +   R H
Sbjct: 301 ALPRPDSLLDTPRQRLDRAAERLPAALTQGVQRRRLRLAELSAPLRPASLRALVSARRDH 360

Query: 373 ILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILS 432
           +      +                             +  I      + +L  R+    +
Sbjct: 361 LAHLGSRLS------------------------PRALEREIAAQGERLTRLSDRLNSAQT 396

Query: 433 HKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDG 492
            +I+     +    R+ ++  YK TL RGY  ++D     +T +   A    + I F DG
Sbjct: 397 TRIERLRQRLESADRLRETLGYKATLARGYAVVRDDQGALLTTRAQAAKAAALQIEFADG 456

Query: 493 QANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
             +                 +  +  ++K   QG LF
Sbjct: 457 TLD-----------TGGAPAKPASKPKQKPPEQGSLF 482


>gi|146312641|ref|YP_001177715.1| exodeoxyribonuclease VII large subunit [Enterobacter sp. 638]
 gi|166919633|sp|A4WD84|EX7L_ENT38 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|145319517|gb|ABP61664.1| exodeoxyribonuclease VII, large subunit [Enterobacter sp. 638]
          Length = 457

 Score =  394 bits (1013), Expect = e-107,   Method: Composition-based stats.
 Identities = 148/508 (29%), Positives = 234/508 (46%), Gaps = 57/508 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           +S     Y+VS L+  ++ ++E  +  V + GEIS +    SSGH YF+LKD+++++   
Sbjct: 3   SSQSPSIYTVSRLNQSVRLLLEQEMGQVWISGEISNFT-QPSSGHWYFTLKDDNAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 SAEGLFDQQFKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANARHE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASQIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ +D+RAPTP+ AAE+    ++ L   + N + RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVSDMRAPTPSAAAEVVSRNQQELLRQMQNGQQRLEMAMDYFLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              L   L      L   R +   +RL + +   L+  + R   H   +  R+       
Sbjct: 296 FTQLHHRLQQQHPQLRLERQQTVLERLRQRMNFALDNQLKRVVSHQQRMTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +                                          
Sbjct: 356 KIYRTQTRIQQLEYRLAE------------------------------------------ 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +           L++ +  +TL RGY+    T+   + Q + +     
Sbjct: 374 -----NLRARLSTTRERFGNAVTHLEAVSPLSTLARGYSVTTATDGKVLKQTKQVKAGDL 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTKKC 512
           +     DG   + V    P K+   KK 
Sbjct: 429 MTTRLADGWVESEVKGITPAKKTRKKKP 456


>gi|126733161|ref|ZP_01748908.1| Exonuclease VII, large subunit [Roseobacter sp. CCS2]
 gi|126716027|gb|EBA12891.1| Exonuclease VII, large subunit [Roseobacter sp. CCS2]
          Length = 495

 Score =  394 bits (1012), Expect = e-107,   Method: Composition-based stats.
 Identities = 182/495 (36%), Positives = 277/495 (55%), Gaps = 6/495 (1%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           + F  + + + PE+SVSE+S  +K  +E   SHV V+GEI G     +SGH Y  LKD+ 
Sbjct: 3   DLFEDEPADNTPEFSVSEISGAVKKAIEGGFSHVRVKGEI-GRVSRPASGHIYMDLKDDR 61

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           + +  +IWKG    +   PEEG+E +  GK+TTFPG SKYQ++IE + P+G+G L+  LE
Sbjct: 62  AVLAGVIWKGRAQGLAHRPEEGMEVVATGKLTTFPGQSKYQMVIEDIAPAGAGALMAMLE 121

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           KRK  L  EG F+ + K  +P++P+II V+TSP+GAVIRDIL R+  RFP +V+++PV V
Sbjct: 122 KRKAALAAEGFFAPERKKELPYLPEIIGVVTSPSGAVIRDILHRLRDRFPRKVLVWPVAV 181

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QG +C  E+A AI   NTL  G   PRPD++I+ARGGGS+EDLW FN+E++ RA A S I
Sbjct: 182 QGQKCAPEVAAAIEGFNTLTPGGALPRPDLLIVARGGGSLEDLWGFNEEVVARAAAASDI 241

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETD TL D+ +D+RAPTPT AAE+AVPV+  L +      ARL+  +   + 
Sbjct: 242 PLISAVGHETDTTLIDFVSDMRAPTPTAAAELAVPVRMELLAWADQQGARLSRALTTGLT 301

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            +   +  L +ALP  D  +   R RLD L   L   L     +  +        ++   
Sbjct: 302 QRQQRVRDLGRALPQVDALVEGPRQRLDYLGERLPAALTGAAAK--KRLQMSEAALRPGI 359

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIK 421
           L   + ++R+ +      +   +K+  R      ++      +     ++R+      + 
Sbjct: 360 LSRRLAEDRRRLDGLSDRLGPALKRRSREARTTLEQ--TSRGLRAGVLQDRVSRQSDRLI 417

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLAT 481
             + R+    S +     + +    R+ ++  Y  TLKRGY  ++  +   +T K     
Sbjct: 418 GTLRRLSDRASRQQAERLSKLEALDRLRETLGYVETLKRGYAVVRG-DGAVVTTKGAAQK 476

Query: 482 KTRILINFFDGQANA 496
              + I F DG+ + 
Sbjct: 477 AKALEIEFADGRLHV 491


>gi|163797950|ref|ZP_02191892.1| Exodeoxyribonuclease VII [alpha proteobacterium BAL199]
 gi|159176744|gb|EDP61315.1| Exodeoxyribonuclease VII [alpha proteobacterium BAL199]
          Length = 494

 Score =  393 bits (1010), Expect = e-107,   Method: Composition-based stats.
 Identities = 181/529 (34%), Positives = 272/529 (51%), Gaps = 41/529 (7%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           +P +     + PE++V E+S  +K  VES    V VRGEIS       SGH Y SLKD+ 
Sbjct: 6   SPTAPAPG-NLPEFTVGEVSLAVKRTVESAFERVRVRGEIS-RPTRAGSGHLYLSLKDDQ 63

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           + ++A+ W+G   ++   PEEG E +  GK+TT+PG SKYQ++IE +  +G G LL  LE
Sbjct: 64  AVLEAVCWRGQAQRLSIQPEEGTEVIATGKLTTYPGRSKYQMVIEQMELAGEGALLKLLE 123

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
            R+K+L  EGLF  + K PIPF+P +I V+TSPTGAVIRDIL R++ RFP+ VI++PV V
Sbjct: 124 DRRKRLTAEGLFEVERKRPIPFLPSVIGVVTSPTGAVIRDILHRLADRFPVHVIVWPVLV 183

Query: 182 QGDECPKEIANAILQLNTLKE-GRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           QG+   ++IANAI   N L   G    RPD++I+ARGGGS+EDLW FN+E++VRA A S 
Sbjct: 184 QGEGAKEQIANAIAGFNALPATGGKVARPDLLIVARGGGSLEDLWAFNEEIVVRAAAASD 243

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP+ISA+GHETD TL D+A+D RAPTPT AAEMAVPV+  L + +    AR+ + + R +
Sbjct: 244 IPLISAVGHETDTTLIDFASDRRAPTPTAAAEMAVPVRADLVARIAENAARIAHAVARRL 303

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
                 L  L + L +    +  ++ RLD   +    +L   + R               
Sbjct: 304 TDGTTRLTGLARGLGDPAARIEQAQQRLDYAGQTAGASLTRTLERLADRVER-------- 355

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420
                                ++          E +   A+  +     + R+       
Sbjct: 356 ---------------------RLPTPFEILARTEGRLNAALRGLRIAPVEQRLDQTSREF 394

Query: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480
            +L    +  +   +K     +    R+L++ ++   L RG+  ++D +   +T   +  
Sbjct: 395 IRLAKASDSAVDRFLKVESDRLKALERVLEANSFVRVLDRGFALVRDADGTPVTSADDAR 454

Query: 481 TKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
               + + F DG+  A+V              +  +       TQ  LF
Sbjct: 455 DGQAVTLRFRDGERAAVV---------GAGGTRSRSKTPVAPPTQETLF 494


>gi|315500485|ref|YP_004089288.1| exodeoxyribonuclease vii, large subunit [Asticcacaulis excentricus
           CB 48]
 gi|315418497|gb|ADU15137.1| exodeoxyribonuclease VII, large subunit [Asticcacaulis excentricus
           CB 48]
          Length = 547

 Score =  392 bits (1008), Expect = e-107,   Method: Composition-based stats.
 Identities = 183/551 (33%), Positives = 272/551 (49%), Gaps = 35/551 (6%)

Query: 4   FSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSR 63
               +  + P +SVSEL+  LK  +ES   HV +RGEIS     H+SGH Y +LKD+ + 
Sbjct: 7   SPVDSQSNSPPWSVSELAGALKRTIESAYDHVRLRGEISKVT-RHTSGHVYLTLKDDRAA 65

Query: 64  IDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKR 123
           ID +IWKG +++++  P+ G+E +V GK+TTFP SSKYQI+IESL  +G G LL  LE+ 
Sbjct: 66  IDGVIWKGNISRLKAQPQAGLEVIVTGKLTTFPASSKYQIVIESLEAAGIGALLAQLERT 125

Query: 124 KKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQG 183
           K KL  EGLF+ + K  +PF PK I VITSPTGAVIRDIL RI  R+P RVI++PV VQG
Sbjct: 126 KAKLHGEGLFAAERKKRLPFAPKTIGVITSPTGAVIRDILHRIRDRWPCRVIVWPVIVQG 185

Query: 184 DECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPI 243
           D  P +I  A+       +    PRPD++I+ARGGGS+EDLW FNDE + RA+A  ++P+
Sbjct: 186 DAAPAQIIQALNGF----QSGAVPRPDVLIVARGGGSVEDLWAFNDEGLARAVAACTLPV 241

Query: 244 ISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYK 303
           ISA+GHETD TL D+ +D RAPTPTGAAEMA PV   L+  +++LE R      + ++ +
Sbjct: 242 ISAVGHETDTTLIDFVSDRRAPTPTGAAEMATPVLSELRGFVLDLERRRLGSFDQALRNR 301

Query: 304 INTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLI 363
              +  L +ALP     +  ++ RLD     L   L   +      F     R     L 
Sbjct: 302 RERVALLGRALPKPQDLIDAAQQRLDYAAHRLGGGLLRNLNAHDTAFARTAARFSPALLE 361

Query: 364 HNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKL 423
                  + + +  +     + + +    +E     A L      T   +      + +L
Sbjct: 362 RPRHLKAERVTQLSERATAALTRGVERQRVEFTRLSARLTPAL--TLRPLDLKREALNRL 419

Query: 424 ITRIEFILSHKIK------------------------SCHTSVSITTRILQSFAYKNTLK 459
             R +  L+ ++                              +    ++  S      L 
Sbjct: 420 NQRFDAALNRRLDDSARRARLPELEQRLAAALARLLSQKSERLHRLDQLRLSLDPDRPLN 479

Query: 460 RGYTSIQDTNNNFITQKRNLATKTRILINFF-DGQANAIVINKAPPKEQPTKKCQLHNNK 518
            G+  +   + + +T    +     + + F  D   + +  +       P  +       
Sbjct: 480 LGFARVSRADGHLVTSPEGVGVGEALTLTFKGDRTLDVVASDGT---SAPPTRPATKPRP 536

Query: 519 REKQGTQGELF 529
              +  QG LF
Sbjct: 537 TPLKPEQGSLF 547


>gi|307296250|ref|ZP_07576077.1| exodeoxyribonuclease VII, large subunit [Sphingobium
           chlorophenolicum L-1]
 gi|306878052|gb|EFN09275.1| exodeoxyribonuclease VII, large subunit [Sphingobium
           chlorophenolicum L-1]
          Length = 499

 Score =  392 bits (1007), Expect = e-107,   Method: Composition-based stats.
 Identities = 182/531 (34%), Positives = 269/531 (50%), Gaps = 55/531 (10%)

Query: 4   FSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSR 63
             +++  + P  SVSELS  LK  VE    HV +RGEISG++    SGH Y  LKD+++ 
Sbjct: 17  AEERSGDNAPPLSVSELSALLKRTVEDRFGHVRLRGEISGFK-RAGSGHIYLCLKDDNAV 75

Query: 64  IDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKR 123
           ID ++WKG   ++ F P++G+E +  GK+TT+PG SKYQI+I+ +  +G G L+  LEK 
Sbjct: 76  IDGVMWKGGAARLPFAPQDGVEVIATGKLTTYPGRSKYQIVIDRMELAGEGALMALLEKL 135

Query: 124 KKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQG 183
           K+KL  EGLF    K  +PF+P++I V+TSPTGAVIRDIL R+  R P +V+++PV VQG
Sbjct: 136 KQKLAAEGLFDRSAKRRLPFMPRVIGVVTSPTGAVIRDILHRLEDRCPTQVLLWPVLVQG 195

Query: 184 DECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPI 243
               ++IA A+   + ++ G   PRPD++I+ARGGGSIEDLW FN+E++VRA+A  SIPI
Sbjct: 196 QGAAEQIARAVRGFSAMQPGGPIPRPDLVIVARGGGSIEDLWSFNEEIVVRAVAECSIPI 255

Query: 244 ISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYK 303
           ISA+GHETD TL DYAAD+RAPTPT AAEMAVPV+  L + L     R++  + R     
Sbjct: 256 ISAVGHETDTTLCDYAADMRAPTPTAAAEMAVPVRAELLAMLTEQGLRMDRAVRRGAAQA 315

Query: 304 INTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLI 363
              L    + +P  D  L+  R RLD+L   L   L   I     H       ++   L 
Sbjct: 316 RERLEMQARLMPTPDTLLAPQRQRLDQLSDGLGSALRHRIADARTHLGQASGALRPALLR 375

Query: 364 HNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKL 423
             + +  + +   Q   + + + +                                    
Sbjct: 376 QYVSRAAERVARLQLRPDYLERVYRDRATAF----------------------------- 406

Query: 424 ITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKT 483
                                 +R+  S      L+RG+  +    +  +    +     
Sbjct: 407 -------------------DRLSRLFTSVNPDLPLQRGFARVM-AGDRLVKSVADAQAAG 446

Query: 484 RILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQ-----GTQGELF 529
            + + F DG  +A +   AP ++ P +     +    K        Q +LF
Sbjct: 447 AVSLRFRDGAVDATIGGAAPLEKPPAEAISNPSRPPRKPRGGKETGQQDLF 497


>gi|84515408|ref|ZP_01002770.1| Exonuclease VII, large subunit [Loktanella vestfoldensis SKA53]
 gi|84510691|gb|EAQ07146.1| Exonuclease VII, large subunit [Loktanella vestfoldensis SKA53]
          Length = 499

 Score =  392 bits (1007), Expect = e-107,   Method: Composition-based stats.
 Identities = 190/500 (38%), Positives = 280/500 (56%), Gaps = 10/500 (2%)

Query: 1   MNPFSQKNSL----DHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFS 56
           M+ F    +     + PE+SVSE+S  +K  +E   +H+ VRGE+ G     SSGH Y  
Sbjct: 2   MDLFEDGPTDKSADNTPEFSVSEISGAVKKTIEGGFAHIRVRGEL-GRISRPSSGHIYLD 60

Query: 57  LKDNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTL 116
           LKD+ S +  IIWKG    +   PEEG+E +  GK+TTFPG SKYQ+IIE + P+G+G L
Sbjct: 61  LKDDRSVLSGIIWKGRATALTHRPEEGMEVIATGKLTTFPGQSKYQMIIEDIQPAGAGAL 120

Query: 117 LTALEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVII 176
           +  LEKR+  L  EGLF    K P+P++P+II V+TSP+GAVIRDIL R+  RFP +V++
Sbjct: 121 MAMLEKRRVMLAGEGLFDAARKKPLPYLPEIIGVVTSPSGAVIRDILHRLRDRFPRKVLV 180

Query: 177 FPVKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAI 236
           +PV VQG +C  E+A AI   N L  G   PRPD+II+ARGGGS+EDLW FN+E++VRA 
Sbjct: 181 WPVAVQGQKCAAEVAAAIDGFNRLTPGGALPRPDLIIVARGGGSLEDLWGFNEEIVVRAA 240

Query: 237 ANSSIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNII 296
           A S IP+ISA+GHETD TL D+AAD+RAPTPT AAE+AVPV+  L + +    ARL   +
Sbjct: 241 AASDIPLISAVGHETDTTLIDFAADIRAPTPTAAAELAVPVRIELLAFVDQQGARLVRAL 300

Query: 297 IRLIKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINR 356
              ++ +   L  L +ALP  D      R RLD L   L   L     +K    +     
Sbjct: 301 SNGVQTRRQRLRDLARALPRVDTLADGPRQRLDYLADRLPAALRQAAAQKRLQLSDAA-- 358

Query: 357 IKSDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYL 416
           ++   L   + ++R+ +      +   +++  R   +  +   A   +  +  + R+   
Sbjct: 359 LRPAILQRRLAEDRRRLSALSDRLAPALQRRSRDAAVTLER--AGRGLRCDLLQTRLDRQ 416

Query: 417 HTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQK 476
              +  ++ R+    + +       ++   R+ ++  Y  TLKRGY  ++   +  +T  
Sbjct: 417 AERLSSVLARLSDRATRQQTERTARLAALDRLRETLGYMETLKRGYAVVR-AGDVLVTDT 475

Query: 477 RNLATKTRILINFFDGQANA 496
              A    + I F DG+   
Sbjct: 476 VAAAKADHLEIQFADGRIAV 495


>gi|261492150|ref|ZP_05988721.1| exodeoxyribonuclease VII [Mannheimia haemolytica serotype A2 str.
           BOVINE]
 gi|261495920|ref|ZP_05992340.1| exodeoxyribonuclease VII [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261308417|gb|EEY09700.1| exodeoxyribonuclease VII [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261312223|gb|EEY13355.1| exodeoxyribonuclease VII [Mannheimia haemolytica serotype A2 str.
           BOVINE]
          Length = 530

 Score =  392 bits (1006), Expect = e-107,   Method: Composition-based stats.
 Identities = 146/492 (29%), Positives = 248/492 (50%), Gaps = 12/492 (2%)

Query: 12  HPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKG 71
               +V++L+Y ++H++E  +SH+ + GEIS +     SGH Y +LKD+ +++   ++K 
Sbjct: 46  SNILTVTQLNYSVRHLLEMEMSHIWLTGEISNF-SQPVSGHWYLTLKDDKAQVRCAMFKM 104

Query: 72  TLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEG 131
              ++ F P+ G++ LV   +T +     YQ+IIES+ P+G G L    E+ K KL  +G
Sbjct: 105 KNVRVNFRPQNGMQVLVRASVTLYEPRGDYQLIIESMQPAGEGLLQQQFEQLKAKLSAQG 164

Query: 132 LFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEI 190
           LF+ +HK PIP   K + +ITS +GA ++DIL  +  R P L V+I+P  VQG E  ++I
Sbjct: 165 LFAQEHKKPIPTFVKTVGIITSSSGAALQDILHILQRRDPSLSVVIYPALVQGKEATQDI 224

Query: 191 ANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHE 250
            N I   N   E       D++I+ RGGGS+EDLW FN+E +  AI +S IPIISA+GHE
Sbjct: 225 VNMIELANRRNE------CDVLIVGRGGGSLEDLWCFNEESVAYAIYHSQIPIISAVGHE 278

Query: 251 TDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSL 310
           TD T+AD+ ADLRAPTP+ AAE+    +  L+  L +   ++N    R+  +K N    L
Sbjct: 279 TDVTIADFVADLRAPTPSAAAELVSRDQNELKRQLQHQFDKVNLAFDRVWNHKFNRFQQL 338

Query: 311 LKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQK 368
              L   +  + +   + R D +   LE  +  ++  K +    +  R+        I++
Sbjct: 339 PLRLNAQHPSKQIQSQQQRFDYMEYRLEQAIYALVAAKKQVGKELNVRLIHQHPQKQIER 398

Query: 369 NRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIE 428
             Q + + +  +    +   +    ++K K       R     +++   T + K+  R+ 
Sbjct: 399 QSQMLKQLELKLH--WQMEQQLSKKQQKWKNITQRFERNPLPYQLYQQQTMVAKMSQRLA 456

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
           + +   +             L   +    L RGY+  Q  +   +T   N+     I+  
Sbjct: 457 YSIEKIMLKEQRHFQELCTKLDGLSPLKILTRGYSITQTKDGKTLTSTENIERGEAIITQ 516

Query: 489 FFDGQANAIVIN 500
              G+  + V++
Sbjct: 517 LKTGKIISQVVD 528


>gi|254419247|ref|ZP_05032971.1| exodeoxyribonuclease VII, large subunit [Brevundimonas sp. BAL3]
 gi|196185424|gb|EDX80400.1| exodeoxyribonuclease VII, large subunit [Brevundimonas sp. BAL3]
          Length = 533

 Score =  391 bits (1005), Expect = e-106,   Method: Composition-based stats.
 Identities = 183/526 (34%), Positives = 287/526 (54%), Gaps = 7/526 (1%)

Query: 5   SQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRI 64
           +     ++P  S+SELS+ LK  +E    HV +RGE+S     H+SGH Y +LKD+ S I
Sbjct: 14  AAAPRDNNPPLSISELSFALKRTLEERFGHVRLRGEVSKVN-RHASGHIYLTLKDDKSAI 72

Query: 65  DAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRK 124
           D +IWKG++  +   PE G+E +V GKIT++P  S YQI+IES+  +G+G LL  LE+ K
Sbjct: 73  DGVIWKGSVRGLGVQPEAGLEVIVTGKITSYPARSSYQIVIESMEAAGAGALLAQLERLK 132

Query: 125 KKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGD 184
            +L EEGLF    K P+P  P+ I VITSPTGAVIRD+L RI+ R+P RVI++PV VQG+
Sbjct: 133 VRLREEGLFEPGRKKPLPQFPRTIGVITSPTGAVIRDVLHRIAERWPCRVIVWPVVVQGE 192

Query: 185 ECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPII 244
               +++NAI   + +      PRPD++I+ARGGGS+EDLW FNDE + R +A + IPII
Sbjct: 193 AACGQVSNAIRGFDAMTVDGPIPRPDLLIVARGGGSVEDLWCFNDEGLARTVAAARIPII 252

Query: 245 SAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKI 304
           SA+GHETD TL D+ +D RAPTPTGAAE+A PV   L+ ++ +L+ R+     RLI+ + 
Sbjct: 253 SAVGHETDTTLIDFVSDRRAPTPTGAAEIATPVLADLRYAVADLDRRMVLAGGRLIEDRR 312

Query: 305 NTLNSLLKALP-NSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLI 363
             L ++ + LP   +  L+ ++ RLD     L   L+  +    RH      ++    L 
Sbjct: 313 TRLRAVARGLPARPEDLLALAQQRLDNAASRLGSGLQRNVALHERHLAVTGGKLSPALLR 372

Query: 364 HNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKL 423
             I++ +  +      +   ++  +        +  A L         R+      ++ L
Sbjct: 373 ARIERGQDRLRGAGDRLGAALQAGVARGERRLLQVSARLSPAP--LHRRLDQREARLQAL 430

Query: 424 ITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKT 483
             R++ ++  +++     ++  TR L +       K G+  +++ + ++IT    L    
Sbjct: 431 GARLDGVMPRRLERDADRLAGLTRALATLDPGRP-KPGFARVENPDGDWITSAATLEAGQ 489

Query: 484 RILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
            + + F DG   AI+          +   +     +     QG+LF
Sbjct: 490 AVRLVFGDGARGAIIDGG--DGRTASAPARPAPRPKPAAPGQGDLF 533


>gi|83858533|ref|ZP_00952055.1| putative exodeoxyribonuclease protein [Oceanicaulis alexandrii
           HTCC2633]
 gi|83853356|gb|EAP91208.1| putative exodeoxyribonuclease protein [Oceanicaulis alexandrii
           HTCC2633]
          Length = 484

 Score =  391 bits (1003), Expect = e-106,   Method: Composition-based stats.
 Identities = 189/532 (35%), Positives = 278/532 (52%), Gaps = 54/532 (10%)

Query: 4   FSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSR 63
            +  ++ + PEY+VSELS  LK  VE    HV VRGE+ G   +  SGH Y  +KD+ + 
Sbjct: 1   MTDASASNTPEYTVSELSNALKRTVEQAYDHVRVRGEL-GRVTVAKSGHVYLDMKDDKAV 59

Query: 64  IDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKR 123
           ID ++WKG    + F PEEG+E +  G+++TFPG SKYQ+IIE + P+G G L+  LE R
Sbjct: 60  IDGVMWKGVAAHLNFRPEEGLEVIAEGRLSTFPGRSKYQMIIERMEPAGEGALMALLEAR 119

Query: 124 KKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQG 183
           KK L  EGLFS   K  +PF+P++I V+TSPTGAVIRDIL R+  RFP+ V+++PV VQG
Sbjct: 120 KKALAAEGLFSPDGKRALPFLPRVIGVVTSPTGAVIRDILHRLEDRFPVHVLLWPVLVQG 179

Query: 184 DECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPI 243
           ++   +IA+AI   N ++ G   P PD++I+ARGGGSIEDLW FN+E +VRA A S IP+
Sbjct: 180 EKAADQIAHAIEGFNAIEPGGPVPVPDVLIVARGGGSIEDLWCFNEERVVRAAAASRIPL 239

Query: 244 ISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYK 303
           ISA+GHETD TL DYA+D RAPTPTGAAE+AVPV+  L   +    ARL + ++R +  K
Sbjct: 240 ISAVGHETDTTLIDYASDRRAPTPTGAAEIAVPVRRELVERISTTTARLMSALVRGLDRK 299

Query: 304 INTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLI 363
              L S  + LP+   TL+ +  +LD +   L    +  + RK         +++   L 
Sbjct: 300 AADLKSASRGLPSPRATLNENNQKLDFIASRLNGAAQSGLERKQTRLQAAALQMRPTALR 359

Query: 364 HNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKL 423
            ++        +    +EQ                                         
Sbjct: 360 RDLAIKGDRFQQSGARLEQA---------------------------------------- 379

Query: 424 ITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKT 483
                     ++     ++      L++ ++K+ L+RG+  ++D +   + Q   L +  
Sbjct: 380 -------FRRELGDQARTLGSLGARLEALSHKSVLRRGFALVKDESGALVRQGAALTSGQ 432

Query: 484 RILINFFDGQANAIVINKAPPKEQPT------KKCQLHNNKREKQGTQGELF 529
            + + F D    AIV   +              K    + K+     QG LF
Sbjct: 433 AVTLVFEDTTRGAIVDGASSASPSSASKPAARPKSATKSRKKPSSPDQGSLF 484


>gi|170744124|ref|YP_001772779.1| exodeoxyribonuclease VII, large subunit [Methylobacterium sp. 4-46]
 gi|168198398|gb|ACA20345.1| exodeoxyribonuclease VII, large subunit [Methylobacterium sp. 4-46]
          Length = 507

 Score =  391 bits (1003), Expect = e-106,   Method: Composition-based stats.
 Identities = 198/521 (38%), Positives = 283/521 (54%), Gaps = 32/521 (6%)

Query: 9   SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAII 68
             +  E+SV++L+  LK  +E    HV +RGEISGYRG H SGHAYFSLKD  ++IDA+I
Sbjct: 17  PANLTEWSVTDLAAALKRTLEDAFGHVRLRGEISGYRGPHGSGHAYFSLKDGGAKIDAVI 76

Query: 69  WKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLL 128
           WKGTL ++   P+EG+E +  G+ITTFPG S YQI+I+SL P+G+G  +  LE+R++ L 
Sbjct: 77  WKGTLARLRHRPKEGLEVVATGRITTFPGKSAYQIVIDSLEPAGAGAWMALLEERRRLLA 136

Query: 129 EEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPK 188
            EGLF    K P+P++P+++ V+TSPTGAVIRDIL R++ RFP  V+++PV+VQG+   +
Sbjct: 137 AEGLFDAARKRPLPYLPRVVGVVTSPTGAVIRDILHRLADRFPRPVLVWPVRVQGEGSAE 196

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           E+A AI   N L      PRPD++I+ARGGGSIEDLW FN+E++VRA A S+IP+I+A+G
Sbjct: 197 EVAAAIRGFNALAPDGPIPRPDVLIVARGGGSIEDLWSFNEEIVVRAAAASAIPLIAAVG 256

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HETD TL D+AAD RAPTPTGAAEMAVPV+  L + L  L  R    + RLI+ +   L 
Sbjct: 257 HETDVTLIDHAADRRAPTPTGAAEMAVPVRLDLVADLDGLARRHAASLARLIERRRADLR 316

Query: 309 SLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQK 368
            L + LP  +  L+  R RLD     L   L             ++  +       ++ +
Sbjct: 317 GLARVLPTPEGLLAVKRQRLDLAEARLRPALGEAARAAQGRLARLLQALGRHPPALHLAR 376

Query: 369 NRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIE 428
            R  +                                R   +  I      +  +  R+ 
Sbjct: 377 ARARLAGIDHR-------------------------PRHALERLIAVRAERLNGVAQRLA 411

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
              S  ++      +  + +  S  Y+  L+RGY  + D     + +        RI + 
Sbjct: 412 QAESRDLERRRARFAAASGLFDSLNYRAVLQRGYALVLDAEGRPVAEAEAARAAGRITVE 471

Query: 489 FFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
           F DG+  A+V   APP+    K+             Q  LF
Sbjct: 472 FQDGKVGAVV-EGAPPRRAAAKRGP------AAPARQTSLF 505


>gi|254361538|ref|ZP_04977676.1| exodeoxyribonuclease VII [Mannheimia haemolytica PHL213]
 gi|153093056|gb|EDN74072.1| exodeoxyribonuclease VII [Mannheimia haemolytica PHL213]
          Length = 486

 Score =  390 bits (1002), Expect = e-106,   Method: Composition-based stats.
 Identities = 145/492 (29%), Positives = 248/492 (50%), Gaps = 12/492 (2%)

Query: 12  HPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKG 71
               +V++L+Y ++H++E  +SH+ + GEIS +     SGH Y +LKD+ +++   ++K 
Sbjct: 2   SNILTVTQLNYSVRHLLEMEMSHIWLTGEISNF-SQPVSGHWYLTLKDDKAQVRCAMFKM 60

Query: 72  TLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEG 131
              ++ F P+ G++ LV   +T +     YQ+IIES+ P+G G L    E+ K KL  +G
Sbjct: 61  KNVRVNFRPQNGMQVLVRASVTLYEPRGDYQLIIESMQPAGEGLLQQQFEQLKAKLSAQG 120

Query: 132 LFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEI 190
           LF+ +HK PIP   K + +ITS +GA ++DIL  +  R P L V+I+P  VQG E  ++I
Sbjct: 121 LFAQEHKKPIPTFVKTVGIITSSSGAALQDILHILQRRDPSLSVVIYPALVQGKEATQDI 180

Query: 191 ANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHE 250
            N I   N   E       D++I+ RGGGS+EDLW FN+E +  AI +S IPIISA+GHE
Sbjct: 181 VNMIELANRRNE------CDVLIVGRGGGSLEDLWCFNEESVAYAIYHSQIPIISAVGHE 234

Query: 251 TDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSL 310
           TD T+AD+ ADLRAPTP+ AAE+    +  L+  + +   ++N    R+  +K N    L
Sbjct: 235 TDVTIADFVADLRAPTPSAAAELVSRDQNELKRQVQHQFDKVNLAFDRVWNHKFNRFQQL 294

Query: 311 LKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQK 368
              L   +  + +   + R D +   LE  +  ++  K +    +  R+        I++
Sbjct: 295 PLRLNAQHPSKQIQSQQQRFDYMEYRLEQAIYALVAAKKQVGKELNVRLIHQHPQKQIER 354

Query: 369 NRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIE 428
             Q + + +  +    +   +    ++K K       R     +++   T + K+  R+ 
Sbjct: 355 QSQMLKQLELKLH--WQMEQQLSKKQQKWKNITQRFERNPLPYQLYQQQTMVAKMSQRLA 412

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
           + +   +             L   +    L RGY+  Q  +   +T   N+     I+  
Sbjct: 413 YSIEKIMLKEQRHFQELCTKLDGLSPLKILTRGYSITQTKDGKTLTSTENIERGEAIITQ 472

Query: 489 FFDGQANAIVIN 500
              G+  + V++
Sbjct: 473 LKTGKIISQVVD 484


>gi|163868905|ref|YP_001610131.1| exodeoxyribonuclease VII large subunit [Bartonella tribocorum CIP
           105476]
 gi|189037855|sp|A9IXA1|EX7L_BART1 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|161018578|emb|CAK02136.1| exodeoxyribonuclease VII large subunit [Bartonella tribocorum CIP
           105476]
          Length = 476

 Score =  390 bits (1002), Expect = e-106,   Method: Composition-based stats.
 Identities = 211/530 (39%), Positives = 304/530 (57%), Gaps = 56/530 (10%)

Query: 1   MNPFSQKNS-LDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKD 59
           +N  S+K S  +  E++VSE++  LK +VE    +V VRGEISGYRG H+SGHAYF+LKD
Sbjct: 2   VNLLSEKTSGTNVAEFTVSEIAGALKRVVEEKFGYVRVRGEISGYRGAHASGHAYFALKD 61

Query: 60  NHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTA 119
           + +R++A+IW+G + K++F PEEG+E + +GK+TT+PGSSKYQI+IE+L P+G G L+T 
Sbjct: 62  DKARLEAVIWRGVMEKLKFPPEEGMEVVAVGKLTTYPGSSKYQIVIEALEPTGVGALMTL 121

Query: 120 LEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPV 179
           LE RKKK  EEGLF +  K P+P++P+II V+TSPTGAVIRDI+ RIS RFPL V+++PV
Sbjct: 122 LENRKKKFAEEGLFDEAKKKPLPYMPRIIGVVTSPTGAVIRDIIHRISDRFPLHVLVWPV 181

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
           +VQG+    E+A A+   N L      P+PD+II+ARGGGS+EDLW FNDE +VRA+  S
Sbjct: 182 RVQGETSGSEVAAAVEGFNALASEGHIPKPDLIIVARGGGSLEDLWGFNDEAVVRAVYAS 241

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
            +PIISA+GHETDWTL DY AD RAPTPTGAAE AVPVK  L+  + +L ARL   + R 
Sbjct: 242 DLPIISAVGHETDWTLIDYVADWRAPTPTGAAEKAVPVKLDLEVCVASLGARLRKGLARS 301

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
             +    L +  + LP++DQ  S  R   D +   L+  L +   +K   F+ +  R+  
Sbjct: 302 FDFHQQKLCAARRGLPSADQLFSLPRRGFDEISSRLQRALCVSYDKKRFSFHALHLRLSP 361

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH 419
             L    +K ++H  E    + +                                     
Sbjct: 362 RLL--KSEKAQRHTKEYTARLYRAFM---------------------------------- 385

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
                          ++   +++ +  R+L+S +Y+N L+RG+  +   N+  I +    
Sbjct: 386 -------------RSVEKKRSALELACRLLKSTSYQNILERGFVLVLGQNHKPIKRLAQF 432

Query: 480 ATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
               +I + FFDG  +         +E  +     H   +     QG LF
Sbjct: 433 PESGQINLRFFDGDIHV------ATQEPFSAARSKHKKIKSPSDDQGTLF 476


>gi|238895963|ref|YP_002920699.1| exodeoxyribonuclease VII large subunit [Klebsiella pneumoniae
           NTUH-K2044]
 gi|330007829|ref|ZP_08306087.1| exodeoxyribonuclease VII, large subunit [Klebsiella sp. MS 92-3]
 gi|238548281|dbj|BAH64632.1| exodeoxyribonuclease VII large subunit [Klebsiella pneumoniae
           subsp. pneumoniae NTUH-K2044]
 gi|328535317|gb|EGF61803.1| exodeoxyribonuclease VII, large subunit [Klebsiella sp. MS 92-3]
          Length = 463

 Score =  390 bits (1001), Expect = e-106,   Method: Composition-based stats.
 Identities = 147/513 (28%), Positives = 236/513 (46%), Gaps = 57/513 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    SSGH YF+LKD+++++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEREMGQVWISGEISNF-SQPSSGHWYFTLKDDNAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K +L
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAQL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  +HK  +P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 TAEGLFEQKHKQALPSPAHCVGVITSKTGAALHDILHVLRRRDPGLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N  +E       D++I+ RGGGS+EDLW FNDE + RAI  S IPI+SA
Sbjct: 182 PGQIVRAIALANARQE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASQIPIVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   L + + RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEIVSRNQQELLRQLQSGQQRLEMAMDYFLASRQRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              L   L      L  +R +   +RL + +   +E  + R  +     + R+       
Sbjct: 296 FTQLFHRLQQQHPQLRLARQQTALERLRQRMRIAVESQLKRAEQRQKRTVQRLNHYNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +I                                         
Sbjct: 356 RIHRAQSRIQQLEYRLAEI----------------------------------------- 374

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 +  ++             L++ +   TL RGY+    ++   + Q + + T   
Sbjct: 375 ------MRGRLSERRERFGNAVTHLEAVSPLATLARGYSVTSVSDGTVLKQTKQVKTGDL 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTKKCQLHNN 517
           +     DG   + V   AP K+   +K      
Sbjct: 429 LTTRLKDGWVESEVKQIAPVKKTRARKPSPTKP 461


>gi|152971366|ref|YP_001336475.1| exodeoxyribonuclease VII large subunit [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|166232356|sp|A6TCC4|EX7L_KLEP7 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|150956215|gb|ABR78245.1| exodeoxyribonuclease VII large subunit [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
          Length = 463

 Score =  389 bits (1000), Expect = e-106,   Method: Composition-based stats.
 Identities = 147/513 (28%), Positives = 236/513 (46%), Gaps = 57/513 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    SSGH YF+LKD+++++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEREMGQVWISGEISNF-SQPSSGHWYFTLKDDNAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K +L
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAQL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  +HK  +P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 TAEGLFEQKHKQALPSPAHCVGVITSKTGAALHDILHVLRRRDPGLPVIIYPTSVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N  +E       D++I+ RGGGS+EDLW FNDE + RAI  S IPI+SA
Sbjct: 182 PGQIVRAIALANARQE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASQIPIVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   L + + RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEIVSRNQQELLRQLQSGQQRLEMAMDYFLASRQRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              L   L      L  +R +   +RL + +   +E  + R  +     + R+       
Sbjct: 296 FTQLFHRLQQQHPQLRLARQQTALERLRQRMRIAVESQLKRAEQRQKRTVQRLNHYNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +I                                         
Sbjct: 356 RIHRAQSRIQQLEYRLAEI----------------------------------------- 374

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 +  ++             L++ +   TL RGY+    ++   + Q + + T   
Sbjct: 375 ------MRGRLSERRERFGNAVTHLEAVSPLATLARGYSVTSVSDGTVLKQTKQVKTGDL 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTKKCQLHNN 517
           +     DG   + V   AP K+   +K      
Sbjct: 429 LTTRLKDGWVESEVKQIAPVKKTRARKPSPTKP 461


>gi|290508299|ref|ZP_06547670.1| exodeoxyribonuclease VII, large subunit [Klebsiella sp. 1_1_55]
 gi|289777693|gb|EFD85690.1| exodeoxyribonuclease VII, large subunit [Klebsiella sp. 1_1_55]
          Length = 463

 Score =  389 bits (1000), Expect = e-106,   Method: Composition-based stats.
 Identities = 146/513 (28%), Positives = 235/513 (45%), Gaps = 57/513 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    SSGH YF+LKD+++++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEREMGQVWISGEISNF-SQPSSGHWYFTLKDDNAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K +L
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAQL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  +HK  +P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 TAEGLFEQKHKQALPSPAHCVGVITSKTGAALHDILHVLRRRDPGLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N  +E       D++I+ RGGGS+EDLW FNDE + RAI  S IPI+SA
Sbjct: 182 PGQIVRAIALANARQE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASQIPIVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   L + + RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEIVSRNQQELLRQLQSGQQRLEMAMDYFLASRQRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              L   L      L  +R +   +RL + +   +E  + R  +     + R+       
Sbjct: 296 FTQLFHRLQQQHPQLRLARQQTALERLRQRMRIAVESQLKRAEQRQKRTVQRLDHYNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +                                          
Sbjct: 356 RIHRAQSRIQQLEYRLAE------------------------------------------ 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 +  ++             L++ +   TL RGY+    ++   + Q + + T   
Sbjct: 374 -----NMRGRLSERRERFGNAVTHLEAVSPLATLARGYSVTSVSDGTVLKQTKQVKTGDL 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTKKCQLHNN 517
           +     DG   + V   AP K+   +K      
Sbjct: 429 LTTRLKDGWVESEVKQIAPVKKTRARKPSPAKP 461


>gi|288934101|ref|YP_003438160.1| exodeoxyribonuclease VII large subunit [Klebsiella variicola At-22]
 gi|288888830|gb|ADC57148.1| exodeoxyribonuclease VII, large subunit [Klebsiella variicola
           At-22]
          Length = 463

 Score =  389 bits (1000), Expect = e-106,   Method: Composition-based stats.
 Identities = 147/513 (28%), Positives = 235/513 (45%), Gaps = 57/513 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    SSGH YF+LKD+++++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEREMGQVWISGEISNF-SQPSSGHWYFTLKDDNAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K +L
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAQL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  +HK  +P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 TAEGLFEQKHKQALPSPAHCVGVITSKTGAALHDILHVLRRRDPGLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N  +E       D++I+ RGGGS+EDLW FNDE + RAI  S IPI+SA
Sbjct: 182 PGQIVRAIALANARQE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASQIPIVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   L + + RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEIVSRNQQELLRQLQSGQQRLEMAMDYFLASRQRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              L   L      L  +R +   +RL + +   +E  I R  +     + R+       
Sbjct: 296 FTQLFHRLQQQHPQLRLARQQTALERLRQRMRIAVESQIKRAEQRQKRTVQRLDHYNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +                                          
Sbjct: 356 RIHRAQSRIQQLEYRLAE------------------------------------------ 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 +  ++             L++ +   TL RGY+    ++   + Q + + T   
Sbjct: 374 -----NMRGRLSERRERFGNAVTHLEAVSPLATLARGYSVTSVSDGTVLKQTKQVKTGDL 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTKKCQLHNN 517
           +     DG   + V   AP K+   +K      
Sbjct: 429 LTTRLKDGWVESEVKQIAPVKKTRARKPSPAKP 461


>gi|206579351|ref|YP_002237142.1| exodeoxyribonuclease VII, large subunit [Klebsiella pneumoniae 342]
 gi|226736766|sp|B5XNM2|EX7L_KLEP3 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|206568409|gb|ACI10185.1| exodeoxyribonuclease VII, large subunit [Klebsiella pneumoniae 342]
          Length = 463

 Score =  389 bits (999), Expect = e-106,   Method: Composition-based stats.
 Identities = 146/513 (28%), Positives = 234/513 (45%), Gaps = 57/513 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    SSGH YF+LKD+++++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEREMGQVWISGEISNF-SQPSSGHWYFTLKDDNAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K +L
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAQL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  +HK  +P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 TAEGLFEQKHKQALPSPAHCVGVITSKTGAALHDILHVLRRRDPGLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N  +E       D++I+ RGGGS+EDLW FNDE + RAI  S IPI+SA
Sbjct: 182 PGQIVRAIALANARQE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASQIPIVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   L + + RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEIVSRNQQELLRQLQSGQQRLEMAMDYFLASRQRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              L   L      L  +R +   +RL + +   +E  + R  +     + R+       
Sbjct: 296 FTQLFHRLQQQHPQLRLARQQTALERLRQRMRIAVESQLKRAEQRQKRTVQRLDHYNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +                                          
Sbjct: 356 RIHRAQSRIQQLEYRLAE------------------------------------------ 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 +  ++             L++ +   TL RGY+     +   + Q + + T   
Sbjct: 374 -----NMRGRLSERRERFGNAVTHLEAVSPLATLARGYSVTSVNDGTVLKQTKQVKTGDL 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTKKCQLHNN 517
           +     DG   + V   AP K+   +K      
Sbjct: 429 LTTRLKDGWVESEVKQIAPVKKTRARKPSPTKP 461


>gi|254511401|ref|ZP_05123468.1| exodeoxyribonuclease VII, large subunit [Rhodobacteraceae bacterium
           KLH11]
 gi|221535112|gb|EEE38100.1| exodeoxyribonuclease VII, large subunit [Rhodobacteraceae bacterium
           KLH11]
          Length = 495

 Score =  389 bits (998), Expect = e-106,   Method: Composition-based stats.
 Identities = 182/531 (34%), Positives = 268/531 (50%), Gaps = 38/531 (7%)

Query: 1   MNPFSQKN--SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLK 58
           M+          + PEYSVS++S  +K  +E     + VRGE+ G      SGH Y+ +K
Sbjct: 1   MSDLLDDPVPGQNTPEYSVSDISGEVKRTLEGTFGRIRVRGEV-GRVFKARSGHLYYDIK 59

Query: 59  DNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLT 118
           D+ + +    WKG ++ +  +PEEG+E +V G++T F   SKY + ++ +  +G G L+ 
Sbjct: 60  DDRNVLACTTWKGQISGLSVVPEEGLEVVVTGRLTAFGAQSKYNLNVDEVAVAGQGALMA 119

Query: 119 ALEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFP 178
            LEKRKK+L  EGLF+ + K P+P++P+II VITSP+GAVIRDIL R+  RFP +V+I+P
Sbjct: 120 LLEKRKKQLESEGLFAPERKKPLPYLPQIIGVITSPSGAVIRDILHRLRDRFPRKVLIWP 179

Query: 179 VKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIAN 238
           V VQG  C  E+  AI   N L  G   PRPD+II+ARGGGSIEDLW FN+E + RA A 
Sbjct: 180 VAVQGANCAPEVTRAIEGFNQLTPGGALPRPDLIIVARGGGSIEDLWGFNEENVARAAAA 239

Query: 239 SSIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIR 298
           S+IP+ISA+GHETD TL DY +D RAPTPT AAE+AVPV+  L +      ARL+     
Sbjct: 240 SAIPLISAVGHETDTTLIDYVSDRRAPTPTAAAELAVPVRMELLAWTREQGARLSRAATD 299

Query: 299 LIKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIK 358
            ++ +   L  L +ALP  +  L   R RLD+    L + L   +  +          ++
Sbjct: 300 AVQRRSQRLRDLARALPRPETLLDSPRQRLDQAAERLPNALIRGVQTRRVKLLDSAAHLR 359

Query: 359 SDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHT 418
              L + +   R         +                             +  +     
Sbjct: 360 PSTLRNLVATRRDRWHNLSSRLS------------------------LRPIQRELTTRRD 395

Query: 419 HIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRN 478
            + +L  R+      ++   H  +  T R+ ++ +YK TL+RGY  I+   ++ +T+K  
Sbjct: 396 TLNRLTERLNTAQITRLDRLHQQLDATDRLRETLSYKATLERGYAVIR-AGDHVLTRKAQ 454

Query: 479 LATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
               T   I F DG  N                 +     +     QG LF
Sbjct: 455 AEKHTTFEIEFADGTLNT----------GQGGGAKPKRTPKPPAPDQGSLF 495


>gi|126740019|ref|ZP_01755709.1| exodeoxyribonuclease VII, large subunit [Roseobacter sp. SK209-2-6]
 gi|126718838|gb|EBA15550.1| exodeoxyribonuclease VII, large subunit [Roseobacter sp. SK209-2-6]
          Length = 544

 Score =  389 bits (998), Expect = e-106,   Method: Composition-based stats.
 Identities = 179/545 (32%), Positives = 275/545 (50%), Gaps = 42/545 (7%)

Query: 1   MNPFSQ--KNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLK 58
           M+      +   + PE+SVSE+S  +K  +E     + V+GE+ G      SGH Y+ +K
Sbjct: 26  MSDLFDDPQPGQNTPEFSVSEISGEVKRTLEGTFGRIRVKGEV-GRVFKARSGHLYYDIK 84

Query: 59  DNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLT 118
           D+ S +    WKG ++ +  +PEEG+E +V G++T F   SKY + ++ +  +G G L+ 
Sbjct: 85  DDRSVLACTTWKGQISSLSVVPEEGLEVVVTGRLTAFGAQSKYNMNVDEVAVAGQGALMA 144

Query: 119 ALEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFP 178
            LEKRKK+L  EGLF+ + K P+P++P+II V+TSP+GAVIRDIL R+  RFP +V+++P
Sbjct: 145 LLEKRKKQLEAEGLFAMERKKPLPYLPQIIGVVTSPSGAVIRDILHRLRDRFPRKVLVWP 204

Query: 179 VKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIAN 238
           V VQG  C  E+A AI   N L  G   PRPD+II+ARGGG+IEDLW FN+E++ RA A 
Sbjct: 205 VAVQGQNCAPEVARAIEGFNRLTPGGALPRPDLIIVARGGGAIEDLWGFNEEIVARAAAA 264

Query: 239 SSIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIR 298
           S IP+ISA+GHETD TL D+ +DLRAPTPT AAE AVPV+  L +      ARL   + +
Sbjct: 265 SEIPLISAVGHETDTTLIDFVSDLRAPTPTAAAEHAVPVRLELMAWSEAQGARLTRGVSQ 324

Query: 299 LIKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIK 358
            ++ +   LN L +A+P  +  L   R RLDR+   L   L   + ++    +     ++
Sbjct: 325 AVQQRRQRLNDLSRAIPRPETLLETPRQRLDRVSETLPRALMAGVQKRQVTLSRAAAALR 384

Query: 359 SDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHT 418
              L   +   +  +      +                                +     
Sbjct: 385 PATLRQLVSSRQDRLRNLSSRLS------------------------PRPLDQEVDRQKE 420

Query: 419 HIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRN 478
            + +L  R++     +++    S++   R L+  +YK TL RGY  ++   +  IT    
Sbjct: 421 QLSRLGIRLKSAQDLRLERMQRSLATAGRQLEILSYKATLDRGYAVVRSGAD-LITSSVE 479

Query: 479 LATKTRILINFFDGQANAIVINKAPPKEQPTKKCQ--------------LHNNKREKQGT 524
                 + I F DG+       +A  +     + +                    +  G 
Sbjct: 480 AQNAGPLTIEFADGEFRLENTEEAATEAASGPQQKSASSKQVTSKPVKQTKAKPEKPDGE 539

Query: 525 QGELF 529
           QG LF
Sbjct: 540 QGSLF 544


>gi|262040241|ref|ZP_06013492.1| exodeoxyribonuclease 7 large subunit [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259042350|gb|EEW43370.1| exodeoxyribonuclease 7 large subunit [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 463

 Score =  388 bits (997), Expect = e-106,   Method: Composition-based stats.
 Identities = 146/513 (28%), Positives = 236/513 (46%), Gaps = 57/513 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    SSGH YF+LKD+++++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEREMGQVWISGEISNF-SQPSSGHWYFTLKDDNAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K +L
Sbjct: 62  MFRNSNRRVTFHPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAQL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  +HK  +P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 TAEGLFEQKHKQALPSPAHCVGVITSKTGAALHDILHVLRRRDPGLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N  +E       D++I+ RGGGS+EDLW FNDE + RAI  S IPI+SA
Sbjct: 182 PGQIVRAIALANARQE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASQIPIVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   L + + RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEIVSRNQQELLRQLQSGQQRLEMAMDYFLASRQRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              L   L      L  +R +   +RL + +   +E  + R  +     + R+       
Sbjct: 296 FTQLFHRLQQQHPQLRLARQQTALERLRQRMRIAVESQLKRAEQRQKRTVQRLNHYNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +I                                         
Sbjct: 356 RIHRAQSRIQQLEYRLAEI----------------------------------------- 374

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 +  ++             L++ +   TL RGY+    ++   + Q + + T   
Sbjct: 375 ------MRGRLSERRERFGNAVTHLEAVSPLATLARGYSVTSVSDGTVLKQTKQVKTGDL 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTKKCQLHNN 517
           +     DG   + V   AP K+   ++      
Sbjct: 429 LTTRLKDGWVESEVKQIAPVKKTRARRPSPTKP 461


>gi|307250047|ref|ZP_07532011.1| Exodeoxyribonuclease 7 large subunit [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|306857907|gb|EFM89999.1| Exodeoxyribonuclease 7 large subunit [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
          Length = 517

 Score =  388 bits (997), Expect = e-105,   Method: Composition-based stats.
 Identities = 143/494 (28%), Positives = 247/494 (50%), Gaps = 12/494 (2%)

Query: 12  HPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKG 71
           +   ++++L+Y +++++E+ L  V + GEIS +     SGH Y +LKD ++++   +++ 
Sbjct: 33  NNILTITQLNYSVRNLLETELGQVWLTGEISNF-SQPVSGHWYLTLKDENAQVRGAMFRM 91

Query: 72  TLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEG 131
              ++ F P+ G++ LV   ++ +     YQIIIES+ P+G G L    E+ K KL  EG
Sbjct: 92  KNQRVTFRPQNGMQVLVRASVSLYEPRGDYQIIIESMQPAGDGLLQQQFEQLKMKLAAEG 151

Query: 132 LFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEI 190
           LF+ + K  IP   K + +ITS +GA ++DIL  +  R P L +II+P  VQG E  ++I
Sbjct: 152 LFAQEKKKAIPPFAKRVGIITSSSGAALQDILNILKRRDPSLAIIIYPTLVQGKEATQDI 211

Query: 191 ANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHE 250
            N I   N  +E       D++I+ RGGGS+EDLW FN+E +  AI  S IPIISA+GHE
Sbjct: 212 VNTIDLANRRRE------CDVLIVGRGGGSLEDLWCFNEEAVAHAIFRSDIPIISAVGHE 265

Query: 251 TDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSL 310
           TD T+AD+ ADLRAPTP+ AAE+    ++ L   L +   +L+    RL   K      L
Sbjct: 266 TDVTIADFVADLRAPTPSAAAELVSRDQQELVRQLQHQFDKLSLAFDRLWTEKQTYFERL 325

Query: 311 LKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQK 368
              L   +  + +   + RL +    LE+ +      + +    ++ R+ +      +Q+
Sbjct: 326 KLRLNAQHPARQIQMQQQRLAQFSYRLENAIHKTYLTEKQKLEQLLLRLTNQHPQRQLQQ 385

Query: 369 NRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIE 428
            +  + + +  + Q ++Q L     + K  +  +   R      +   +    +L  R++
Sbjct: 386 QQMQLKQAEYRLAQAIEQTLIRKQNQWKHIVKQVK--RNPLPYCVEKKNQQYAQLAQRLQ 443

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
           F +  K+     +       +   +    L RGY+  Q +    +    NL   T+I   
Sbjct: 444 FAIEKKLTKEQQAFQELCTRIDGLSPLKILARGYSVTQTSKGEILRSTENLKVGTQITTK 503

Query: 489 FFDGQANAIVINKA 502
              G+  + +I   
Sbjct: 504 LSQGEIVSEIIKIN 517


>gi|294013432|ref|YP_003546892.1| exodeoxyribonuclease VII large subunit [Sphingobium japonicum
           UT26S]
 gi|292676762|dbj|BAI98280.1| exodeoxyribonuclease VII large subunit [Sphingobium japonicum
           UT26S]
          Length = 499

 Score =  388 bits (996), Expect = e-105,   Method: Composition-based stats.
 Identities = 181/531 (34%), Positives = 270/531 (50%), Gaps = 55/531 (10%)

Query: 4   FSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSR 63
             +++  + P  SVSELS  LK  VE    HV +RGEISG++    SGH Y  LKD+++ 
Sbjct: 17  AEERSGDNAPPLSVSELSALLKRTVEDRFGHVRLRGEISGFK-RAGSGHIYLCLKDDNAV 75

Query: 64  IDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKR 123
           ID ++WKG   ++ F P++G+E +  GK+TT+PG SKYQI+I+ +  +G G L+  LEK 
Sbjct: 76  IDGVMWKGGAARLPFAPQDGVEVIATGKLTTYPGRSKYQIVIDRMELAGEGALMALLEKL 135

Query: 124 KKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQG 183
           K+KL  EGLF    K  +PF+P++I V+TSPTGAVIRDIL R+  R P +V+++PV VQG
Sbjct: 136 KQKLAAEGLFDRSAKRRLPFMPRVIGVVTSPTGAVIRDILHRLEDRCPTQVLLWPVLVQG 195

Query: 184 DECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPI 243
               +++A A+   + ++ G   PRPD++I+ARGGGSIEDLW FN+E++VRA+A SSIPI
Sbjct: 196 QGAAEQVARAVRGFSAMQPGGPIPRPDLVIVARGGGSIEDLWSFNEEIVVRAVAESSIPI 255

Query: 244 ISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYK 303
           ISA+GHETD TL DYAAD+RAPTPT AAEMAVPV+  L + L     R++  + R     
Sbjct: 256 ISAVGHETDTTLCDYAADMRAPTPTAAAEMAVPVRAELLAMLTEQGLRMDRAVRRGAAQA 315

Query: 304 INTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLI 363
              L+   + +P  D  L+  R RLD+L   L   L   I     H       ++   L 
Sbjct: 316 RERLDMQARLMPTPDTLLAPQRQRLDQLSDGLASALRHRIADARTHLGQAGGALRPALLR 375

Query: 364 HNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKL 423
             + +  + +   Q   + + + +                                    
Sbjct: 376 QYVNRAAERVARLQLRPDYLERVYRDRATA------------------------------ 405

Query: 424 ITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKT 483
                                 +R+  S      L+RG+  +    +  +    +     
Sbjct: 406 ------------------FDRVSRLFTSVNPDLPLQRGFARVM-AGDRLVKSVADAKAAG 446

Query: 484 RILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQ-----GTQGELF 529
            + ++F DG   A +    P ++ P +     +    K        Q +LF
Sbjct: 447 AVSLHFRDGAVGATIEGGTPLEKPPAQAISNPSRPPRKPREGEEAGQPDLF 497


>gi|260598893|ref|YP_003211464.1| exodeoxyribonuclease VII large subunit [Cronobacter turicensis
           z3032]
 gi|260218070|emb|CBA32811.1| Exodeoxyribonuclease 7 large subunit [Cronobacter turicensis z3032]
          Length = 457

 Score =  387 bits (994), Expect = e-105,   Method: Composition-based stats.
 Identities = 143/512 (27%), Positives = 235/512 (45%), Gaps = 61/512 (11%)

Query: 3   PFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHS 62
           P +   S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +
Sbjct: 2   PLTPTPS----IFTVSRLNQSVRLLLEQEMGQVWISGEISNFT-QPASGHWYFTLKDDTA 56

Query: 63  RIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEK 122
           ++   +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+
Sbjct: 57  QVRCAMFRNSNRRVTFRPQHGQQVLVRATITLYEPRGDYQIIVESMQPAGEGLLQQRYEQ 116

Query: 123 RKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKV 181
            K++L  EGLF    K P+P   + + VITS TGA + D+L  +  R P L V+I+P  V
Sbjct: 117 LKQQLAAEGLFDPALKKPLPSPARQVGVITSKTGAALHDVLNVLRRRDPSLPVVIYPTAV 176

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QGD+ P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S I
Sbjct: 177 QGDDAPAQIVRAIELANLRDE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRI 230

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           PI+SA+GHETD T+AD+ ADLRAPTP+ AAEM    +  L   +  L+ RL   +   + 
Sbjct: 231 PIVSAVGHETDVTIADFVADLRAPTPSAAAEMVSRNQLELLRQVQGLQQRLEMAMDYSLA 290

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
            +      L   L      L  +R +    RL + +++ L+  + +  +    +  R+  
Sbjct: 291 NRQQRFTRLHHRLEQQHPQLRLARQQTLLMRLRQRMDNALDSRMRQATQRQTRLTQRLNQ 350

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH 419
              +  + +    I + +  + Q+                                    
Sbjct: 351 QQPLPRLHRASARIQQLEYRLAQL------------------------------------ 374

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
                      ++ ++             L++ +   TL RGY+     + N +   + +
Sbjct: 375 -----------VTARLSHTRERFGNAITHLEAVSPLATLARGYSVTTAQDGNVLKATKQV 423

Query: 480 ATKTRILINFFDGQANAIVINKAPPKEQPTKK 511
                +     DG   + V    P K+   KK
Sbjct: 424 QPGDTLTTRLADGWVESEVRQITPAKKTRKKK 455


>gi|254490067|ref|ZP_05103260.1| exodeoxyribonuclease VII, large subunit [Methylophaga thiooxidans
           DMS010]
 gi|224464731|gb|EEF80987.1| exodeoxyribonuclease VII, large subunit [Methylophaga thiooxydans
           DMS010]
          Length = 485

 Score =  387 bits (994), Expect = e-105,   Method: Composition-based stats.
 Identities = 144/493 (29%), Positives = 256/493 (51%), Gaps = 13/493 (2%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
            Y VS L    + ++E +   + V GEIS    + +SGH YF+LKD  +++   +++   
Sbjct: 4   VYPVSRLVREARVLLEGSFPLLWVEGEISNL-AMPASGHIYFTLKDEAAQVRCAMFRNRN 62

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            ++ F PE G++ L+  ++T + G  ++Q+++E +  +GSG L  A E  K++L +EGLF
Sbjct: 63  RQLRFTPENGMQVLLRVRVTLYEGRGEFQLVVEHMEEAGSGALQRAYEALKQRLGQEGLF 122

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIAN 192
            D HK PIP +P  I +I+SP GA + DI+  +  RFP   VI++PV VQG+   +++ +
Sbjct: 123 DDAHKKPIPALPHTIGIISSPDGAAVHDIVSVLKRRFPAAAVILYPVAVQGEAAARQLVD 182

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           A+   +  K+       D++I+ RGGGS+EDLW FNDE + RA+ N  +P+ISA+GHE D
Sbjct: 183 AVKLADHRKD------CDVLIIGRGGGSLEDLWSFNDEQLARALFNCELPVISAVGHEID 236

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ AD+RAPTP+ AAE+AVP  + L + +  L  RL  +  + +  +   L  L +
Sbjct: 237 FTIADFVADVRAPTPSAAAEIAVPDAKQLLAKIQGLTQRLTVMTKQWLVSEQRHLQHLQR 296

Query: 313 ALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQH 372
            LP  D  L+  R  L++  + L    + I+    +  +++  R+K       I K +  
Sbjct: 297 RLPRPDVQLNQQRQVLNQQTKLLGSAWQRILMSSQQKLDYLSARLK--HPQAQIDKQQSK 354

Query: 373 ILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILS 432
           +   Q  + Q  +   ++           LH  R+   + +   H  +  +  +++ ++ 
Sbjct: 355 LAALQHRLGQAFRAEFKHSETALLSLQQRLH--RQLPTHAVIRHHEALSLVRKQLDRLML 412

Query: 433 HKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNN-NFITQKRNLATKTRILINFFD 491
            ++ +   ++    R L + +  NTL+RGY+          +T    +     I +    
Sbjct: 413 MQLDTAKQALKQQVRTLAAVSPLNTLERGYSITTRQQTAEVLTHAETVEKGEMIEVRLLQ 472

Query: 492 GQANAIVINKAPP 504
           G     V + +  
Sbjct: 473 GHLACEVKSVSKK 485


>gi|254466447|ref|ZP_05079858.1| exodeoxyribonuclease VII, large subunit [Rhodobacterales bacterium
           Y4I]
 gi|206687355|gb|EDZ47837.1| exodeoxyribonuclease VII, large subunit [Rhodobacterales bacterium
           Y4I]
          Length = 502

 Score =  387 bits (993), Expect = e-105,   Method: Composition-based stats.
 Identities = 186/528 (35%), Positives = 279/528 (52%), Gaps = 34/528 (6%)

Query: 2   NPFS-QKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           +P    +   + PE++VSE+S  +K  +E     + VRGE+ G      SGH Y+ +KD+
Sbjct: 7   DPIPSDRPGQNAPEFTVSEISGEVKRTLEGTFGRIRVRGEV-GRVFKARSGHLYYDIKDD 65

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            S +    WKG ++ +  +PEEG+E +V G++T F   SKY + ++ +  +G G L+  L
Sbjct: 66  RSVLACTTWKGQISGLSVVPEEGLEVVVTGRLTAFGAQSKYNMNVDEVAVAGQGALMALL 125

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           EKRKK+L  EGLF+ + K P+P++P+II V+TSP+GAVIRDIL R+  RFP +V+++PV 
Sbjct: 126 EKRKKQLEAEGLFAPERKKPLPYLPQIIGVVTSPSGAVIRDILHRLRDRFPRKVLVWPVA 185

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQG  C  E+A AI   N L  G   PRPD+II+ARGGGSIEDLW FN+E++ RA A S 
Sbjct: 186 VQGQNCAPEVARAIDGFNRLTPGGALPRPDLIIVARGGGSIEDLWGFNEEIVARAAAASQ 245

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP+ISA+GHETD TL D+ +D RAPTPT AAE+AVPV+  L +      ARL     + +
Sbjct: 246 IPLISAVGHETDTTLIDFVSDRRAPTPTAAAELAVPVRLELMAWTETQGARLTRAAGQAV 305

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           + +   LN L +ALP  D  L   R RLDR+   L   L   + R+  H +     ++  
Sbjct: 306 QLRRQRLNDLARALPKPDTLLETPRQRLDRISDRLPGALISGVQRRRVHLSETAASLRPA 365

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420
            L   ++  R  +      +                             +  +      +
Sbjct: 366 TLRQLVEGRRNRLQNLSSRLS------------------------LRPIQREMAAQKDAL 401

Query: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480
            +L  R++   + +I     +++ T R L+  +YK TL+RGY  ++  +   +T +   A
Sbjct: 402 GRLAQRLDAAQAVRIDRQRQALTATGRQLEILSYKATLERGYAVVRSGD-EILTTRAAAA 460

Query: 481 TKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGEL 528
               + I F DG  +   +         T+      N   K G QG L
Sbjct: 461 KAGALQIEFADGTLD---LGGGAADAPKTEGP----NPLAKGGGQGTL 501


>gi|42521827|ref|NP_967207.1| exodeoxyribonuclease VII, large subunit [Bdellovibrio bacteriovorus
           HD100]
 gi|39574357|emb|CAE77861.1| exodeoxyribonuclease VII, large subunit [Bdellovibrio bacteriovorus
           HD100]
          Length = 468

 Score =  386 bits (992), Expect = e-105,   Method: Composition-based stats.
 Identities = 149/494 (30%), Positives = 238/494 (48%), Gaps = 59/494 (11%)

Query: 11  DHP-EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIW 69
           + P   SV +L+ ++K ++E  +  V V+GEIS ++  H+SGH YFSLKD+ S+I A+++
Sbjct: 30  NEPSVLSVEQLNIYVKQLLEGQIGQVWVKGEISNFKA-HTSGHFYFSLKDSRSQITAVMF 88

Query: 70  KGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLE 129
           +G   +++F P +G+E +V G+IT +     YQ++ E + P G+G L  A E+ K KL  
Sbjct: 89  RGNNARLKFKPTDGMEVIVRGRITVYEPRGNYQLMCEMMEPVGAGALQKAFEQLKMKLKA 148

Query: 130 EGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRF-PLRVIIFPVKVQGDECPK 188
           EGLF    K PIP  P+ IA++TSPTGA IRDIL  +S R   ++V + P  VQG+    
Sbjct: 149 EGLFESARKKPIPTFPRHIAIVTSPTGAAIRDILNVLSRRAKAIQVTVVPTIVQGEAAAP 208

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           +I  A  +   L      P  D++I+ RGGGSIED+W FNDE + R IA S +P+ISA+G
Sbjct: 209 QICEAFKKATAL------PGVDVVIVGRGGGSIEDMWCFNDERLARLIAASPVPVISAVG 262

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HE D+T+AD+ ADLRAPTP+ AAE+       L + +++LE  L+    + +K+    + 
Sbjct: 263 HEIDFTIADFVADLRAPTPSAAAELVAKSSGELANKVVSLERMLHLTFEKKMKFLREKML 322

Query: 309 SLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQK 368
            L K L +  + L     R D L   LE  +   +  +      +  ++        I +
Sbjct: 323 GLSKRLVDPKRRLQDLELRNDDLLNRLEFAINRRLAERRHRVELMSQKLG--SPQDLIDE 380

Query: 369 NRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIE 428
            ++ +   +   E+ +                                            
Sbjct: 381 KKKDLEYLKARSEKALHFS----------------------------------------- 399

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
                 I+     +     +L S +    ++RGY+ +   N+  I     +     + I 
Sbjct: 400 ------IERKKARMGKVMAMLDSLSPLKVVERGYSIVT-KNSEVIKSASQVKKGDLLDIR 452

Query: 489 FFDGQANAIVINKA 502
              G   AIV    
Sbjct: 453 LAQGSVTAIVDGVK 466


>gi|296104183|ref|YP_003614329.1| exodeoxyribonuclease VII large subunit [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295058642|gb|ADF63380.1| exodeoxyribonuclease VII large subunit [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 457

 Score =  386 bits (992), Expect = e-105,   Method: Composition-based stats.
 Identities = 145/509 (28%), Positives = 234/509 (45%), Gaps = 57/509 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           +S     Y+VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   SSQSPSIYTVSRLNQTVRLLLEQEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K  L
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAAL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
            +EGLF  Q+K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 SQEGLFDQQYKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N  +E       D++I+ RGGGS+EDLW FNDE + RAI  S+IPI+SA
Sbjct: 182 PGQIVRAIELANARQE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASAIPIVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    +  L   + N + RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQLELLRQIQNCQQRLEMAMDYFLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              L   L      L  +R +   +RL + +   L+  + R       +  R+       
Sbjct: 296 FTQLHHRLQQQHPQLRLARQQTVLERLRQRMNFALDNQLKRAMSRQQRVTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +                                          
Sbjct: 356 RIYRAQTRIQQLEYRLAE------------------------------------------ 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 +  ++ +           L++ +  +TL RGY+    T+   + Q + +     
Sbjct: 374 -----TVRARLSTTRERFGNAVTHLEAVSPLSTLARGYSVTTATDGKVLKQTKQVKAGDV 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTKKCQ 513
           +     DG   + V      K+   +K  
Sbjct: 429 LTTRLSDGWVESEVKGVMSVKKPRARKKA 457


>gi|307256866|ref|ZP_07538644.1| Exodeoxyribonuclease 7 large subunit [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306864600|gb|EFM96505.1| Exodeoxyribonuclease 7 large subunit [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
          Length = 517

 Score =  386 bits (991), Expect = e-105,   Method: Composition-based stats.
 Identities = 142/494 (28%), Positives = 246/494 (49%), Gaps = 12/494 (2%)

Query: 12  HPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKG 71
           +   ++++L+Y +++++E+ L  V + GEIS +     SGH Y +LKD ++++   +++ 
Sbjct: 33  NNILTITQLNYSVRNLLETELGQVWLTGEISNF-SQPVSGHWYLTLKDENAQVRGAMFRM 91

Query: 72  TLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEG 131
              ++ F P+ G++ LV   ++ +     YQIIIES+ P+G G L    E+ K KL  EG
Sbjct: 92  KNQRVTFRPQNGMQVLVRASVSLYEPRGDYQIIIESMQPAGDGLLQQQFEQLKMKLAAEG 151

Query: 132 LFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEI 190
           LF+ + K  IP   K + +ITS +GA ++DIL  +  R P L +II+P  VQG E  ++I
Sbjct: 152 LFAQEKKKAIPPFAKRVGIITSSSGAALQDILNILKRRDPSLAIIIYPTLVQGKEATQDI 211

Query: 191 ANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHE 250
            N I   N  +E       D++I+ RGGGS+EDLW FN+E +  AI  S IPIISA+GHE
Sbjct: 212 VNTIDLANRRRE------CDVLIVGRGGGSLEDLWCFNEEAVAHAIFRSDIPIISAVGHE 265

Query: 251 TDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSL 310
           TD T+AD+ ADLRAPTP+ AAE+    ++ L   L +   +L+    RL   K      L
Sbjct: 266 TDVTIADFVADLRAPTPSAAAELVSRDQQELVRQLQHQFDKLSLAFDRLWTEKQTYFERL 325

Query: 311 LKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQK 368
              L   +  + +   + RL +    LE+ +      + +    ++ R+ +      +Q+
Sbjct: 326 KLRLNAQHPARQVQMQQQRLAQFSYRLENAIHKTYLTEKQKLEQLLLRLTNQHPQRQLQQ 385

Query: 369 NRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIE 428
            +  + + +  + Q ++Q L     + K  +  +   R      +   +    +L  R++
Sbjct: 386 QQMQLKQAEYRLAQAIEQTLIRKQNQWKHIVEQVK--RNPLPYCVEKKNQQYAQLAQRLQ 443

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
           F +  K+     +       +   +    L RGY+  Q +    +    NL    +I   
Sbjct: 444 FAIEKKLTKEQQAFQELCTRIDGLSPLKILARGYSVTQTSKGEILRSTENLKVGMQITTK 503

Query: 489 FFDGQANAIVINKA 502
              G+  + +I   
Sbjct: 504 LSQGEIVSEIIKIN 517


>gi|54307974|ref|YP_128994.1| exodeoxyribonuclease VII large subunit [Photobacterium profundum
           SS9]
 gi|81828837|sp|Q6LU33|EX7L_PHOPR RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|46912400|emb|CAG19192.1| putative exodeoxyribonuclease VII, large subunit [Photobacterium
           profundum SS9]
          Length = 448

 Score =  386 bits (991), Expect = e-105,   Method: Composition-based stats.
 Identities = 142/503 (28%), Positives = 240/503 (47%), Gaps = 58/503 (11%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M  F+Q  S D   ++VS L+  ++ ++E+ +  V + GE+S    +  SGH YF+LKD+
Sbjct: 1   MTLFTQTQSNDR-IFTVSSLNAEVRLLLENEMGIVWLVGELSNL-SMPVSGHWYFTLKDS 58

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            +++   +++G   ++ F P  G + LV  +++ +     YQ+IIES+ P G G L    
Sbjct: 59  RAQVKCAMFRGNNRRVTFKPANGTQVLVKARLSLYEPRGDYQLIIESMQPEGDGRLQQQF 118

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPV 179
           E+ K  L  EGLF+   K P+P  PK I +ITS TGA + DIL  +  R P L V+I+P 
Sbjct: 119 EQLKMSLAAEGLFAQALKKPLPEQPKRIGIITSKTGAALHDILTVLHRRDPSLPVVIYPT 178

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
            VQGD     IA AI + N  +E       D++I+ RGGGS+EDLW FN+E++ R IA S
Sbjct: 179 MVQGDGSAISIAQAIGRANARQE------CDVLIVGRGGGSLEDLWAFNEEIVARTIAAS 232

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
            IPI+SA+GHE D T+AD+ AD+RAPTP+ AAE+      H    +     +L N I   
Sbjct: 233 QIPIVSAVGHEVDVTIADFVADMRAPTPSAAAELVSRDITHQTQKIQQKNQQLKNAIRTY 292

Query: 300 IKYKINTLNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRI 357
           +  +      L   L   +    L+  +  LD +   LE  +  ++   ++H   I  ++
Sbjct: 293 LSKREAKTVQLTHRLERQHPQLRLNQQQQHLDDISSRLERAMGRLLSSHHQHVERINYKL 352

Query: 358 KSDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLH 417
                +  I+ N+  + ++++ +                                     
Sbjct: 353 SLHSPVQTIKNNQTTLDQRKRRLL------------------------------------ 376

Query: 418 THIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKR 477
                        + H++ + +  +++    L++ +   TL RGY+  +D     I    
Sbjct: 377 -----------DAMDHRLLNANHKLALAAEKLETVSPLATLSRGYSITRDAKGKVIRHID 425

Query: 478 NLATKTRILINFFDGQANAIVIN 500
            +    +++    DG+ ++ V  
Sbjct: 426 QVKPGDKLVTKVTDGEIHSTVSE 448


>gi|90410882|ref|ZP_01218896.1| exodeoxyribonuclease VII large subunit [Photobacterium profundum
           3TCK]
 gi|90328095|gb|EAS44406.1| exodeoxyribonuclease VII large subunit [Photobacterium profundum
           3TCK]
          Length = 448

 Score =  386 bits (991), Expect = e-105,   Method: Composition-based stats.
 Identities = 141/503 (28%), Positives = 240/503 (47%), Gaps = 58/503 (11%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M  F+Q  S D   ++VS L+  ++ ++E+ +  V + GE+S    +  SGH YF+LKD+
Sbjct: 1   MTLFTQTQSNDR-IFTVSSLNAEVRLLLENEMGIVWLVGELSNL-SMPVSGHWYFTLKDS 58

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            +++   +++G   ++ F P  G + LV  +++ +     YQ+IIES+ P G G L    
Sbjct: 59  RAQVKCAMFRGNNRRVTFKPANGTQVLVKARLSLYEPRGDYQLIIESMQPEGDGRLQQQF 118

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPV 179
           E+ K  L  EGLF+   K P+P  PK + +ITS TGA + DIL  +  R P L V+I+P 
Sbjct: 119 EQLKMSLAAEGLFAQVLKKPLPEQPKRVGIITSKTGAALHDILNVLHRRDPSLPVVIYPT 178

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
            VQGD     IA AI + N  +E       D++I+ RGGGS+EDLW FN+E++ R IA S
Sbjct: 179 MVQGDGSAISIAQAIGRANARQE------CDVLIVGRGGGSLEDLWAFNEEIVARTIAAS 232

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
            IPI+SA+GHE D T+AD+ AD+RAPTP+ AAE+      H    +     +L N I   
Sbjct: 233 QIPIVSAVGHEVDVTIADFVADMRAPTPSAAAELVSRDITHQTQKIQQKNQQLKNAIHTY 292

Query: 300 IKYKINTLNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRI 357
           +  +      L   L   +    L+  +  LD +   LE  +  ++   ++H   I  ++
Sbjct: 293 LSKREAKTVQLTHRLERQHPQLRLNQQQQHLDDISSRLELAMGRLLSSHHQHVERINYKL 352

Query: 358 KSDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLH 417
                +  I+ N+  + ++++ +                                     
Sbjct: 353 SLHSPVQTIKNNQTTLDQRKRRLL------------------------------------ 376

Query: 418 THIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKR 477
                        + H++ + +  +++    L++ +   TL RGY+  +D     I    
Sbjct: 377 -----------DAMDHRLLNANHKLALAAEKLETVSPLATLSRGYSITRDAKGKVIRHID 425

Query: 478 NLATKTRILINFFDGQANAIVIN 500
            +    +++    DG+ ++ V  
Sbjct: 426 QVKPGDKLVTKVTDGEIHSTVSE 448


>gi|190150143|ref|YP_001968668.1| exodeoxyribonuclease VII large subunit [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|307263480|ref|ZP_07545095.1| Exodeoxyribonuclease 7 large subunit [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|189915274|gb|ACE61526.1| putative exodeoxyribonuclease VII large subunit [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|306871123|gb|EFN02852.1| Exodeoxyribonuclease 7 large subunit [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 517

 Score =  386 bits (990), Expect = e-105,   Method: Composition-based stats.
 Identities = 142/494 (28%), Positives = 246/494 (49%), Gaps = 12/494 (2%)

Query: 12  HPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKG 71
           +   ++++L+Y +++++E+ L  V + GEIS +     SGH Y +LKD ++++   +++ 
Sbjct: 33  NNILTITQLNYSVRNLLETELGQVWLTGEISNF-SQPVSGHWYLTLKDENAQVRGAMFRM 91

Query: 72  TLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEG 131
              ++ F P+ G++ LV   ++ +     YQIIIES+ P+G G L    E+ K KL  EG
Sbjct: 92  KNQRVTFRPQNGMQVLVRASVSLYEPRGDYQIIIESMQPAGDGLLQQQFEQLKMKLAAEG 151

Query: 132 LFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEI 190
           LF+ + K  IP   K + +ITS +GA ++DIL  +  R P L +II+P  VQG E  ++I
Sbjct: 152 LFAQEKKKAIPPFTKRVGIITSSSGAALQDILNILKRRDPSLAIIIYPTLVQGKEATQDI 211

Query: 191 ANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHE 250
            N I   N  +E       D++I+ RGGGS+EDLW FN+E +  AI  S IPIISA+GHE
Sbjct: 212 VNTIDLANRRRE------CDVLIVGRGGGSLEDLWCFNEEAVAHAIFRSDIPIISAVGHE 265

Query: 251 TDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSL 310
           TD T+AD+ ADLR PTP+ AAE+    ++ L   L +   +L+    RL   K      L
Sbjct: 266 TDVTIADFVADLRVPTPSAAAELVSRDQQELVRQLQHQFDKLSLAFDRLWTEKQTYFERL 325

Query: 311 LKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQK 368
              L   +  + +   + RL +    LE+ +      + +    ++ R+ +      +Q+
Sbjct: 326 KLRLNAQHPARQVQMQQQRLAQFSYRLENAIHKTYLTEKQKLEQLLLRLTNQHPQRQLQQ 385

Query: 369 NRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIE 428
            +  + + +  + Q ++Q L     + K  +  +   R      +   +    +L  R++
Sbjct: 386 QQMQLKQAEYRLAQAIEQTLIRKQNQWKHIVEQVK--RNPLPYCVEKKNQQYAQLAQRLQ 443

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
           F +  K+     +       +   +    L RGY+  Q +    +    NL   T+I   
Sbjct: 444 FAIEKKLTKEQQAFQELCTRIDGLSPLKILARGYSVAQTSKGEILRSTENLKVGTQITTK 503

Query: 489 FFDGQANAIVINKA 502
              G+  + +I   
Sbjct: 504 LSQGEIVSEIIKIN 517


>gi|149202158|ref|ZP_01879131.1| exodeoxyribonuclease VII, large subunit [Roseovarius sp. TM1035]
 gi|149144256|gb|EDM32287.1| exodeoxyribonuclease VII, large subunit [Roseovarius sp. TM1035]
          Length = 495

 Score =  385 bits (989), Expect = e-105,   Method: Composition-based stats.
 Identities = 190/531 (35%), Positives = 284/531 (53%), Gaps = 38/531 (7%)

Query: 1   MNPFSQKNSL--DHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLK 58
           M+          + PE+SVS+LS  +K ++E   SHV VRGE+ G      SGH Y  LK
Sbjct: 1   MSDLIDDPQEGGNAPEFSVSDLSGAIKRMIEGEFSHVRVRGEL-GRISRPRSGHIYLDLK 59

Query: 59  DNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLT 118
           D+ + +  IIWKG   ++   PEEG+E +  G++TTFPG S+YQIIIE + P+G G L+ 
Sbjct: 60  DDSAVLAGIIWKGVATRLAVQPEEGMEVVATGRLTTFPGQSRYQIIIEDMKPAGMGALMA 119

Query: 119 ALEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFP 178
            LEKRK  L  EGLF+ + K  +P++P+II V+TSP+GAVIRDIL R+  RFP +V+I+P
Sbjct: 120 MLEKRKAALAAEGLFASERKQALPYLPEIIGVVTSPSGAVIRDILHRLRDRFPRKVLIWP 179

Query: 179 VKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIAN 238
           V VQGD+C  E+A AI   N +  G   PRPD+II+ARGGGS+EDLW FN+E++VRA A 
Sbjct: 180 VAVQGDKCAAEVARAIRGFNAMTPGGALPRPDLIIVARGGGSVEDLWGFNEEIVVRAAAE 239

Query: 239 SSIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIR 298
           S+IP+ISA+GHETD TL D+A+D RAPTPT AAE+AVPV+  L + +    ARL++ + +
Sbjct: 240 SAIPLISAVGHETDTTLIDFASDKRAPTPTAAAELAVPVRMDLLAWVEGQGARLSHALSQ 299

Query: 299 LIKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIK 358
            ++ +   L  L +ALP ++  L   R RLD L   L   L   +  +  H +     ++
Sbjct: 300 GVRLRGQRLRDLARALPRAEVLLDGPRQRLDALGERLPAALIRSVQVRRVHLSETAGALR 359

Query: 359 SDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHT 418
              L   ++ +R+ +      +                                I     
Sbjct: 360 PALLRRAVEGDRRRLQATAARL------------------------NVHALNRDIAQKRR 395

Query: 419 HIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRN 478
            + ++  R+  +   +++     ++   R+ ++  YK TL RGY  ++  +   +T +  
Sbjct: 396 DLDQVSARLSDVAGRQVRGWQDRLAALERLRETLGYKATLSRGYAVVRG-DGAVMTTRAA 454

Query: 479 LATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
            A    + I F DG  +             +         +     QG LF
Sbjct: 455 AAGAAALQIEFADGVLDV----------SGSSAAAPKPKPKTPPAGQGSLF 495


>gi|307245679|ref|ZP_07527765.1| Exodeoxyribonuclease 7 large subunit [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|307254646|ref|ZP_07536475.1| Exodeoxyribonuclease 7 large subunit [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307259093|ref|ZP_07540823.1| Exodeoxyribonuclease 7 large subunit [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306853381|gb|EFM85600.1| Exodeoxyribonuclease 7 large subunit [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|306862391|gb|EFM94356.1| Exodeoxyribonuclease 7 large subunit [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306866760|gb|EFM98618.1| Exodeoxyribonuclease 7 large subunit [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
          Length = 517

 Score =  385 bits (989), Expect = e-105,   Method: Composition-based stats.
 Identities = 142/494 (28%), Positives = 247/494 (50%), Gaps = 12/494 (2%)

Query: 12  HPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKG 71
           +   ++++L+Y +++++E+ L  V + GEIS +     SGH Y +LKD ++++   +++ 
Sbjct: 33  NNILTITQLNYSVRNLLETELGQVWLTGEISNF-SQPVSGHWYLTLKDENAQVRGAMFRM 91

Query: 72  TLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEG 131
              ++ F P+ G++ LV   ++ +     YQIIIES+ P+G G L    E+ K KL  +G
Sbjct: 92  KNQRVTFRPQNGMQVLVRASVSLYEPRGDYQIIIESMQPAGDGLLQQQFEQLKMKLAAQG 151

Query: 132 LFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEI 190
           LF+ + K  IP   K + +ITS +GA ++DIL  +  R P L +II+P  VQG E  ++I
Sbjct: 152 LFAQEKKKAIPPFAKRVGIITSSSGAALQDILNILKRRDPSLAIIIYPTLVQGKEATQDI 211

Query: 191 ANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHE 250
            N I   N  +E       D++I+ RGGGS+EDLW FN+E +  AI  S IPIISA+GHE
Sbjct: 212 VNTIDLANRRRE------CDVLIVGRGGGSLEDLWCFNEEAVAHAIFRSDIPIISAVGHE 265

Query: 251 TDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSL 310
           TD T+AD+ ADLRAPTP+ AAE+    ++ L   L +   +L+    RL   K      L
Sbjct: 266 TDVTIADFVADLRAPTPSAAAELVSRDQQELVRQLQHQFDKLSLAFDRLWTEKQTYFERL 325

Query: 311 LKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQK 368
              L   +  + +   + RL +    LE+ +      + +    ++ R+ +      +Q+
Sbjct: 326 KLRLNAQHPARQVQMQQQRLAQFSYRLENAIHKTYLTEKQKLEQLLLRLTNQHPQRQLQQ 385

Query: 369 NRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIE 428
            +  + + +  + Q ++Q L     + K  +  +   R      +   +    +L  R++
Sbjct: 386 QQMQLKQAEYRLAQAIEQTLIRKQNQWKHIVEQVK--RNPLPYYVEKKNQQYAQLAQRLQ 443

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
           F +  K+     +       +   +    L RGY+  Q +    +    NL   T+I   
Sbjct: 444 FAIEKKLTKEQQAFQELCTRIDGLSPLKILARGYSVTQTSKGEILRSTENLKVGTQITTK 503

Query: 489 FFDGQANAIVINKA 502
              G+  + +I   
Sbjct: 504 LSQGEIVSEIIKIN 517


>gi|307261299|ref|ZP_07542974.1| Exodeoxyribonuclease 7 large subunit [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|306869030|gb|EFN00832.1| Exodeoxyribonuclease 7 large subunit [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
          Length = 517

 Score =  385 bits (989), Expect = e-104,   Method: Composition-based stats.
 Identities = 142/494 (28%), Positives = 247/494 (50%), Gaps = 12/494 (2%)

Query: 12  HPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKG 71
           +   ++++L+Y +++++E+ L  V + GEIS +     SGH Y +LKD ++++   +++ 
Sbjct: 33  NNILTITQLNYSVRNLLETELGQVWLTGEISNF-SQPVSGHWYLTLKDENAQVRGAMFRM 91

Query: 72  TLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEG 131
              ++ F P+ G++ LV   ++ +     YQIIIES+ P+G G L    E+ K KL  +G
Sbjct: 92  KNQRVTFRPQNGMQVLVRASVSLYEPRGDYQIIIESMQPAGDGLLQQQFEQLKMKLAAQG 151

Query: 132 LFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEI 190
           LF+ + K  IP   K + +ITS +GA ++DIL  +  R P L +II+P  VQG E  ++I
Sbjct: 152 LFAQEKKKAIPPFAKRVGIITSSSGAALQDILNILKRRDPSLAIIIYPTLVQGKEATQDI 211

Query: 191 ANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHE 250
            N I   N  +E       D++I+ RGGGS+EDLW FN+E +  AI  S IPIISA+GHE
Sbjct: 212 VNTIDLANRRRE------CDVLIVGRGGGSLEDLWCFNEEAVAHAIFRSDIPIISAVGHE 265

Query: 251 TDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSL 310
           TD T+AD+ ADLRAPTP+ AAE+    ++ L   L +   +L+    RL   K      L
Sbjct: 266 TDVTIADFVADLRAPTPSAAAELVSRDQQELVRQLQHQFDKLSLAFDRLWTEKQTYFERL 325

Query: 311 LKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQK 368
              L   +  + +   + RL +    LE+ +      + +    ++ R+ +      +Q+
Sbjct: 326 KLRLNAQHPARQVQMQQQRLAQFSYRLENAIHKTYLTEKQKLEQLLLRLTNQHPQRQLQQ 385

Query: 369 NRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIE 428
            +  + + +  + Q ++Q L     + K  +  +   R      +   +    +L  R++
Sbjct: 386 QQMQLKQAEYRLAQAIEQTLIRKQNQWKHIVEQVK--RNPLPYCVEKKNQQYAQLAQRLQ 443

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
           F +  K+     +       +   +    L RGY+  Q +    +    NL   T+I   
Sbjct: 444 FAIEKKLTKEQQAFQELCTRIDGLSPLKILARGYSVTQTSKGEILRSTENLKVGTQITTK 503

Query: 489 FFDGQANAIVINKA 502
              G+  + +I   
Sbjct: 504 LSQGEIVSEIIKIN 517


>gi|300717943|ref|YP_003742746.1| exodeoxyribonuclease VII large subunit [Erwinia billingiae Eb661]
 gi|299063779|emb|CAX60899.1| Exodeoxyribonuclease VII large subunit [Erwinia billingiae Eb661]
          Length = 459

 Score =  385 bits (989), Expect = e-104,   Method: Composition-based stats.
 Identities = 148/514 (28%), Positives = 237/514 (46%), Gaps = 59/514 (11%)

Query: 4   FSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSR 63
            S   S +   ++VS L+  ++ ++E  +  V +  EIS +    SSGH YF+LKD+ ++
Sbjct: 1   MSLPPSAN--IFTVSRLNTTVRKLLEMEMGQVWLSAEISNF-SQPSSGHWYFTLKDDGAQ 57

Query: 64  IDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKR 123
           +   +++ +  ++ F P+ G + LV   IT +     YQ+I ES+ P+G G L    E+ 
Sbjct: 58  VRCAMFRNSNRRVTFRPQNGQQVLVRATITLYEPRGDYQLIAESMQPAGEGLLQQQFEQL 117

Query: 124 KKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQ 182
           K+KL+ EGLF   HK P+P   + + VITS TGA + D+L+ +  R P L V+I+P  VQ
Sbjct: 118 KQKLMSEGLFEQSHKQPLPDPARQVGVITSSTGAALHDVLRVLHRRDPSLPVVIYPTPVQ 177

Query: 183 GDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIP 242
           G + P  I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP
Sbjct: 178 GVDAPASIVRAIETANARAE------CDVLIVGRGGGSLEDLWSFNDERVARAIYASRIP 231

Query: 243 IISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKY 302
           I+SA+GHETD T+AD+ ADLRAPTP+ AAE+    +  L   L + + RL   +   +  
Sbjct: 232 IVSAVGHETDVTIADFVADLRAPTPSAAAELVSRNQIELLRQLQSQQTRLEMAMDYYLAQ 291

Query: 303 KINTLNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           K  T   +   L      L  +R +    RL R L+  +++ + +  R       R+ + 
Sbjct: 292 KSRTFTRIQHRLQQQHPQLRLARQQTALMRLQRRLDDAMQLRVRQAGRQQERAKQRLSAF 351

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420
                I + +Q++ + Q  ++Q                                      
Sbjct: 352 QPQARIHRAQQNLQQWQYRLQQA------------------------------------- 374

Query: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480
                     +  ++       S  T  L+  +   TL RG++     +   + + R + 
Sbjct: 375 ----------MQQQLNGGKQRFSTLTAQLEGVSPLATLARGFSVTTAQDGQVVKKTRQVQ 424

Query: 481 TKTRILINFFDGQANAIVINKAPPKEQPTKKCQL 514
           T   +     DG   + V    P K+    K   
Sbjct: 425 TGDTLKTRLDDGWVESEVTAVTPTKKPRKPKNPA 458


>gi|126208293|ref|YP_001053518.1| exodeoxyribonuclease VII large subunit [Actinobacillus
           pleuropneumoniae L20]
 gi|126097085|gb|ABN73913.1| putative exodeoxyribonuclease VII large subunit [Actinobacillus
           pleuropneumoniae serovar 5b str. L20]
          Length = 486

 Score =  385 bits (988), Expect = e-104,   Method: Composition-based stats.
 Identities = 143/494 (28%), Positives = 247/494 (50%), Gaps = 12/494 (2%)

Query: 12  HPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKG 71
           +   ++++L+Y +++++E+ L  V + GEIS +     SGH Y +LKD ++++   +++ 
Sbjct: 2   NNILTITQLNYSVRNLLETELGQVWLTGEISNF-SQPVSGHWYLTLKDENAQVRGAMFRM 60

Query: 72  TLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEG 131
              ++ F P+ G++ LV   ++ +     YQIIIES+ P+G G L    E+ K KL  EG
Sbjct: 61  KNQRVTFRPQNGMQVLVRASVSLYEPRGDYQIIIESMQPAGDGLLQQQFEQLKMKLAAEG 120

Query: 132 LFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEI 190
           LF+ + K  IP   K + +ITS +GA ++DIL  +  R P L +II+P  VQG E  ++I
Sbjct: 121 LFAQEKKKAIPPFAKRVGIITSSSGAALQDILNILKRRDPSLAIIIYPTLVQGKEATQDI 180

Query: 191 ANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHE 250
            N I   N  +E       D++I+ RGGGS+EDLW FN+E +  AI  S IPIISA+GHE
Sbjct: 181 VNTIDLANRRRE------CDVLIVGRGGGSLEDLWCFNEEAVAHAIFRSDIPIISAVGHE 234

Query: 251 TDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSL 310
           TD T+AD+ ADLRAPTP+ AAE+    ++ L   L +   +L+    RL   K      L
Sbjct: 235 TDVTIADFVADLRAPTPSAAAELVSRDQQELVRQLQHQFDKLSLAFDRLWTEKQTYFERL 294

Query: 311 LKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQK 368
              L   +  + +   + RL +    LE+ +      + +    ++ R+ +      +Q+
Sbjct: 295 KLRLNAQHPARQVQMQQQRLAQFSYRLENAIHKTYLTEKQKLEQLLLRLTNQHPQRQLQQ 354

Query: 369 NRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIE 428
            +  + + +  + Q ++Q L     + K  +  +   R      +   +    +L  R++
Sbjct: 355 QQMQLKQAEYRLAQAIEQTLIRKQNQWKHIVEQVK--RNPLPYCVEKKNQQYAQLAQRLQ 412

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
           F +  K+     +       +   +    L RGY+  Q +    +    NL   T+I   
Sbjct: 413 FAIEKKLTKEQQAFQELCTRIDGLSPLKILARGYSVTQTSKGEILRSTENLKVGTQITTK 472

Query: 489 FFDGQANAIVINKA 502
              G+  + +I   
Sbjct: 473 LSQGEIVSEIIKIN 486


>gi|311278570|ref|YP_003940801.1| exodeoxyribonuclease VII, large subunit [Enterobacter cloacae SCF1]
 gi|308747765|gb|ADO47517.1| exodeoxyribonuclease VII, large subunit [Enterobacter cloacae SCF1]
          Length = 457

 Score =  384 bits (987), Expect = e-104,   Method: Composition-based stats.
 Identities = 146/508 (28%), Positives = 234/508 (46%), Gaps = 57/508 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    SSGH YF+LKD+++++   
Sbjct: 3   PSQSPSIFTVSRLNQTVRLLLEQEMGQVWISGEISNFT-QPSSGHWYFTLKDDNAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K +L
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAQL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
            +EGLF  Q K P+P   + + VITS TGA + DIL  +  R P L +II+P  VQGD+ 
Sbjct: 122 SQEGLFDQQCKQPLPSPARCVGVITSKTGAALHDILHVLKRRDPSLPIIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N  +E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANARQE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASLIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    +  L   L N + RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQLELLRQLQNGQQRLEMAMDYFLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              L   L      L  +R +   +RL + +   L+  + R  +    I  R+       
Sbjct: 296 FTQLHHRLQQQHPQLRLARQQTVLERLRQRMSFALDNQLRRAGQRQQRITQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +                                          
Sbjct: 356 RIHRAQTRIQQLEYRLVE------------------------------------------ 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                    ++ +           L++ +  +TL RGY+     + N + Q + +     
Sbjct: 374 -----NARARLSATRERFGNAVTHLEAVSPLSTLARGYSVTTAMDGNVLKQTKQVKAGDL 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTKKC 512
           +     DG   + V      K+   KK 
Sbjct: 429 LTTRLSDGWVESEVKGVTTAKKTRRKKP 456


>gi|156932950|ref|YP_001436866.1| exodeoxyribonuclease VII large subunit [Cronobacter sakazakii ATCC
           BAA-894]
 gi|166232355|sp|A7MGV1|EX7L_ENTS8 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|156531204|gb|ABU76030.1| hypothetical protein ESA_00753 [Cronobacter sakazakii ATCC BAA-894]
          Length = 457

 Score =  384 bits (986), Expect = e-104,   Method: Composition-based stats.
 Identities = 143/512 (27%), Positives = 236/512 (46%), Gaps = 61/512 (11%)

Query: 3   PFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHS 62
           P +Q  S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +
Sbjct: 2   PLTQTPS----IFTVSRLNQSVRLLLEQEMGQVWISGEISNFT-QPASGHWYFTLKDDTA 56

Query: 63  RIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEK 122
           ++   +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+
Sbjct: 57  QVRCAMFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQRYEQ 116

Query: 123 RKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKV 181
            K++L  EGLF    K P+P   + + VITS TGA + D+L  +  R P L V+I+P  V
Sbjct: 117 LKQQLAAEGLFDPALKKPLPSPARQVGVITSKTGAALHDVLNVLRRRDPSLPVVIYPTAV 176

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QGD+ P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S I
Sbjct: 177 QGDDAPAQIVRAIELANLRDE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRI 230

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           PI+SA+GHETD T+AD+ ADLRAPTP+ AAE+    +  L   +  L+ RL   +   + 
Sbjct: 231 PIVSAVGHETDVTIADFVADLRAPTPSAAAEIVSRNQLELLRQVQALQQRLEMAMDYSLA 290

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
            +      L   L      L  +R +    RL + +++ L+  +    +    ++ R+  
Sbjct: 291 NRQQRFTRLHHRLEQQHPQLRLARQQTLLMRLRQRMDNALDSRMRHATQRQTRLMQRLNQ 350

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH 419
              +  + +    + + +  + QI                                    
Sbjct: 351 QQPLPRLHRASARVQQLEYRLGQI------------------------------------ 374

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
                      ++ ++             L++ +   TL RGY+     + N +   + +
Sbjct: 375 -----------VAARLSHTRERFGNAITHLEAVSPLATLARGYSVTTAQDGNVLKATKQV 423

Query: 480 ATKTRILINFFDGQANAIVINKAPPKEQPTKK 511
                +     DG   + V    P K+   KK
Sbjct: 424 RPGDTLTTRLADGWVESEVRQITPAKKTRKKK 455


>gi|52424615|ref|YP_087752.1| exodeoxyribonuclease VII large subunit [Mannheimia
           succiniciproducens MBEL55E]
 gi|52306667|gb|AAU37167.1| XseA protein [Mannheimia succiniciproducens MBEL55E]
          Length = 440

 Score =  384 bits (986), Expect = e-104,   Method: Composition-based stats.
 Identities = 149/493 (30%), Positives = 234/493 (47%), Gaps = 57/493 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIW 69
           ++   YSVS+L+Y ++ ++E  L  V + GEIS +     SGH Y +LKD ++++   ++
Sbjct: 2   MNENIYSVSQLNYSVRQLLEGQLGLVWLTGEISNF-SQPVSGHWYLTLKDENAQVRCAMF 60

Query: 70  KGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLE 129
           +    ++ F P+ G++ LV   ++ +     YQ+IIES+ P+G G L    E  K KL  
Sbjct: 61  RMKNMRVAFRPQNGMQVLVRANVSLYEPRGDYQLIIESMHPAGEGFLQQQFEALKIKLAA 120

Query: 130 EGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPK 188
           EGLF+   K  +P   K + ++TSPTGA ++DIL  +  R P L++II+P  VQG +   
Sbjct: 121 EGLFAQNLKKNLPHFAKTVGIVTSPTGAALQDILNILQRRDPSLKIIIYPTAVQGKDAAN 180

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           EI   I   N   E       D++I+ RGGGS+EDLW FN+E + RAI  SSIP+ISA+G
Sbjct: 181 EIVQMIELANLRNEA------DVLIVGRGGGSLEDLWCFNEETVARAIFRSSIPVISAVG 234

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HETD T+AD+ AD+RAPTP+ AAE+    ++ L   L     RL   + RL   K   L 
Sbjct: 235 HETDVTIADFVADVRAPTPSAAAELVSRNQQELFQQLQYKRQRLEMALDRLFNEKQQHLQ 294

Query: 309 SLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNI 366
             L  L   +    L   R +  +L   L   +  ++ + +     +  R++ + L + +
Sbjct: 295 RFLLRLQNRHPSARLLAQRQQTGQLEHRLNSAIRRLLDKNHYKLTALCERLEKNPLPYLV 354

Query: 367 QKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITR 426
           ++   HI++                                                 T 
Sbjct: 355 RQQNYHIVQLA-----------------------------------------------TN 367

Query: 427 IEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRIL 486
           ++F L   I S  TS+S     L   +    L RGY+  +      I+    + T  +I 
Sbjct: 368 LDFALKRLIVSKQTSLSALCGKLDGLSPLKVLARGYSIAETEQGETISSVNQVETGDKIK 427

Query: 487 INFFDGQANAIVI 499
               DG   + VI
Sbjct: 428 TRLRDGVIVSKVI 440


>gi|300920664|ref|ZP_07137075.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 115-1]
 gi|300412345|gb|EFJ95655.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 115-1]
          Length = 456

 Score =  384 bits (986), Expect = e-104,   Method: Composition-based stats.
 Identities = 147/506 (29%), Positives = 235/506 (46%), Gaps = 57/506 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQYKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANQRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSARQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIYHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRAGQQQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +I                                         
Sbjct: 356 KIHRTQTRIQQLEYRLAEI----------------------------------------- 374

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +           L++ +  +TL RGY+    T+ N + + + +     
Sbjct: 375 ------LRAQLSATRERFGNAVTHLEAVSPLSTLARGYSVTTATDGNVLKKVKQVKAGEM 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTK 510
           +     DG   + V N  P K+   K
Sbjct: 429 LTTRLEDGWIESEVKNIQPVKKSRKK 454


>gi|157144558|ref|YP_001451877.1| exodeoxyribonuclease VII large subunit [Citrobacter koseri ATCC
           BAA-895]
 gi|166232350|sp|A8AD78|EX7L_CITK8 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|157081763|gb|ABV11441.1| hypothetical protein CKO_00278 [Citrobacter koseri ATCC BAA-895]
          Length = 457

 Score =  384 bits (986), Expect = e-104,   Method: Composition-based stats.
 Identities = 146/507 (28%), Positives = 234/507 (46%), Gaps = 57/507 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           +S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   SSQTSTIFTVSRLNQTVRLLLEQEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQIIIES+ P+G G L    E  K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIIESMQPAGEGLLQQKYELLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQYKQPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI + N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIERANARNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + + + RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEIVSRNQQELLRQIQSAQQRLGMAMDYYLANRNRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              L   L      L  +R +   +RL + +   L+  + R       ++ R+       
Sbjct: 296 FTQLFHRLQQQHPQLRLARQQTMLERLRQRMNFALDNQLKRAASRQQRVLQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +                                          
Sbjct: 356 RIYRAQTRIQQLEYRLAE------------------------------------------ 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 +  ++ +           L++ +  +TL RGY+    T+   + Q R +     
Sbjct: 374 -----NVRARLSATRERFGNAVTHLEAVSPLSTLARGYSVTTATDGKVLKQTRQVKAGDV 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTKK 511
           +     DG   + V      K+   KK
Sbjct: 429 LTTRLSDGWVESEVKGVTTAKKTRRKK 455


>gi|332754196|gb|EGJ84564.1| exodeoxyribonuclease VII, large subunit [Shigella flexneri 4343-70]
          Length = 456

 Score =  384 bits (985), Expect = e-104,   Method: Composition-based stats.
 Identities = 148/506 (29%), Positives = 236/506 (46%), Gaps = 57/506 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQYKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTSVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANQRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSARQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRAGQQQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +I                                         
Sbjct: 356 KIHRTQTRIQQLEYRLAEI----------------------------------------- 374

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +           L++ +  +TL RGY+    T+ N + + + + T   
Sbjct: 375 ------LRAQLSATRERFGNAVTHLEAVSPLSTLARGYSVTTATDGNVLKKVKQVKTGEM 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTK 510
           +     DG   + V N  P K+   K
Sbjct: 429 LTTRLEDGWIESEVKNIQPVKKSRKK 454


>gi|161502331|ref|YP_001569443.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|189037843|sp|A9MHM3|EX7L_SALAR RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|160863678|gb|ABX20301.1| hypothetical protein SARI_00364 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 454

 Score =  384 bits (985), Expect = e-104,   Method: Composition-based stats.
 Identities = 145/502 (28%), Positives = 234/502 (46%), Gaps = 57/502 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           +S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   SSQTSSIFTVSRLNQTVRLLLEQEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+K+P+P     + VITS TGA + DIL  +  R P L VII+P  VQG++ 
Sbjct: 122 QAEGLFDQQYKHPLPSPAYCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPAAVQGEDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N  KE       D++I+ RGGGS+EDLW FNDE + RAI  S+IP++SA
Sbjct: 182 PGQIVRAITLANARKE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASTIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   +     RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQMQTACQRLEMAMDYYLANRQRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
            + L   L      L  +R +   +RL + +   LE  + +  +       R++      
Sbjct: 296 FSQLYHRLQQQHPQLRLARQQTTLERLRQRMHLALENQLKQANQRQQRASQRLRQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +                                          
Sbjct: 356 RIHRAQSRIQQLEYRLAE------------------------------------------ 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                    ++         T   L++ +   TL RGY+    T+ N + + + L     
Sbjct: 374 -----NFRARLSEQRERFGNTVTHLEAVSPLATLARGYSVSTATDGNVLKKVKQLKVGDM 428

Query: 485 ILINFFDGQANAIVINKAPPKE 506
           +     DG   + V    P K+
Sbjct: 429 MTTRLKDGWVTSEVTAIKPVKK 450


>gi|302382957|ref|YP_003818780.1| exodeoxyribonuclease VII large subunit [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302193585|gb|ADL01157.1| exodeoxyribonuclease VII, large subunit [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 529

 Score =  384 bits (985), Expect = e-104,   Method: Composition-based stats.
 Identities = 184/526 (34%), Positives = 274/526 (52%), Gaps = 12/526 (2%)

Query: 5   SQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRI 64
                 ++P  S+SELS+ LK  +E    HV +RGEIS     H+SGH Y +LKD+ S I
Sbjct: 15  PAPARDNNPPLSISELSFALKRTLEDRFGHVRLRGEISKVN-RHASGHIYLTLKDDKSAI 73

Query: 65  DAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRK 124
           D ++WKG+   +   PE G+E +V GKIT++P  S YQI+IES+  +G+G LL  LE+ K
Sbjct: 74  DGVVWKGSARGLGVQPETGLEVIVTGKITSYPARSSYQIVIESMEAAGAGALLAQLERLK 133

Query: 125 KKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGD 184
            +L  EGLF    K  IP  P+ I VITSPTGAVIRDIL RI+ R+P  VI++PV VQGD
Sbjct: 134 VRLSGEGLFDPARKRSIPLYPRTIGVITSPTGAVIRDILHRIAERWPCHVIVWPVVVQGD 193

Query: 185 ECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPII 244
               ++  AI   + +  G   PRPD++I+ARGGGS+EDLW FNDE + R +A ++IPII
Sbjct: 194 AACGQVGAAIRGFDAMTPGGPIPRPDLLIVARGGGSVEDLWCFNDEGLARTVAAATIPII 253

Query: 245 SAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKI 304
           SA+GHETD TL D+ +D RAPTPTGAAE+A PV   L++++ +LE RL+    RL++ + 
Sbjct: 254 SAVGHETDTTLIDFVSDRRAPTPTGAAEIATPVLADLRAAVTDLERRLDRAGARLLEDRR 313

Query: 305 NTLNSLLKALP-NSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLI 363
             L ++ + LP   +  ++ ++ RLD     L   L   +   +R    +  R     L 
Sbjct: 314 VRLRAVARGLPARPEDLIALAQQRLDHAASRLGSGLGRNVELHHRRLVGVAGRFSPRLLD 373

Query: 364 HNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKL 423
             +++    +      +   +         E++       +     ++R+      +   
Sbjct: 374 RAVEQRTARLDGLGSRLVAAL--GANAARHERRLLQVSGRLTPAPLRHRLEQRSDRLTAT 431

Query: 424 ITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKT 483
           + R++      I      ++   R L +   +   K G+  I D     I     L+   
Sbjct: 432 VARLDRARPQAILRASDRLAALARALATLDPRRP-KPGFARIDDETGKMIASAAALSPGQ 490

Query: 484 RILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
           R+ +NF DG   A +         P    +     R     QG LF
Sbjct: 491 RVSLNFADGSQGATIDG-------PASAPRPPGKPRTAPVDQGSLF 529


>gi|157161984|ref|YP_001459302.1| exodeoxyribonuclease VII large subunit [Escherichia coli HS]
 gi|170019208|ref|YP_001724162.1| exodeoxyribonuclease VII large subunit [Escherichia coli ATCC 8739]
 gi|312973250|ref|ZP_07787422.1| exodeoxyribonuclease VII, large subunit [Escherichia coli 1827-70]
 gi|166919632|sp|A8A315|EX7L_ECOHS RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|189037847|sp|B1IWF2|EX7L_ECOLC RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|157067664|gb|ABV06919.1| exodeoxyribonuclease VII, large subunit [Escherichia coli HS]
 gi|169754136|gb|ACA76835.1| exodeoxyribonuclease VII, large subunit [Escherichia coli ATCC
           8739]
 gi|310331845|gb|EFP99080.1| exodeoxyribonuclease VII, large subunit [Escherichia coli 1827-70]
 gi|323941229|gb|EGB37414.1| exodeoxyribonuclease VII [Escherichia coli E482]
          Length = 456

 Score =  384 bits (985), Expect = e-104,   Method: Composition-based stats.
 Identities = 147/506 (29%), Positives = 235/506 (46%), Gaps = 57/506 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQYKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANQRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSARQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLKKRMSFALENQLKRAGQQQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +I                                         
Sbjct: 356 KIHRAQTRIQQLEYRLAEI----------------------------------------- 374

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +           L++ +  +TL RGY+    T+ N + + + +     
Sbjct: 375 ------LRAQLSATRERFGNAVTHLEAVSPLSTLARGYSVTTATDGNVLKKVKQVKAGEM 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTK 510
           +     DG   + V N  P K+   K
Sbjct: 429 LTTRLEDGWIESEVKNIQPVKKSRKK 454


>gi|254473566|ref|ZP_05086962.1| exodeoxyribonuclease VII, large subunit [Pseudovibrio sp. JE062]
 gi|211957278|gb|EEA92482.1| exodeoxyribonuclease VII, large subunit [Pseudovibrio sp. JE062]
          Length = 510

 Score =  384 bits (985), Expect = e-104,   Method: Composition-based stats.
 Identities = 189/554 (34%), Positives = 284/554 (51%), Gaps = 82/554 (14%)

Query: 10  LDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIW 69
            +  EY+VSE+S  +K  +E    ++ VRGE+ G     +SGH Y  +KD+ + +  IIW
Sbjct: 5   SNIAEYTVSEISGDIKRELEDKFGYIRVRGEL-GRVSRPASGHIYLDVKDDKAVLSGIIW 63

Query: 70  KGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLE 129
           +G  ++++  PE+G+E +  GKITTFPG SKYQ++I+SL P+G+G L+  LE+RK+KL  
Sbjct: 64  RGNASRLKVQPEQGLEVIATGKITTFPGQSKYQMVIDSLEPAGAGALMALLEERKRKLAA 123

Query: 130 EGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKE 189
           EGLF+++ K  +P +P++I V+TSPTGAVIRDIL RIS RFPL V+++PV+VQG+ C  E
Sbjct: 124 EGLFAEERKVALPRMPRVIGVVTSPTGAVIRDILHRISDRFPLHVLVWPVRVQGETCGSE 183

Query: 190 IANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGH 249
           +A  I   N L+ G   PRPD++I+ARGGGSIEDLW FNDE +VRA A+S IP+ISA+GH
Sbjct: 184 VAAGIRGFNALEAGGAIPRPDVLIVARGGGSIEDLWGFNDEAVVRAAADSQIPLISAVGH 243

Query: 250 ETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNS 309
           ETDWTL D AAD+RAPTPTGAAE AVPVK  + + + +L  RL+  ++RL++ +   L +
Sbjct: 244 ETDWTLIDLAADVRAPTPTGAAEFAVPVKAEMTAQVDDLSRRLSTGLLRLVQSRRTELRA 303

Query: 310 LLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKN 369
              ALP     L+  R R D +   LEH L++           + + ++   L   + + 
Sbjct: 304 ASAALPAPRDLLALPRQRFDMVAGRLEHGLKMNTQIHRNSLTAVSSGLRPITLERQVAQG 363

Query: 370 RQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEF 429
           R+ +   +          ++                                        
Sbjct: 364 RERLQVLKVRATTAFSNQVQRQ-------------------------------------- 385

Query: 430 ILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINF 489
                       +S +  +L S +Y+  ++RGY  ++D N   +   + +     + +  
Sbjct: 386 ---------RLRLSNSAGLLGSLSYERVIERGYAVVRDENGIPLASAQAVQAGQALKLEM 436

Query: 490 FDGQANAIVINK------------------------APPKE----------QPTKKCQLH 515
             G   A+                            +PPK           +  KK    
Sbjct: 437 KGGTVGAVADGGGVTPTPPRVAIPTPTEAAEPSAPTSPPKSLEEHMAQTKAKQAKKPARK 496

Query: 516 NNKREKQGTQGELF 529
                    QG LF
Sbjct: 497 KKSVVDPDAQGSLF 510


>gi|94496131|ref|ZP_01302709.1| exodeoxyribonuclease VII large subunit [Sphingomonas sp. SKA58]
 gi|94424310|gb|EAT09333.1| exodeoxyribonuclease VII large subunit [Sphingomonas sp. SKA58]
          Length = 493

 Score =  384 bits (985), Expect = e-104,   Method: Composition-based stats.
 Identities = 182/527 (34%), Positives = 269/527 (51%), Gaps = 51/527 (9%)

Query: 4   FSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSR 63
              +   + P  SVSELS  LK  VE    HV +RGEISG++   +SGH Y  LKD+++ 
Sbjct: 16  AEDRAGDNAPPLSVSELSGMLKRTVEDRFGHVRLRGEISGFK-RAASGHLYLCLKDDNAV 74

Query: 64  IDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKR 123
           ID ++WKG   ++ F P++G+E +  GK+TT+PG SKYQI+IE +  +G G L+  LEK 
Sbjct: 75  IDGVMWKGGAQRLAFAPQDGVEVIATGKLTTYPGRSKYQIVIERMELAGEGALMALLEKL 134

Query: 124 KKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQG 183
           K KL  EGLF+ + K P+PF+P+ I V+TSPTGAVIRDIL R++ R P +V+++PV VQG
Sbjct: 135 KAKLAGEGLFAPERKKPLPFLPRTIGVVTSPTGAVIRDILHRLADRCPTQVLLWPVLVQG 194

Query: 184 DECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPI 243
               +++A A+   + +      PRP+++I+ARGGGSIEDLW FN+E++VRA+A  SIPI
Sbjct: 195 QGAAEQVARAVRGFSEMAGDGALPRPELVIVARGGGSIEDLWSFNEEIVVRAVAECSIPI 254

Query: 244 ISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYK 303
           ISA+GHETD TL DYAAD RAPTPT AAEMAVPV+  L + L ++  R    + R     
Sbjct: 255 ISAVGHETDTTLCDYAADRRAPTPTAAAEMAVPVRAELLAGLTDMGLRAGRAVRRGAAQA 314

Query: 304 INTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLI 363
              L+   + +P  D  LS  R RLD++   L   L   +     H       ++   L 
Sbjct: 315 RERLDMQARLMPTPDTLLSPQRQRLDQVSDGLASGLRHRLADARAHLGQASGALRPALLR 374

Query: 364 HNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKL 423
             + +  + +   +   E +V                                       
Sbjct: 375 QQLARAGERLDRLRLRPENLV--------------------------------------- 395

Query: 424 ITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKT 483
             R +   +          +              L+RGY  +    +  +          
Sbjct: 396 --RAQRDCATAFDRVSRHFAS-------LNPDLPLQRGYARVM-AGDRLVRSVEAARAAG 445

Query: 484 RILINFFDGQANAIVIN-KAPPKEQPTKKCQLHNNKREKQGTQGELF 529
           +++++F DG  +A V   +AP    P+   +     R+    Q +LF
Sbjct: 446 QVVLHFHDGTVDAAVGQAEAPAGMAPSPSARPTRKPRDPAHAQQDLF 492


>gi|333016127|gb|EGK35459.1| exodeoxyribonuclease VII, large subunit [Shigella flexneri K-227]
          Length = 456

 Score =  383 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 147/506 (29%), Positives = 235/506 (46%), Gaps = 57/506 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQYKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTSVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELSNQRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSARQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRAGQQQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +I                                         
Sbjct: 356 KIHRTQTRIQQLEYRLAEI----------------------------------------- 374

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +           L++ +  +TL RGY+    T+ N + + + +     
Sbjct: 375 ------LRAQLSATRERFGNAVTHLEAVSPLSTLARGYSVTTATDGNVLKKVKQVKAGEM 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTK 510
           +     DG   + V N  P K+   K
Sbjct: 429 LTTRLEDGWIESEVKNIQPVKKSRKK 454


>gi|293415774|ref|ZP_06658417.1| exodeoxyribonuclease VII [Escherichia coli B185]
 gi|291433422|gb|EFF06401.1| exodeoxyribonuclease VII [Escherichia coli B185]
          Length = 456

 Score =  383 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 146/506 (28%), Positives = 234/506 (46%), Gaps = 57/506 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDLQYKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANQRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSTRQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRAGQQQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +                                          
Sbjct: 356 KIHRAQTRIQQLEYRLAE------------------------------------------ 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +           L++ +  +TL RGY+    T+ N + + + +     
Sbjct: 374 -----TLRAQLSATRERFGNAVTHLEAVSPLSTLARGYSVTTATDGNVLKKVKQVKAGEM 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTK 510
           +     DG   + V N  P K+   K
Sbjct: 429 LTTRLEDGWIESEVKNIQPVKKSRKK 454


>gi|333000697|gb|EGK20273.1| exodeoxyribonuclease VII, large subunit [Shigella flexneri VA-6]
          Length = 456

 Score =  383 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 147/506 (29%), Positives = 235/506 (46%), Gaps = 57/506 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQYKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTSVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANQRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSARQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRAGQQQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +I                                         
Sbjct: 356 KIHRTQTRIQQLEYRLAEI----------------------------------------- 374

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +           L++ +  +TL RGY+    T+ N + + + +     
Sbjct: 375 ------LRAQLSATRERFGNAVTHLEAVSPLSTLARGYSVTTATDGNVLKKVKQVKAGEM 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTK 510
           +     DG   + V N  P K+   K
Sbjct: 429 LTTRLEDGWIESEVKNIQPVKKSRKK 454


>gi|307252394|ref|ZP_07534290.1| Exodeoxyribonuclease 7 large subunit [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306859986|gb|EFM92003.1| Exodeoxyribonuclease 7 large subunit [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
          Length = 517

 Score =  383 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 142/494 (28%), Positives = 247/494 (50%), Gaps = 12/494 (2%)

Query: 12  HPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKG 71
           +   ++++L+Y +++++E+ L  V + GEIS +     SGH Y +LKD ++++   +++ 
Sbjct: 33  NNILTITQLNYSVRNLLETELGQVWLTGEISNF-SQPVSGHWYLTLKDENAQVRGAMFRM 91

Query: 72  TLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEG 131
              ++ F P+ G++ LV   ++ +     YQIIIES+ P+G G L    E+ K KL  EG
Sbjct: 92  KNQRVTFRPQNGMQVLVRASVSLYEPRGDYQIIIESMQPAGDGLLQQQFEQLKMKLAAEG 151

Query: 132 LFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEI 190
           LF+ + K  IP   K + +ITS +GA ++DIL  +  R P L +II+P  VQG E  ++I
Sbjct: 152 LFAQEKKKAIPPFTKRVGIITSSSGAALQDILNILKRRDPSLAIIIYPTLVQGKEATQDI 211

Query: 191 ANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHE 250
            N I   N  +E       D++I+ RGGGS+EDLW FN+E +  AI  S IPIISA+GHE
Sbjct: 212 VNTIDLANRRRE------CDVLIVGRGGGSLEDLWCFNEEAVAHAIFRSDIPIISAVGHE 265

Query: 251 TDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSL 310
           TD T+AD+ ADLR PTP+ AAE+    ++ L   L +   +L+    RL   K      L
Sbjct: 266 TDVTIADFVADLRVPTPSAAAELVSRDQQELVRQLQHQFDKLSLAFDRLWTEKQTYFERL 325

Query: 311 LKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQK 368
              L   +  + +   + RL +    LE+ +      + +    ++ R+ +      +Q+
Sbjct: 326 KLRLNAQHPARQVQVQQQRLAQFSYRLENAIHKTYLTEKQKLEQLLLRLTNQHPQRQLQQ 385

Query: 369 NRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIE 428
            +  + + +  + Q ++Q L     + K  +  +   R      +   +    +L  R++
Sbjct: 386 QQMQLKQAEYRLAQAIEQTLIRKQNQWKHIVEQVK--RNPLPYYVEKKNQQYAQLAQRLQ 443

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
           F +  K+     +       +   +    L RGY+  Q +    +   +NL   T+I   
Sbjct: 444 FAIEKKLTKEQQAFQELCTRIDGLSPLKILARGYSVTQTSKGEILRSTKNLKVGTQITTK 503

Query: 489 FFDGQANAIVINKA 502
              G+  + +I   
Sbjct: 504 LSQGEIVSEIIKIN 517


>gi|209919986|ref|YP_002294070.1| exodeoxyribonuclease VII large subunit [Escherichia coli SE11]
 gi|307312496|ref|ZP_07592129.1| exodeoxyribonuclease VII, large subunit [Escherichia coli W]
 gi|226694841|sp|B6I581|EX7L_ECOSE RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|209913245|dbj|BAG78319.1| exonuclease VII large subunit [Escherichia coli SE11]
 gi|306907419|gb|EFN37923.1| exodeoxyribonuclease VII, large subunit [Escherichia coli W]
 gi|315061828|gb|ADT76155.1| exonuclease VII, large subunit [Escherichia coli W]
 gi|323377591|gb|ADX49859.1| exodeoxyribonuclease VII, large subunit [Escherichia coli KO11]
 gi|324020069|gb|EGB89288.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 117-3]
          Length = 456

 Score =  383 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 147/506 (29%), Positives = 235/506 (46%), Gaps = 57/506 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQYKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANQRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSTRQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRTGQQQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +I                                         
Sbjct: 356 KIHRAQTRIQQLEYRLAEI----------------------------------------- 374

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +           L++ +  +TL RGY+    T+ N + + + +     
Sbjct: 375 ------LRAQLSATRERFGNAVTHLEAVSPLSTLARGYSVTTATDGNVLKKVKQVKAGEM 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTK 510
           +     DG   + V N  P K+   K
Sbjct: 429 LTTRLEDGWIESEVKNIQPVKKSRKK 454


>gi|156973388|ref|YP_001444295.1| exodeoxyribonuclease VII large subunit [Vibrio harveyi ATCC
           BAA-1116]
 gi|166232371|sp|A7MU31|EX7L_VIBHB RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|156524982|gb|ABU70068.1| hypothetical protein VIBHAR_01075 [Vibrio harveyi ATCC BAA-1116]
          Length = 443

 Score =  383 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 139/494 (28%), Positives = 240/494 (48%), Gaps = 57/494 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           +  +   ++VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++   
Sbjct: 3   SQTNQNIFTVSRLNAEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSRAQVKCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++G   ++ F P  G + LV  +++ +     YQ+IIES+ P G G L    E  K KL
Sbjct: 62  MFRGNNRRVTFKPANGNQVLVKARLSLYEPRGDYQLIIESMQPEGDGRLQQEFEALKMKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF+  +K P+P  PK + VITS TGA + DIL  +  R P L V+++P  VQG+E 
Sbjct: 122 AAEGLFAQTNKQPLPEHPKRVGVITSKTGAALYDILDVLKRRDPSLPVVVYPTMVQGEEA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
             ++A AI + N+  E       D++I+ RGGGS+EDLW FN+E++ R IA S IPIISA
Sbjct: 182 AIQMAQAIGRANSRDE------CDVLIVGRGGGSLEDLWCFNNEILARTIAASQIPIISA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHE D T+AD+ AD+RAPTP+ AAE+      H   +L+  + +L + +   +  +   
Sbjct: 236 VGHEVDVTIADFVADIRAPTPSAAAELVSRDNSHKDQALVTHQHKLASAMRYYLAQQKQQ 295

Query: 307 LNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              L+  L   +    L     +LD L   L+  ++  I  + +      +R++ +  + 
Sbjct: 296 SAQLMHRLERQHPSYQLQRQTQQLDELEMRLQRAMQRFITTRQQAVERKHHRLQLNSPVK 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            + + +  +   +Q                                              
Sbjct: 356 RLAEQKSKLDRVEQ---------------------------------------------- 369

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
            ++   +  K+ +    ++I    L + +   TLKRGY+  Q      +TQ +++ T   
Sbjct: 370 -KLLDAMDRKLLTMRHQLAIAAEKLDTVSPLATLKRGYSITQTEQGQVVTQAKDVKTGDV 428

Query: 485 ILINFFDGQANAIV 498
           ++    DG+  + V
Sbjct: 429 LVTRLSDGELRSTV 442


>gi|307247801|ref|ZP_07529837.1| Exodeoxyribonuclease 7 large subunit [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|306855603|gb|EFM87770.1| Exodeoxyribonuclease 7 large subunit [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
          Length = 517

 Score =  383 bits (983), Expect = e-104,   Method: Composition-based stats.
 Identities = 142/494 (28%), Positives = 246/494 (49%), Gaps = 12/494 (2%)

Query: 12  HPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKG 71
           +   ++++L+Y +++++E+ L  V + GEIS +     SGH Y +LKD ++++   +++ 
Sbjct: 33  NNILTITQLNYSVRNLLETELGQVWLTGEISNF-SQPVSGHWYLTLKDENAQVRGAMFRM 91

Query: 72  TLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEG 131
              ++ F P+ G++ LV   ++ +     YQIIIES+ P+G G L    E+ K KL   G
Sbjct: 92  KNQRVIFRPQNGMQVLVRASVSLYEPRGDYQIIIESMQPAGDGLLQQQFEQLKMKLAASG 151

Query: 132 LFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEI 190
           LF+ + K  IP   K + +ITS +GA ++DIL  +  R P L +II+P  VQG E  ++I
Sbjct: 152 LFAQEKKKAIPPFTKRVGIITSSSGAALQDILNILKRRDPSLAIIIYPTLVQGKEATQDI 211

Query: 191 ANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHE 250
            N I   N  +E       D++I+ RGGGS+EDLW FN+E +  AI  S IPIISA+GHE
Sbjct: 212 VNTIDLANRRRE------CDVLIVGRGGGSLEDLWCFNEEAVAHAIFRSDIPIISAVGHE 265

Query: 251 TDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSL 310
           TD T+AD+ ADLRAPTP+ AAE+    ++ L   L +   +L+    RL   K      L
Sbjct: 266 TDVTIADFVADLRAPTPSAAAELVSRDQQELVRQLQHQFDKLSLAFDRLWTEKQTYFERL 325

Query: 311 LKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQK 368
              L   +  + +   + RL +    LE+ +      + +    ++ R+ +      +Q+
Sbjct: 326 KLRLNAQHPARQVQMQQQRLAQFSYRLENAIHKTYLTEKQKLEQLLLRLTNQHPQRQLQQ 385

Query: 369 NRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIE 428
            +  + + +  + Q ++Q L     + K  +  +   R      +   +    +L  R++
Sbjct: 386 QQMQLKQAEYRLAQAIEQTLIRKQNQWKHIVEQVK--RNPLPYCVEKKNQQYAQLAQRLQ 443

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
           F +  K+     +       +   +    L RGY+  Q +    +    NL   T+I   
Sbjct: 444 FAIEKKLTKEQQAFQELCTRIDGLSPLKILARGYSVTQTSKGEILRSTENLKVGTQITTK 503

Query: 489 FFDGQANAIVINKA 502
              G+  + +I   
Sbjct: 504 LSQGEIVSEIIKIN 517


>gi|110806440|ref|YP_689960.1| exodeoxyribonuclease VII large subunit [Shigella flexneri 5 str.
           8401]
 gi|123048016|sp|Q0T210|EX7L_SHIF8 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|110615988|gb|ABF04655.1| exonuclease VII, large subunit [Shigella flexneri 5 str. 8401]
          Length = 456

 Score =  383 bits (983), Expect = e-104,   Method: Composition-based stats.
 Identities = 147/506 (29%), Positives = 235/506 (46%), Gaps = 57/506 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQYKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTSVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANQRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSSRQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRAGQQQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +I                                         
Sbjct: 356 KIHRTQTRIQQLEYRLAEI----------------------------------------- 374

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +           L++ +  +TL RGY+    T+ N + + + +     
Sbjct: 375 ------LRAQLSATRERFGNAVTHLEAVSPLSTLARGYSVTTATDGNVLKKVKQVKAGEM 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTK 510
           +     DG   + V N  P K+   K
Sbjct: 429 LTTRLEDGWIESEVKNIQPVKKSRKK 454


>gi|229505620|ref|ZP_04395130.1| exodeoxyribonuclease VII large subunit [Vibrio cholerae BX 330286]
 gi|229517830|ref|ZP_04407274.1| exodeoxyribonuclease VII large subunit [Vibrio cholerae RC9]
 gi|229344545|gb|EEO09519.1| exodeoxyribonuclease VII large subunit [Vibrio cholerae RC9]
 gi|229357843|gb|EEO22760.1| exodeoxyribonuclease VII large subunit [Vibrio cholerae BX 330286]
          Length = 464

 Score =  383 bits (983), Expect = e-104,   Method: Composition-based stats.
 Identities = 144/491 (29%), Positives = 242/491 (49%), Gaps = 57/491 (11%)

Query: 11  DHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           +   Y+VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++   ++K
Sbjct: 25  NRNIYTVSRLNSEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSQAQVKCAMFK 83

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           G    + F P+ G + LV  +++ +     YQII+ES+ P G G L    E+ K +L  E
Sbjct: 84  GNNRLVNFKPQNGQQVLVKARLSLYEPRGDYQIILESMQPEGDGRLQQQFEQLKMQLAAE 143

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKE 189
           GLF+   K P+P  P+ + +ITS TGA + DIL  +  R P L V+I+P  VQG+E   +
Sbjct: 144 GLFAQTRKKPLPENPRCVGIITSRTGAALHDILHVLKRRDPNLPVVIYPTLVQGEEAAIQ 203

Query: 190 IANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGH 249
           IA AI + NT  E       D++I+ RGGGS+EDLW FN E++ R IA S IPIISA+GH
Sbjct: 204 IAQAIGRANTRAE------CDVLIVGRGGGSLEDLWCFNHEIVARTIAASEIPIISAVGH 257

Query: 250 ETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNS 309
           E D T+AD+ AD+RAPTP+ AAE+      H Q +L   +A+L + +   +  +      
Sbjct: 258 EIDVTIADFVADVRAPTPSAAAELVSRDHRHKQQALHQWQAKLASTMRHYLAQQETQFAR 317

Query: 310 LLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQ 367
           L   L   +    L   + +LD L   LE  ++  +  + + ++ + ++I+    IH I+
Sbjct: 318 LQHKLDKQHPQARLERQQQQLDELSLRLEQKMQQRLATQQQRWDRLSHKIELHSPIHLIR 377

Query: 368 KNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRI 427
           + R ++++++Q I Q                                             
Sbjct: 378 QQRFNLIQQEQRINQ--------------------------------------------- 392

Query: 428 EFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILI 487
              +   +      +++ +  L + +   TL RGY+  + T    + Q   +     ++ 
Sbjct: 393 --SIQRYLIQSRHQLALLSEKLDAVSPLATLARGYSVTRTTQGELVRQSAQVKPGDTLVT 450

Query: 488 NFFDGQANAIV 498
              DG+  + V
Sbjct: 451 QLMDGEILSTV 461


>gi|254228660|ref|ZP_04922084.1| exodeoxyribonuclease VII, large subunit [Vibrio sp. Ex25]
 gi|151938839|gb|EDN57673.1| exodeoxyribonuclease VII, large subunit [Vibrio sp. Ex25]
          Length = 496

 Score =  383 bits (983), Expect = e-104,   Method: Composition-based stats.
 Identities = 139/492 (28%), Positives = 235/492 (47%), Gaps = 57/492 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIW 69
            +   ++VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++   ++
Sbjct: 58  TNQNIFTVSRLNAEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSRAQVKCAMF 116

Query: 70  KGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLE 129
           +G   ++ F P  G + LV  +++ +     YQ+IIES+ P G G L    E+ K KL  
Sbjct: 117 RGNNRRVTFKPTNGNQVLVKARLSLYEPRGDYQLIIESMQPEGDGRLQQEFEELKMKLAA 176

Query: 130 EGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPK 188
           EGLF+  +K P+P  PK + VITS TGA + DIL  +  R P L V+I+P  VQG++   
Sbjct: 177 EGLFAQTNKQPLPEHPKRVGVITSKTGAALYDILDVLKRRDPSLPVVIYPTVVQGEDAAI 236

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           +IA AI + N+  E       D++I+ RGGGS+EDLW FN+E++ R IA S IPIISA+G
Sbjct: 237 QIAQAIGRANSRDE------CDVLIVGRGGGSLEDLWCFNNEILARTIAASQIPIISAVG 290

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HE D T+AD+ AD+RAPTP+ AAE+      H   +L+  + +L + +   +  +     
Sbjct: 291 HEVDVTIADFVADVRAPTPSAAAELVSRDNSHKDQALVTRQHKLASAMRYYLAQQKQQSA 350

Query: 309 SLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNI 366
            L+  L   +    L     +LD L   L+  +   I  + +       R++ +  +  +
Sbjct: 351 QLVHRLERQHPSYRLQRQTQQLDELDMRLQRAMSRFIALRQQRIERQHYRLQLNSPVTRL 410

Query: 367 QKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITR 426
            + +  +   +Q +                                              
Sbjct: 411 AEQKSKLERVEQKL---------------------------------------------- 424

Query: 427 IEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRIL 486
               +  K+ +    ++I    L + +   TLKRGY+  Q      ITQ  ++ +   ++
Sbjct: 425 -MDAMDRKLLTMRHQLAIAAEKLDTVSPLATLKRGYSITQTEQGKVITQSSDVKSGDVLI 483

Query: 487 INFFDGQANAIV 498
               +G   + V
Sbjct: 484 TRLAEGDVRSTV 495


>gi|30063901|ref|NP_838072.1| exodeoxyribonuclease VII large subunit [Shigella flexneri 2a str.
           2457T]
 gi|56480122|ref|NP_708348.2| exodeoxyribonuclease VII large subunit [Shigella flexneri 2a str.
           301]
 gi|81839397|sp|Q83QL0|EX7L_SHIFL RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|30042156|gb|AAP17882.1| exonuclease VII, large subunit [Shigella flexneri 2a str. 2457T]
 gi|56383673|gb|AAN44055.2| exonuclease VII, large subunit [Shigella flexneri 2a str. 301]
 gi|281601911|gb|ADA74895.1| Exodeoxyribonuclease 7 large subunit [Shigella flexneri 2002017]
 gi|332755559|gb|EGJ85923.1| exodeoxyribonuclease VII, large subunit [Shigella flexneri K-671]
 gi|332756205|gb|EGJ86556.1| exodeoxyribonuclease VII, large subunit [Shigella flexneri 2747-71]
 gi|332766342|gb|EGJ96552.1| exodeoxyribonuclease VII, large subunit [Shigella flexneri 2930-71]
          Length = 456

 Score =  382 bits (982), Expect = e-104,   Method: Composition-based stats.
 Identities = 147/506 (29%), Positives = 235/506 (46%), Gaps = 57/506 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             E LF  Q+K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAECLFDQQYKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTSVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANQRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSARQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRAGQQQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +I                                         
Sbjct: 356 KIHRTQTRIQQLEYRLAEI----------------------------------------- 374

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +           L++ +  +TL RGY+    T+ N + + + + T   
Sbjct: 375 ------LRAQLSATRERFGNAVTHLEAVSPLSTLARGYSVTTATDGNVLKKVKQVKTGEM 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTK 510
           +     DG   + V N  P K+   K
Sbjct: 429 LTTRLEDGWIESEVKNIQPVKKSRKK 454


>gi|300951786|ref|ZP_07165601.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 116-1]
 gi|300958861|ref|ZP_07170969.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 175-1]
 gi|300314513|gb|EFJ64297.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 175-1]
 gi|300448983|gb|EFK12603.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 116-1]
          Length = 456

 Score =  382 bits (982), Expect = e-104,   Method: Composition-based stats.
 Identities = 146/506 (28%), Positives = 234/506 (46%), Gaps = 57/506 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQYKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPAAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANQRNE------CDVLIVGRGGGSLEDLWGFNDERVARAIFTSRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQMQSTRQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRTGQQQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +                                          
Sbjct: 356 KIHRAQTRIQQLEYRLAE------------------------------------------ 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +           L++ +  +TL RGY+    T+ N + + + +     
Sbjct: 374 -----TLRAQLSATRERFGNAVTHLEAVSPLSTLARGYSVTTATDGNVLKKVKQVKAGEM 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTK 510
           +     DG   + V N  P K+   K
Sbjct: 429 LTTRLEDGWIESEVKNIQPVKKSRKK 454


>gi|261340809|ref|ZP_05968667.1| exodeoxyribonuclease VII, large subunit [Enterobacter cancerogenus
           ATCC 35316]
 gi|288317235|gb|EFC56173.1| exodeoxyribonuclease VII, large subunit [Enterobacter cancerogenus
           ATCC 35316]
          Length = 457

 Score =  382 bits (982), Expect = e-104,   Method: Composition-based stats.
 Identities = 146/507 (28%), Positives = 233/507 (45%), Gaps = 57/507 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           +S     ++VS L+  ++ ++E  +  V + GEIS +    SSGH YF+LKD+ +++   
Sbjct: 3   SSQSPSIFTVSRLNQTVRLLLEQEMGQVWISGEISNFT-QPSSGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q K  +P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 SAEGLFDQQFKKALPTPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI + N  +E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIERANARQE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASVIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    +  L   L N + RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQLELLRQLQNGQQRLEMAMDYFLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              L   L      L  +R +   +RL + +   L+  + R       +  R+       
Sbjct: 296 FTQLYHRLQQQHPQLRLARQQTVLERLRQRMNVALDGQLKRAASRQQRMAQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +                                          
Sbjct: 356 KIYRAQTRIQQLEYRLAE------------------------------------------ 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 +  ++ +           L++ +  +TL RGY+    T+   + Q + +     
Sbjct: 374 -----NVRARLSATRERFGNAVTHLEAVSPLSTLARGYSVTTATDGKVLKQTKQIKAGDV 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTKK 511
           +     DG   + V    P K+   +K
Sbjct: 429 LTTRLSDGWVESEVKAIKPVKKTRQRK 455


>gi|320200073|gb|EFW74662.1| Exodeoxyribonuclease VII large subunit [Escherichia coli EC4100B]
          Length = 456

 Score =  382 bits (982), Expect = e-104,   Method: Composition-based stats.
 Identities = 145/506 (28%), Positives = 235/506 (46%), Gaps = 57/506 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDLQYKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANQRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSTHQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRTGQQQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + + ++                                       
Sbjct: 356 KIHRAQTRIQQLEYRLAETLRV-------------------------------------- 377

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                    ++ +           L++ +  +TL RGY+    T+ N + + + +     
Sbjct: 378 ---------QLSATRERFGNAVTHLEAVSPLSTLARGYSVTTATDGNVLKKVKQVKAGEM 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTK 510
           +     DG   + V N  P K+   K
Sbjct: 429 LTTRLEDGWIESEVKNIQPVKKSRKK 454


>gi|331664069|ref|ZP_08364979.1| exodeoxyribonuclease VII, large subunit [Escherichia coli TA143]
 gi|284922456|emb|CBG35543.1| exodeoxyribonuclease 7 large subunit [Escherichia coli 042]
 gi|331059868|gb|EGI31845.1| exodeoxyribonuclease VII, large subunit [Escherichia coli TA143]
          Length = 458

 Score =  382 bits (982), Expect = e-104,   Method: Composition-based stats.
 Identities = 142/510 (27%), Positives = 231/510 (45%), Gaps = 57/510 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQYKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANQRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + + + RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSAQQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRAGQQQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +                                          
Sbjct: 356 RIHRAQTRIQQLEYRLAE------------------------------------------ 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +           L++ +  +TL RGY+     +   + Q + +     
Sbjct: 374 -----TLRAQLSATRERFGNAVTHLEAVSPLSTLARGYSVTSAADGAVLKQVKQVKAGDT 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTKKCQL 514
           +     DG   + V      ++   K    
Sbjct: 429 LTTRLGDGVVISEVSAVTKTRKPRKKAANP 458


>gi|154245360|ref|YP_001416318.1| exodeoxyribonuclease VII large subunit [Xanthobacter autotrophicus
           Py2]
 gi|154159445|gb|ABS66661.1| exodeoxyribonuclease VII, large subunit [Xanthobacter autotrophicus
           Py2]
          Length = 496

 Score =  382 bits (982), Expect = e-104,   Method: Composition-based stats.
 Identities = 193/525 (36%), Positives = 281/525 (53%), Gaps = 48/525 (9%)

Query: 6   QKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRID 65
            +   + PE+SVSELS  L+  VE    HV VRGEISGYRG H SGHAYFSLKD  +R+D
Sbjct: 17  AEPRANAPEWSVSELSAALRRTVEDAYGHVRVRGEISGYRGPHGSGHAYFSLKDAGARLD 76

Query: 66  AIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKK 125
           A+IWKGT  ++   PEEG+E + IG++TT+PG S YQI+IE+L  +G+G ++  LE+RK+
Sbjct: 77  AVIWKGTFQRLRLKPEEGLEVVAIGRLTTYPGKSGYQIVIEALEFAGAGAIMAMLEERKR 136

Query: 126 KLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDE 185
           +L  EGLF    K  +PF+P++I V+TSPTGAVIRDIL R+  RFP RV+++PV+VQG+ 
Sbjct: 137 RLSAEGLFDPARKVALPFLPQVIGVVTSPTGAVIRDILHRLDDRFPRRVLVWPVRVQGET 196

Query: 186 CPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIIS 245
              E+A AI   N L  G   PRPD+I++ARGGG++EDL  F+DE +VRA A S+IP+++
Sbjct: 197 SAAEVAAAIRGFNALPAGGAIPRPDVIVVARGGGALEDLLGFSDEEVVRAAAESAIPLVA 256

Query: 246 AIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKIN 305
           A+GHETD TL D+AAD+RAPTPT AAEM VPV+  L +++ +L  RL    +RL++ +  
Sbjct: 257 AVGHETDVTLIDFAADVRAPTPTAAAEMVVPVRSELIAAVEDLGGRLAAAPVRLLERRRA 316

Query: 306 TLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHN 365
            L  L + LP+++  LS  R RLD     L   L+               R+  + L   
Sbjct: 317 DLRGLSRLLPSAENLLSVPRQRLDAASERLPRALKANAAAHRLRLVAARARLSPEALRLR 376

Query: 366 IQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLIT 425
           +++    +      +++                                           
Sbjct: 377 LERAGDRLETLDGRLKRAFSVAREQRA--------------------------------A 404

Query: 426 RIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRI 485
           R+                   ++L + ++K  L RG+  ++D     +     L   T +
Sbjct: 405 RLRSA---------------GQLLDALSFKGVLSRGFALVRDAQGQPVRLAAGLTAGTAL 449

Query: 486 LINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQG-ELF 529
            + F DG   A+  +  P               R+    +G  LF
Sbjct: 450 DLEFADGHVAAVTGDVVPAATPAAPARPRPAKSRKPPKVEGPTLF 494


>gi|323170220|gb|EFZ55873.1| exodeoxyribonuclease VII, large subunit [Escherichia coli LT-68]
          Length = 456

 Score =  382 bits (982), Expect = e-104,   Method: Composition-based stats.
 Identities = 145/506 (28%), Positives = 235/506 (46%), Gaps = 57/506 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQYKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANQRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSTRQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRTGQQQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + + ++                                       
Sbjct: 356 KIHRTQTRIQQLEYRLAETLRV-------------------------------------- 377

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                    ++ +           L++ +  +TL RGY+    T+ N + + + +     
Sbjct: 378 ---------QLSATRERFGNAVTHLEAVSPLSTLARGYSVTTATDGNVLKKVKQVKAGEM 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTK 510
           +     DG   + V N  P K+   K
Sbjct: 429 LTTRLEDGWIESEVKNIQPVKKSRKK 454


>gi|323499813|ref|ZP_08104772.1| exodeoxyribonuclease VII large subunit [Vibrio sinaloensis DSM
           21326]
 gi|323315054|gb|EGA68106.1| exodeoxyribonuclease VII large subunit [Vibrio sinaloensis DSM
           21326]
          Length = 443

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 141/495 (28%), Positives = 240/495 (48%), Gaps = 57/495 (11%)

Query: 7   KNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDA 66
            +  +   ++VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++  
Sbjct: 2   SSLTNQNIFTVSRLNAEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSRAQVKC 60

Query: 67  IIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKK 126
            +++G   ++ F P+ G + LV  +++ +     YQ+IIES+ P G G L    ++ K K
Sbjct: 61  AMFRGNNRRVSFKPQNGNQVLVKARLSLYEPRGDYQLIIESMQPEGDGRLQQQFDELKMK 120

Query: 127 LLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDE 185
           L  EGLF+  +K P+P  PK + VITS TGA + DIL  +  R P L V+I+P  VQG+E
Sbjct: 121 LAGEGLFAQTNKRPLPEHPKRVGVITSKTGAALLDILDVLKRRDPSLPVVIYPTMVQGEE 180

Query: 186 CPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIIS 245
              +IA AI   N+  E       D++I+ RGGGS+EDLW FN+E++ R IA+S IPIIS
Sbjct: 181 AAIQIAQAIGCANSRNE------CDVLIVGRGGGSLEDLWCFNNEILARTIASSQIPIIS 234

Query: 246 AIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKIN 305
           A+GHE D T+AD+ AD+RAPTP+ AAE+      H   +    + +L + I   +  +  
Sbjct: 235 AVGHEIDVTIADFVADMRAPTPSAAAELVSRDNSHKAQTFQARQHKLLSAIRYYLAEQKQ 294

Query: 306 TLNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLI 363
             + L+  L   +    L     +LD L   L+  ++ +I  + +      +R++    +
Sbjct: 295 HASQLMHRLERQHPSYQLQRQSQQLDELDMRLQRAMKQLITTRQQSVERKHHRLQLASPV 354

Query: 364 HNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKL 423
             + + R  +   +Q                                             
Sbjct: 355 TRLAEQRSKLDRAEQ--------------------------------------------- 369

Query: 424 ITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKT 483
             ++   +  K+ +    ++I    L + +   TLKRGY+  Q      +TQ  ++ T  
Sbjct: 370 --KLMDAMDRKLLTARHQLAIAAEKLDTVSPLATLKRGYSITQTEQGQVVTQATDVKTGD 427

Query: 484 RILINFFDGQANAIV 498
            ++    DG+  + V
Sbjct: 428 TLVTRLADGELRSTV 442


>gi|90416233|ref|ZP_01224165.1| exodeoxyribonuclease VII large subunit [marine gamma
           proteobacterium HTCC2207]
 gi|90331958|gb|EAS47172.1| exodeoxyribonuclease VII large subunit [marine gamma
           proteobacterium HTCC2207]
          Length = 449

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 147/503 (29%), Positives = 239/503 (47%), Gaps = 59/503 (11%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           MNP    N  +   +SVS+L+  ++H++E+ L  + V GEIS +    +SGH Y +LKD+
Sbjct: 1   MNP----NPSERQVFSVSQLNRSVRHLIETQLPLLWVEGEISNF-ARPASGHWYLTLKDD 55

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            +++   +++    ++ F P  G + LV  +   + G  +YQ++IE +  +G G L    
Sbjct: 56  QAQVRCAMFRNANQRVGFKPANGTQVLVRCRAGLYEGRGEYQLVIEHMEEAGFGALQRQF 115

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPV 179
           E+ K+KL +EGLF +QHK P+P     I VITS TGA ++D+L  ++ RFP ++V IFP 
Sbjct: 116 EQLKQKLSDEGLFDNQHKRPMPDSVSHIGVITSATGAAVKDVLSVLARRFPSIKVSIFPT 175

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
            VQG++  K+I  AI   N L +       D +I+ RGGGS+EDLW FN+E++ RAI  S
Sbjct: 176 AVQGEQAAKQIVEAINNANQLGQ------CDALIVGRGGGSLEDLWPFNEEVVARAIFAS 229

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
           +IPI+SA+GHE D+T+AD+ ADLRAPTP+ AAE+  P  E + +     E  L   + R 
Sbjct: 230 AIPIVSAVGHEVDFTIADFVADLRAPTPSAAAELLSPDGEDILNQFEGFEILLTEAVGRK 289

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
           I         L K L +    L      LD L   L   ++  + ++ +  N +  ++  
Sbjct: 290 ISQLRQRTEYLKKRLRHPGHKLQEQSQHLDHLDIRLRRAIDNKLEQRRQQINRVQAQLAR 349

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH 419
                 I    Q +    + + +                                     
Sbjct: 350 VHPGEAIGDYHQLVARYVKQMSR------------------------------------- 372

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
                      +  +++   +       +L + +   TL RGY+ I+DT+N  +    +L
Sbjct: 373 ----------TVRQQLEVRRSKTGQAMHLLDTVSPLKTLGRGYSIIRDTDNAVVKSVASL 422

Query: 480 ATKTRILINFFDGQANAIVINKA 502
                +     DG+    V    
Sbjct: 423 NKGDMLRGQLEDGEVILAVTGTN 445


>gi|229523412|ref|ZP_04412819.1| exodeoxyribonuclease VII large subunit [Vibrio cholerae TM
           11079-80]
 gi|229339775|gb|EEO04790.1| exodeoxyribonuclease VII large subunit [Vibrio cholerae TM
           11079-80]
          Length = 464

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 143/491 (29%), Positives = 241/491 (49%), Gaps = 57/491 (11%)

Query: 11  DHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           +   Y+VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++   ++K
Sbjct: 25  NRNIYTVSRLNSEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSQAQVKCAMFK 83

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           G    + F P+ G + LV  +++ +     YQII+ES+ P G G L    E+ K +L  E
Sbjct: 84  GNNRLVNFKPQNGQQVLVKARLSLYEPRGDYQIILESMQPEGDGRLQQQFEQLKMQLAAE 143

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKE 189
           GLF+   K P+P  P+ + +ITS TGA + DIL  +  R P L V+I+P  VQG+E   +
Sbjct: 144 GLFAQTRKKPLPDNPRCVGIITSRTGAALHDILHVLKRRDPNLPVVIYPTLVQGEEAAIQ 203

Query: 190 IANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGH 249
           IA AI + NT  E       D++I+ RGGGS+EDLW FN E++ R IA S IPIISA+GH
Sbjct: 204 IAQAIGRANTRAE------CDVLIVGRGGGSLEDLWCFNHEIVARTIAASEIPIISAVGH 257

Query: 250 ETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNS 309
           E D T+AD+ AD+RAPTP+ AAE+      H Q +L   +A+L + +   +  +      
Sbjct: 258 EIDVTIADFVADVRAPTPSAAAELVSRDHRHKQQALHQWQAKLASAMRHYLAQQDTQFAR 317

Query: 310 LLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQ 367
           L   L   +    L   + +LD L   LE  ++  +  + + ++ + ++I+    IH I+
Sbjct: 318 LQHKLDKQHPQARLERQQQQLDELSLRLEQKMQQRLATQQQRWDRLSHKIELHSPIHLIR 377

Query: 368 KNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRI 427
           + R ++++++Q I Q                                             
Sbjct: 378 QQRFNLIQQEQRINQ--------------------------------------------- 392

Query: 428 EFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILI 487
              +   +      +++ +  L + +   TL RGY+  +      + Q   +     ++ 
Sbjct: 393 --SIQRYLIQSRHQLALLSEKLDAVSPLATLARGYSVTRTAQGELVRQSAQVKPGDTLVT 450

Query: 488 NFFDGQANAIV 498
              DG+  + V
Sbjct: 451 QLMDGEILSTV 461


>gi|229530104|ref|ZP_04419494.1| exodeoxyribonuclease VII large subunit [Vibrio cholerae 12129(1)]
 gi|229333878|gb|EEN99364.1| exodeoxyribonuclease VII large subunit [Vibrio cholerae 12129(1)]
          Length = 464

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 144/491 (29%), Positives = 242/491 (49%), Gaps = 57/491 (11%)

Query: 11  DHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           +   Y+VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++   ++K
Sbjct: 25  NRNIYTVSRLNSEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSQAQVKCAMFK 83

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           G    + F P+ G + LV  +++ +     YQII+ES+ P G G L    E+ K +L  E
Sbjct: 84  GNNRLVNFKPQNGQQVLVKARLSLYEPRGDYQIILESMQPEGDGRLQQQFEQLKMQLAAE 143

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKE 189
           GLF+   K P+P  P+ + +ITS TGA + DIL  +  R P L V+I+P  VQG+E   +
Sbjct: 144 GLFAQTRKKPLPENPRCVGIITSRTGAALHDILHVLKRRDPNLPVVIYPTLVQGEEAAIQ 203

Query: 190 IANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGH 249
           IA AI + NT  E       D++I+ RGGGS+EDLW FN E++ R IA S IPIISA+GH
Sbjct: 204 IAQAIGRANTRAE------CDVLIVGRGGGSLEDLWCFNHEIVARTIAASEIPIISAVGH 257

Query: 250 ETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNS 309
           E D T+AD+ AD+RAPTP+ AAE+      H Q +L   +A+L + +   +  +      
Sbjct: 258 EIDVTIADFVADVRAPTPSAAAELVSRDHRHKQQALHQWQAKLASAMRHYLAQQDTQFAR 317

Query: 310 LLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQ 367
           L   L   +    L   + +LD L   LE  ++  +  + + ++ + ++I+    IH I+
Sbjct: 318 LQHKLDKQHPQARLERQQQQLDELSLRLEQKMQQRLATQQQRWDRLSHKIELHSPIHLIR 377

Query: 368 KNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRI 427
           + R ++++++Q I Q                                             
Sbjct: 378 QQRFNLIQQEQRINQ--------------------------------------------- 392

Query: 428 EFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILI 487
              +   +      +++ +  L + +   TL RGY+  + T    + Q   +     ++ 
Sbjct: 393 --SIQRYLIQSRHQLALLSEKLDAVSPLATLARGYSVTRTTQGELVRQSAQVKPGDTLVT 450

Query: 488 NFFDGQANAIV 498
              DG+  + V
Sbjct: 451 QLMDGEILSTV 461


>gi|74313035|ref|YP_311454.1| exodeoxyribonuclease VII large subunit [Shigella sonnei Ss046]
 gi|187731397|ref|YP_001881300.1| exodeoxyribonuclease VII large subunit [Shigella boydii CDC
           3083-94]
 gi|191167680|ref|ZP_03029489.1| exodeoxyribonuclease VII, large subunit [Escherichia coli B7A]
 gi|193068370|ref|ZP_03049333.1| exodeoxyribonuclease VII, large subunit [Escherichia coli E110019]
 gi|218555034|ref|YP_002387947.1| exodeoxyribonuclease VII large subunit [Escherichia coli IAI1]
 gi|218696136|ref|YP_002403803.1| exodeoxyribonuclease VII large subunit [Escherichia coli 55989]
 gi|256017343|ref|ZP_05431208.1| exodeoxyribonuclease VII large subunit [Shigella sp. D9]
 gi|293446862|ref|ZP_06663284.1| exodeoxyribonuclease VII [Escherichia coli B088]
 gi|300817721|ref|ZP_07097936.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 107-1]
 gi|300820821|ref|ZP_07100971.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 119-7]
 gi|300903525|ref|ZP_07121448.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 84-1]
 gi|300927128|ref|ZP_07142876.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 182-1]
 gi|301302866|ref|ZP_07208994.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 124-1]
 gi|301330400|ref|ZP_07223042.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 78-1]
 gi|309794444|ref|ZP_07688867.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 145-7]
 gi|331678500|ref|ZP_08379175.1| exodeoxyribonuclease VII, large subunit [Escherichia coli H591]
 gi|332278338|ref|ZP_08390751.1| exonuclease VII large subunit [Shigella sp. D9]
 gi|123745956|sp|Q3YZ43|EX7L_SHISS RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|226694650|sp|B7M7L3|EX7L_ECO8A RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|226697609|sp|B2TXT4|EX7L_SHIB3 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|254783700|sp|B7LCP9|EX7L_ECO55 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|73856512|gb|AAZ89219.1| exonuclease VII, large subunit [Shigella sonnei Ss046]
 gi|187428389|gb|ACD07663.1| exodeoxyribonuclease VII, large subunit [Shigella boydii CDC
           3083-94]
 gi|190902279|gb|EDV62019.1| exodeoxyribonuclease VII, large subunit [Escherichia coli B7A]
 gi|192958322|gb|EDV88762.1| exodeoxyribonuclease VII, large subunit [Escherichia coli E110019]
 gi|218352868|emb|CAU98667.1| exonuclease VII, large subunit [Escherichia coli 55989]
 gi|218361802|emb|CAQ99401.1| exonuclease VII, large subunit [Escherichia coli IAI1]
 gi|291323692|gb|EFE63120.1| exodeoxyribonuclease VII [Escherichia coli B088]
 gi|300404460|gb|EFJ87998.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 84-1]
 gi|300416898|gb|EFK00209.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 182-1]
 gi|300526574|gb|EFK47643.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 119-7]
 gi|300529709|gb|EFK50771.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 107-1]
 gi|300841801|gb|EFK69561.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 124-1]
 gi|300843629|gb|EFK71389.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 78-1]
 gi|308121900|gb|EFO59162.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 145-7]
 gi|315256529|gb|EFU36497.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 85-1]
 gi|320175072|gb|EFW50185.1| Exodeoxyribonuclease VII large subunit [Shigella dysenteriae CDC
           74-1112]
 gi|320185209|gb|EFW59989.1| Exodeoxyribonuclease VII large subunit [Shigella flexneri CDC
           796-83]
 gi|323169047|gb|EFZ54724.1| exodeoxyribonuclease VII, large subunit [Shigella sonnei 53G]
 gi|323184430|gb|EFZ69805.1| exodeoxyribonuclease VII, large subunit [Escherichia coli 1357]
 gi|323944731|gb|EGB40798.1| exodeoxyribonuclease VII [Escherichia coli H120]
 gi|324118147|gb|EGC12044.1| exodeoxyribonuclease VII [Escherichia coli E1167]
 gi|331074960|gb|EGI46280.1| exodeoxyribonuclease VII, large subunit [Escherichia coli H591]
 gi|332092786|gb|EGI97855.1| exodeoxyribonuclease VII, large subunit [Shigella boydii 3594-74]
 gi|332100690|gb|EGJ04036.1| exonuclease VII large subunit [Shigella sp. D9]
          Length = 456

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 145/506 (28%), Positives = 235/506 (46%), Gaps = 57/506 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQYKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANQRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSTRQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRTGQQQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + + ++                                       
Sbjct: 356 KIHRAQTRIQQLEYRLAETLRV-------------------------------------- 377

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                    ++ +           L++ +  +TL RGY+    T+ N + + + +     
Sbjct: 378 ---------QLSATRERFGNAVTHLEAVSPLSTLARGYSVTTATDGNVLKKVKQVKAGEM 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTK 510
           +     DG   + V N  P K+   K
Sbjct: 429 LTTRLEDGWIESEVKNIQPVKKSRKK 454


>gi|15640785|ref|NP_230415.1| exodeoxyribonuclease VII large subunit [Vibrio cholerae O1 biovar
           El Tor str. N16961]
 gi|121585732|ref|ZP_01675527.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae 2740-80]
 gi|121725972|ref|ZP_01679271.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae V52]
 gi|153817270|ref|ZP_01969937.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae NCTC 8457]
 gi|227080945|ref|YP_002809496.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae M66-2]
 gi|254847903|ref|ZP_05237253.1| exodeoxyribonuclease 7 large subunit [Vibrio cholerae MO10]
 gi|255744572|ref|ZP_05418523.1| exodeoxyribonuclease VII large subunit [Vibrio cholera CIRS 101]
 gi|262161293|ref|ZP_06030404.1| exodeoxyribonuclease VII large subunit [Vibrio cholerae INDRE 91/1]
 gi|298499101|ref|ZP_07008908.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae MAK 757]
 gi|14194729|sp|Q9KTW4|EX7L_VIBCH RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|254783717|sp|C3LT19|EX7L_VIBCM RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|9655213|gb|AAF93931.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae O1 biovar
           El Tor str. N16961]
 gi|121550095|gb|EAX60111.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae 2740-80]
 gi|121631454|gb|EAX63824.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae V52]
 gi|126512186|gb|EAZ74780.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae NCTC 8457]
 gi|227008833|gb|ACP05045.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae M66-2]
 gi|254843608|gb|EET22022.1| exodeoxyribonuclease 7 large subunit [Vibrio cholerae MO10]
 gi|255737603|gb|EET92997.1| exodeoxyribonuclease VII large subunit [Vibrio cholera CIRS 101]
 gi|262029043|gb|EEY47696.1| exodeoxyribonuclease VII large subunit [Vibrio cholerae INDRE 91/1]
 gi|297543434|gb|EFH79484.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae MAK 757]
          Length = 446

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 144/496 (29%), Positives = 243/496 (48%), Gaps = 57/496 (11%)

Query: 6   QKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRID 65
             +  +   Y+VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++ 
Sbjct: 2   SSSLANRNIYTVSRLNSEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSQAQVK 60

Query: 66  AIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKK 125
             ++KG    + F P+ G + LV  +++ +     YQII+ES+ P G G L    E+ K 
Sbjct: 61  CAMFKGNNRLVNFKPQNGQQVLVKARLSLYEPRGDYQIILESMQPEGDGRLQQQFEQLKM 120

Query: 126 KLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGD 184
           +L  EGLF+   K P+P  P+ + +ITS TGA + DIL  +  R P L V+I+P  VQG+
Sbjct: 121 QLAAEGLFAQTRKKPLPENPRCVGIITSRTGAALHDILHVLKRRDPNLPVVIYPTLVQGE 180

Query: 185 ECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPII 244
           E   +IA AI + NT  E       D++I+ RGGGS+EDLW FN E++ R IA S IPII
Sbjct: 181 EAAIQIAQAIGRANTRAE------CDVLIVGRGGGSLEDLWCFNHEIVARTIAASEIPII 234

Query: 245 SAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKI 304
           SA+GHE D T+AD+ AD+RAPTP+ AAE+      H Q +L   +A+L + +   +  + 
Sbjct: 235 SAVGHEIDVTIADFVADVRAPTPSAAAELVSRDHRHKQQALHQWQAKLASTMRHYLAQQE 294

Query: 305 NTLNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFL 362
                L   L   +    L   + +LD L   LE  ++  +  + + ++ + ++I+    
Sbjct: 295 TQFARLQHKLDKQHPQARLERQQQQLDELSLRLEQKMQQRLATQQQRWDRLSHKIELHSP 354

Query: 363 IHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKK 422
           IH I++ R ++++++Q I Q                                        
Sbjct: 355 IHLIRQQRFNLIQQEQRINQ---------------------------------------- 374

Query: 423 LITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATK 482
                   +   +      +++ +  L + +   TL RGY+  + T    + Q   +   
Sbjct: 375 -------SIQRYLIQSRHQLALLSEKLDAVSPLATLARGYSVTRTTQGELVRQSAQVKPG 427

Query: 483 TRILINFFDGQANAIV 498
             ++    DG+  + V
Sbjct: 428 DTLVTQLMDGEILSTV 443


>gi|311694943|gb|ADP97816.1| exodeoxyribonuclease VII large subunit [marine bacterium HP15]
          Length = 462

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 151/509 (29%), Positives = 232/509 (45%), Gaps = 56/509 (11%)

Query: 3   PFSQKNSLDHP-EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           P +       P   SVSEL++  +H++ES+   V V GE+SG     SSGH YFSLKD  
Sbjct: 8   PATPHLQDTRPRALSVSELNHQARHLLESSFMQVWVEGELSGL-SRPSSGHWYFSLKDRK 66

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
            ++   +++G   +I   P+EG +  + GK+T +     +QII+E + P+G G L  A E
Sbjct: 67  CQVRCAMFRGMNQRIRTPPKEGDQVRIRGKVTLYENRGDFQIIVEHVEPAGLGALQQAFE 126

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVK 180
           + K+KLL EGLF    K P+P +P+ I V+TSPTGA I DIL  ++ R P + V ++P  
Sbjct: 127 ELKRKLLAEGLFEQASKKPLPSLPRHIGVVTSPTGAAIHDILTVLARRCPAIPVTLYPTA 186

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQG     +I  AI         +     D++I+ RGGGS+EDLW FN+E + RAIA   
Sbjct: 187 VQGKAATADIVRAIEA------AQNHGVADVLIIGRGGGSLEDLWCFNEEAVARAIAACR 240

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP +SA+GHE D T+AD+ ADLRAPTP+ AAE   P +      L + E RL+N +   +
Sbjct: 241 IPTVSAVGHEVDVTIADFVADLRAPTPSAAAEKISPDQSDWLKQLRDREFRLSNAMGLAL 300

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           K     L  L   L +  + L     R+D L   L   +   +       +H+  R+   
Sbjct: 301 KRLGTQLGHLSARLRDPRRELLEKAQRMDELELRLRKAIRQRLTTVGVRNDHLRQRLVMQ 360

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420
                +  ++  +    + +                                +  +   +
Sbjct: 361 SPHRQLSDSQDALRRVSERL--------------------------------VSVMQQDL 388

Query: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480
           K+    +                   + L   +   TL RGY+ ++D N N +    N+ 
Sbjct: 389 KQRRDNL---------------EHAAQTLNVVSPLATLGRGYSIVRDNNGNILRDASNVN 433

Query: 481 TKTRILINFFDGQANAIVINKAPPKEQPT 509
               I      G+  A V +    +E   
Sbjct: 434 PGDTISARVARGEMTAKVTSVKSAEETGP 462


>gi|16130434|ref|NP_417004.1| exonuclease VII, large subunit [Escherichia coli str. K-12 substr.
           MG1655]
 gi|89109315|ref|AP_003095.1| exonuclease VII, large subunit [Escherichia coli str. K-12 substr.
           W3110]
 gi|170082119|ref|YP_001731439.1| exonuclease VII, large subunit [Escherichia coli str. K-12 substr.
           DH10B]
 gi|194437699|ref|ZP_03069795.1| exodeoxyribonuclease VII, large subunit [Escherichia coli 101-1]
 gi|238901674|ref|YP_002927470.1| exonuclease VII, large subunit [Escherichia coli BW2952]
 gi|253772597|ref|YP_003035428.1| exodeoxyribonuclease VII large subunit [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254162483|ref|YP_003045591.1| exodeoxyribonuclease VII large subunit [Escherichia coli B str.
           REL606]
 gi|256021805|ref|ZP_05435670.1| exodeoxyribonuclease VII large subunit [Escherichia sp. 4_1_40B]
 gi|300930149|ref|ZP_07145570.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 187-1]
 gi|301022367|ref|ZP_07186256.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 196-1]
 gi|301648264|ref|ZP_07248007.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 146-1]
 gi|307139144|ref|ZP_07498500.1| exodeoxyribonuclease VII large subunit [Escherichia coli H736]
 gi|331643129|ref|ZP_08344264.1| exodeoxyribonuclease VII, large subunit [Escherichia coli H736]
 gi|2507019|sp|P04994|EX7L_ECOLI RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|226694651|sp|B1XAY4|EX7L_ECODH RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|259646288|sp|C4ZX84|EX7L_ECOBW RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|1788856|gb|AAC75562.1| exonuclease VII, large subunit [Escherichia coli str. K-12 substr.
           MG1655]
 gi|1805569|dbj|BAA16396.1| exonuclease VII, large subunit [Escherichia coli str. K12 substr.
           W3110]
 gi|169889954|gb|ACB03661.1| exonuclease VII, large subunit [Escherichia coli str. K-12 substr.
           DH10B]
 gi|194423505|gb|EDX39496.1| exodeoxyribonuclease VII, large subunit [Escherichia coli 101-1]
 gi|238861056|gb|ACR63054.1| exonuclease VII, large subunit [Escherichia coli BW2952]
 gi|242378107|emb|CAQ32880.1| exonuclease VII, large subunit, subunit of exonuclease VII
           [Escherichia coli BL21(DE3)]
 gi|253323641|gb|ACT28243.1| exodeoxyribonuclease VII, large subunit [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253974384|gb|ACT40055.1| exodeoxyribonuclease VII large subunit [Escherichia coli B str.
           REL606]
 gi|253978551|gb|ACT44221.1| exodeoxyribonuclease VII large subunit [Escherichia coli BL21(DE3)]
 gi|260448411|gb|ACX38833.1| exodeoxyribonuclease VII, large subunit [Escherichia coli DH1]
 gi|299881280|gb|EFI89491.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 196-1]
 gi|300461955|gb|EFK25448.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 187-1]
 gi|301073651|gb|EFK88457.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 146-1]
 gi|309702841|emb|CBJ02172.1| exodeoxyribonuclease 7 large subunit [Escherichia coli ETEC H10407]
 gi|315137133|dbj|BAJ44292.1| exodeoxyribonuclease VII large subunit [Escherichia coli DH1]
 gi|315615768|gb|EFU96400.1| exodeoxyribonuclease VII, large subunit [Escherichia coli 3431]
 gi|323936402|gb|EGB32692.1| exodeoxyribonuclease VII [Escherichia coli E1520]
 gi|323961319|gb|EGB56931.1| exodeoxyribonuclease VII [Escherichia coli H489]
 gi|331039927|gb|EGI12147.1| exodeoxyribonuclease VII, large subunit [Escherichia coli H736]
 gi|332344381|gb|AEE57715.1| exodeoxyribonuclease VII, large subunit XseA [Escherichia coli
           UMNK88]
          Length = 456

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 146/506 (28%), Positives = 234/506 (46%), Gaps = 57/506 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQYKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPAAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANQRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFTSRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSTRQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRTGQQQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +                                          
Sbjct: 356 KIHRAQTRIQQLEYRLAE------------------------------------------ 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +           L++ +  +TL RGY+    T+ N + + + +     
Sbjct: 374 -----TLRAQLSATRERFGNAVTHLEAVSPLSTLARGYSVTTATDGNVLKKVKQVKAGEM 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTK 510
           +     DG   + V N  P K+   K
Sbjct: 429 LTTRLEDGWIESEVKNIQPVKKSRKK 454


>gi|330445252|ref|ZP_08308904.1| exodeoxyribonuclease VII, large subunit [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328489443|dbj|GAA03401.1| exodeoxyribonuclease VII, large subunit [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 449

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 140/502 (27%), Positives = 237/502 (47%), Gaps = 57/502 (11%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M  FS ++  +   Y+VS L+  ++ I+E+ +  V + GE+S +  +  SGH YF+LKD+
Sbjct: 1   MTTFSPQSQTNSRIYTVSSLNAQVRLILENEMGVVWLIGELSNF-SMPVSGHWYFTLKDS 59

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            +++   ++KG+   + F P  G + LV  +++ +     YQ+IIES+ P G G L    
Sbjct: 60  RAQVKCAMFKGSNRHVTFKPGNGNQVLVKARLSLYEPRGDYQLIIESMQPEGDGRLQQQF 119

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPV 179
           E+ K  L  EGLF+   K  +P  PK + +ITS TGA + DIL  +  R P L ++I+P 
Sbjct: 120 EQLKMSLAAEGLFAQSLKKSLPEQPKRVGIITSKTGAALHDILHVLQRRDPSLPIVIYPT 179

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
            VQG+     IA AI + N  +E       D++I+ RGGGS+EDLW FN+E++ R IA S
Sbjct: 180 MVQGEGAAISIAQAIGRANARQE------CDVLIVGRGGGSLEDLWAFNEEIVARTIAAS 233

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
            IPI+SA+GHE D T+AD+ AD+RAPTP+ AAE+      H    L     +L + I   
Sbjct: 234 QIPIVSAVGHEVDVTIADFVADVRAPTPSAAAELISRDMTHQTQLLDRKRQQLRHAITAY 293

Query: 300 IKYKINTLNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRI 357
           +   +     L   L   +    L+  +  LD + + L   +   I +  +H  H   ++
Sbjct: 294 LSQSLRQTTQLQHRLERQHPQLRLNLQQQHLDEISQRLTQAMAKKIQKHQKHVEHNNYKL 353

Query: 358 KSDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLH 417
                   ++  +Q++   +Q                                       
Sbjct: 354 SLYSPASLVRNAQQNLERSEQR-------------------------------------- 375

Query: 418 THIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKR 477
                    +   L  K+ +    +++    L++ +   TL RGY+  ++   + I +  
Sbjct: 376 ---------LYDALDRKLLNARHKLAVAAEKLETVSPLATLARGYSITRNEQGDVIRKAS 426

Query: 478 NLATKTRILINFFDGQANAIVI 499
            +     ++    DG+ ++ VI
Sbjct: 427 QVKAGDTLITTVTDGEIHSSVI 448


>gi|283786123|ref|YP_003365988.1| exodeoxyribonuclease 7 large subunit [Citrobacter rodentium ICC168]
 gi|282949577|emb|CBG89195.1| exodeoxyribonuclease 7 large subunit [Citrobacter rodentium ICC168]
          Length = 457

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 145/508 (28%), Positives = 236/508 (46%), Gaps = 57/508 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           +S +   ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   SSPNSTIFTVSRLNQTVRLLLEQEMGQVWISGEISNF-SQPASGHWYFTLKDDAAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRASITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  QHK P+P     + VITS TGA + DILQ +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQHKQPLPSPAHCVGVITSKTGAALHDILQVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANRRSE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+  DLRAPTP+ AAEM    ++ L   + +++ RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVGDLRAPTPSAAAEMVSRNQQELLRQIQSVQQRLGMAMDYFLASRHRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              L   L      L  +R +   DRL + L   ++  + R  +    ++ R+       
Sbjct: 296 FTQLHHRLQQQHPQLRLARQQTALDRLRQRLNVAIDSQLKRTNQRQLRLLQRLNHHHPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +                                          
Sbjct: 356 RIHRAQSRIQQLEYRLAE------------------------------------------ 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 +  ++ +           L++ +  +TL RGY+    T+   + +   +     
Sbjct: 374 -----NIRARLSATRERFGNAVTHLEAVSPLSTLARGYSVSTATDGKILKKVNQVKAGDV 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTKKC 512
           +     DG   + V      K+   +K 
Sbjct: 429 MTTRLADGWVESEVTAVKAAKKSRQRKS 456


>gi|170679853|ref|YP_001744694.1| exodeoxyribonuclease VII large subunit [Escherichia coli SMS-3-5]
 gi|226694873|sp|B1LNG1|EX7L_ECOSM RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|170517571|gb|ACB15749.1| exodeoxyribonuclease VII, large subunit [Escherichia coli SMS-3-5]
          Length = 455

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 143/507 (28%), Positives = 231/507 (45%), Gaps = 57/507 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+KN +P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDLQYKNSLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANQRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSARQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +H   +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRAGQHQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +                                          
Sbjct: 356 KIHRAQTRIQQLEYRLAE------------------------------------------ 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +           L++ +  +TL RGY+     +   + Q + +     
Sbjct: 374 -----TLRAQLSATRERFGNAVTHLEAVSPLSTLARGYSVTSAADGAVLKQVKQVKVGET 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTKK 511
           +     DG   + V      ++   K 
Sbjct: 429 LTTRLGDGVVISEVSAVTKSRKPRKKA 455


>gi|262402849|ref|ZP_06079410.1| exodeoxyribonuclease VII large subunit [Vibrio sp. RC586]
 gi|262351631|gb|EEZ00764.1| exodeoxyribonuclease VII large subunit [Vibrio sp. RC586]
          Length = 446

 Score =  382 bits (980), Expect = e-104,   Method: Composition-based stats.
 Identities = 140/496 (28%), Positives = 242/496 (48%), Gaps = 57/496 (11%)

Query: 6   QKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRID 65
             +  +   Y+VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++ 
Sbjct: 2   SSSLANRNIYTVSRLNSEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSQAQVK 60

Query: 66  AIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKK 125
             ++KG    + F P+ G + LV  +++ +     YQII+ES+ P G G L    E+ K 
Sbjct: 61  CAMFKGNNRLVNFKPQNGQQVLVKARLSLYEPRGDYQIILESMQPEGDGRLQQQFEQLKM 120

Query: 126 KLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGD 184
           +L  EGLF+   K  +P  P+ + +ITS TGA + DIL  +  R P L V+I+P  VQG+
Sbjct: 121 QLAAEGLFAQTRKKALPENPRCVGIITSRTGAALHDILHVLKRRDPNLPVVIYPTLVQGE 180

Query: 185 ECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPII 244
           +   +IA AI + N   E       D++I+ RGGGS+EDLW FN E++ R IA S IP+I
Sbjct: 181 DAAIQIAQAIGRANARSE------CDVLIVGRGGGSLEDLWCFNHEIVARTIAASEIPVI 234

Query: 245 SAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKI 304
           SA+GHE D T+AD+ AD+RAPTP+ AAE+      H Q +L   +A+L + +   +  + 
Sbjct: 235 SAVGHEIDVTIADFVADVRAPTPSAAAELVSRDNRHKQQALHQWQAKLASAMRHYLTQQD 294

Query: 305 NTLNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFL 362
                +   L   +    L   + +LD L   LE  ++  +  + + ++ + ++I+    
Sbjct: 295 TQFARIQHKLDKQHPQARLERQQQQLDELSLRLEQKMQHRLATQQQRWDRLSHKIELHSP 354

Query: 363 IHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKK 422
           IH +++ R H+++++Q I Q                                        
Sbjct: 355 IHLVRQQRFHLIQQEQRINQ---------------------------------------- 374

Query: 423 LITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATK 482
                   + H +      +++ +  L + +   TL RGY+  + T    + Q   +   
Sbjct: 375 -------SIQHYLIQSRHQLALLSEKLDAVSPLATLARGYSVTRTTQGELVRQSAQVKPG 427

Query: 483 TRILINFFDGQANAIV 498
             ++    DG+  + V
Sbjct: 428 DTLVTQLMDGEILSTV 443


>gi|168243287|ref|ZP_02668219.1| exodeoxyribonuclease VII, large subunit [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|194447717|ref|YP_002046572.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|226697604|sp|B4TD84|EX7L_SALHS RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|194406021|gb|ACF66240.1| exodeoxyribonuclease VII, large subunit [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|205337649|gb|EDZ24413.1| exodeoxyribonuclease VII, large subunit [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
          Length = 449

 Score =  382 bits (980), Expect = e-104,   Method: Composition-based stats.
 Identities = 143/499 (28%), Positives = 228/499 (45%), Gaps = 57/499 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           +S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   SSQTSSIFTVSRLNQTVRLLLEQEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIAESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  QHK P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 HAEGLFDQQHKQPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANARGE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + + + RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEIVSRNQQELLRQIQSAQQRLGMAMDYYLANRSRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  I +  +    +  R+       
Sbjct: 296 FTQIFHRLQQQHPQLRLARQQTALERLRQRMGFALEARIKQANQRQQRVSQRLSQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +                                               
Sbjct: 356 RIHRAQSRIQQLEYR--------------------------------------------- 370

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
             +   +  ++             L++ +   TL RGYT    T+   + + + +     
Sbjct: 371 --LTENIRSRLSEQRERFGNAVTHLEAVSPLATLARGYTVSTTTDGKVLKKIKQVKAGDI 428

Query: 485 ILINFFDGQANAIVINKAP 503
           +     DG   + V +  P
Sbjct: 429 MTTRLEDGWLESEVKSVTP 447


>gi|218706010|ref|YP_002413529.1| exodeoxyribonuclease VII large subunit [Escherichia coli UMN026]
 gi|293405947|ref|ZP_06649939.1| exodeoxyribonuclease 7 large subunit [Escherichia coli FVEC1412]
 gi|298381749|ref|ZP_06991348.1| exodeoxyribonuclease VII large subunit [Escherichia coli FVEC1302]
 gi|300898391|ref|ZP_07116734.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 198-1]
 gi|226694666|sp|B7N693|EX7L_ECOLU RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|218433107|emb|CAR14002.1| exonuclease VII, large subunit [Escherichia coli UMN026]
 gi|291428155|gb|EFF01182.1| exodeoxyribonuclease 7 large subunit [Escherichia coli FVEC1412]
 gi|298279191|gb|EFI20705.1| exodeoxyribonuclease VII large subunit [Escherichia coli FVEC1302]
 gi|300357931|gb|EFJ73801.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 198-1]
          Length = 458

 Score =  382 bits (980), Expect = e-104,   Method: Composition-based stats.
 Identities = 142/510 (27%), Positives = 231/510 (45%), Gaps = 57/510 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQYKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANQRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + + + RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSAQQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLWLARQQTMLERLQKRMSFALENQLKRAGQQQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +                                          
Sbjct: 356 RIHRAQTRIQQLEYRLAE------------------------------------------ 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +           L++ +  +TL RGY+     +   + Q + +     
Sbjct: 374 -----TLRAQLSATRERFGNAVTHLEAVSPLSTLARGYSVTSAADGAVLKQVKQVKAGDT 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTKKCQL 514
           +     DG   + V      ++   K    
Sbjct: 429 LTTRLGDGVVISEVSAVTKTRKPRKKAANP 458


>gi|229513095|ref|ZP_04402561.1| exodeoxyribonuclease VII large subunit [Vibrio cholerae TMA 21]
 gi|229349988|gb|EEO14942.1| exodeoxyribonuclease VII large subunit [Vibrio cholerae TMA 21]
          Length = 464

 Score =  382 bits (980), Expect = e-103,   Method: Composition-based stats.
 Identities = 144/491 (29%), Positives = 242/491 (49%), Gaps = 57/491 (11%)

Query: 11  DHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           +   Y+VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++   ++K
Sbjct: 25  NRNIYTVSRLNSEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSQAQVKCAMFK 83

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           G    + F P+ G + LV  +++ +     YQII+ES+ P G G L    E+ K +L  E
Sbjct: 84  GNNRLVNFKPQNGQQVLVKARLSLYEPRGDYQIILESMQPEGDGRLQQQFEQLKMQLAAE 143

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKE 189
           GLF+   K P+P  P+ + +ITS TGA + DIL  +  R P L V+I+P  VQG+E   +
Sbjct: 144 GLFAQTRKKPLPDNPRCVGIITSRTGAALHDILHVLKRRDPNLPVVIYPTLVQGEEAAIQ 203

Query: 190 IANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGH 249
           IA AI + NT  E       D++I+ RGGGS+EDLW FN E++ R IA S IPIISA+GH
Sbjct: 204 IAQAIGRANTRAE------CDVLIVGRGGGSLEDLWCFNHEIVARTIAASEIPIISAVGH 257

Query: 250 ETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNS 309
           E D T+AD+ AD+RAPTP+ AAE+      H Q +L   +A+L + +   +  +      
Sbjct: 258 EIDVTIADFVADVRAPTPSAAAELVSRDHRHKQQALHQWQAKLASAMRHYLAQQDTQFAR 317

Query: 310 LLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQ 367
           L   L   +    L   + +LD L   LE  ++  +  + + ++ + ++I+    IH I+
Sbjct: 318 LQHKLDKQHPQARLERQQQQLDELSLRLEQKMQQRLATQQQRWDRLSHKIELHSPIHLIR 377

Query: 368 KNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRI 427
           + R ++++++Q I Q                                             
Sbjct: 378 QQRFNLIQQEQRINQ--------------------------------------------- 392

Query: 428 EFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILI 487
              +   +      +++ +  L + +   TL RGY+  + T    + Q   +     ++ 
Sbjct: 393 --SIQRYLIQSRHQLALLSEKLDAVSPLATLARGYSVTRTTQGELVRQSAQVKPGDTLVT 450

Query: 488 NFFDGQANAIV 498
              DG+  + V
Sbjct: 451 QLMDGEILSTV 461


>gi|153828281|ref|ZP_01980948.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae 623-39]
 gi|148876235|gb|EDL74370.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae 623-39]
          Length = 446

 Score =  382 bits (980), Expect = e-103,   Method: Composition-based stats.
 Identities = 144/496 (29%), Positives = 243/496 (48%), Gaps = 57/496 (11%)

Query: 6   QKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRID 65
             +  +   Y+VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++ 
Sbjct: 2   SSSLANRNIYTVSRLNSEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSQAQVK 60

Query: 66  AIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKK 125
             ++KG    + F P+ G + LV  +++ +     YQII+ES+ P G G L    E+ K 
Sbjct: 61  CAMFKGNNRLVNFKPQNGQQVLVKARLSLYEPRGDYQIILESMQPEGDGRLQQQFEQLKM 120

Query: 126 KLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGD 184
           +L  EGLF+   K P+P  P+ + +ITS TGA + DIL  +  R P L V+I+P  VQG+
Sbjct: 121 QLAAEGLFAQTRKKPLPENPRCVGIITSRTGAALHDILHVLKRRDPNLPVVIYPTLVQGE 180

Query: 185 ECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPII 244
           E   +IA AI + NT  E       D++I+ RGGGS+EDLW FN E++ R IA S IPII
Sbjct: 181 EAAIQIAQAIGRANTRAE------CDVLIVGRGGGSLEDLWCFNHEIVARTIAASEIPII 234

Query: 245 SAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKI 304
           SA+GHE D T+AD+ AD+RAPTP+ AAE+      H Q +L   +A+L + +   +  + 
Sbjct: 235 SAVGHEIDVTIADFVADVRAPTPSAAAELVSRDHRHKQQALHQWQAKLASAMRHYLAQQD 294

Query: 305 NTLNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFL 362
                L   L   +    L   + +LD L   LE  ++  +  + + ++ + ++I+    
Sbjct: 295 TQFARLQHKLDKQHPQARLERQQQQLDELSLRLEQKMQRRLATQQQRWDRLSHKIELHSP 354

Query: 363 IHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKK 422
           IH I++ R ++++++Q I Q                                        
Sbjct: 355 IHLIRQQRFNLIQQEQRINQ---------------------------------------- 374

Query: 423 LITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATK 482
                   +   +      +++ +  L + +   TL RGY+  + T    + Q   +   
Sbjct: 375 -------SIQRYLIQSRHQLALLSEKLDAVSPLATLARGYSVTRTTQGELVRQSAQVKPG 427

Query: 483 TRILINFFDGQANAIV 498
             ++    DG+  + V
Sbjct: 428 DTLVTQLMDGEILSTV 443


>gi|283832115|ref|ZP_06351856.1| exodeoxyribonuclease VII, large subunit [Citrobacter youngae ATCC
           29220]
 gi|291071743|gb|EFE09852.1| exodeoxyribonuclease VII, large subunit [Citrobacter youngae ATCC
           29220]
          Length = 457

 Score =  382 bits (980), Expect = e-103,   Method: Composition-based stats.
 Identities = 148/508 (29%), Positives = 233/508 (45%), Gaps = 57/508 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           +S     ++VS L+  ++ ++E  +  V + GEIS +    SSGH YF+LKD+ +++   
Sbjct: 3   SSQTTSIFTVSRLNQTVRLLLEQEMGQVWISGEISNFT-QPSSGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  QHK P+P     I VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQHKQPLPSPAHCIGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANARGE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+  DLRAPTP+ AAE+    ++ L   + + + RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVGDLRAPTPSAAAEIVSRNQQELLRQIQSSQQRLGMAMDYYLANRSRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              L   L      L  +R +   +RL + +   LE  I +  +    ++ R+       
Sbjct: 296 FTQLFHRLQQQHPQLRLARQQTTLERLRQRMSTALENQIKQANQRQQRMLQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +                                          
Sbjct: 356 RIHRAQSRIQQLEYRLAE------------------------------------------ 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 +  ++             L++ +   TL RGY+    TN   + + R +     
Sbjct: 374 -----NIRTRLSVHRERFGNAVTHLEAVSPLATLARGYSVSTATNGGVLKKVRQVKAGDV 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTKKC 512
           +     DG   + V    P K+   +K 
Sbjct: 429 MTTRLEDGWVESEVTKVTPQKKTRARKA 456


>gi|322514318|ref|ZP_08067372.1| exodeoxyribonuclease VII large subunit [Actinobacillus ureae ATCC
           25976]
 gi|322119786|gb|EFX91818.1| exodeoxyribonuclease VII large subunit [Actinobacillus ureae ATCC
           25976]
          Length = 486

 Score =  382 bits (980), Expect = e-103,   Method: Composition-based stats.
 Identities = 142/494 (28%), Positives = 246/494 (49%), Gaps = 12/494 (2%)

Query: 12  HPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKG 71
           +   ++++L+Y +++++E  L  V + GEIS +     SGH Y +LKD ++++   +++ 
Sbjct: 2   NNILTITQLNYSVRNLLEMELGQVWLTGEISNF-SQPVSGHWYLTLKDENAQVRGAMFRM 60

Query: 72  TLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEG 131
              ++ F P+ G++ LV   ++ +     YQIIIES+ P+G G L    E+ K KL  EG
Sbjct: 61  KNQRVTFRPQNGMQVLVRASVSLYEPRGDYQIIIESMQPAGDGLLQQQFEQLKMKLAAEG 120

Query: 132 LFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEI 190
           LF+ + K  IP   K + +ITS +GA ++DIL  +  R P L +II+P  VQG E  ++I
Sbjct: 121 LFAQEKKKAIPPFAKRVGIITSSSGAALQDILNILKRRDPSLAIIIYPTLVQGKEATQDI 180

Query: 191 ANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHE 250
            N I   N   E       D++I+ RGGGS EDLW FN+E +  AI  S IPIISA+GHE
Sbjct: 181 VNTIDLANRRCE------CDVLIVGRGGGSFEDLWCFNEESVAHAIFRSDIPIISAVGHE 234

Query: 251 TDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSL 310
           TD T+AD+ ADLRAPTP+ AAE+    ++ L   L +   +L+    RL   K  +   L
Sbjct: 235 TDVTIADFVADLRAPTPSAAAELVSRDQQELVRQLQHQFDKLSLAFDRLWAEKQASFERL 294

Query: 311 LKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQK 368
              L   +  + +   + RL +    LE+ +      + +    ++ R+ +    H +Q+
Sbjct: 295 KLRLNAQHPARQVQMQQQRLAQFNYRLENAIHKTYLTEKQKLEQLLLRLTNQHPQHQLQQ 354

Query: 369 NRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIE 428
            +  + + +  + Q+++Q L     + K     +          +   +    +L  R++
Sbjct: 355 QQMQLKQAEYRLVQVIEQTLIRKQNQWKHIAEQVKH--NPLPYYVEKKNQQYAQLAQRLQ 412

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
           F +  K+     +       +   +    L RGY+  Q +    +   +NL   T+I   
Sbjct: 413 FAIEKKLTKEQQAFQELCTKIDGLSPLKILARGYSVTQTSQGEILRSTKNLEVGTQITTK 472

Query: 489 FFDGQANAIVINKA 502
              G+  + ++   
Sbjct: 473 LSQGEIVSEIVKIN 486


>gi|188496216|ref|ZP_03003486.1| exodeoxyribonuclease VII, large subunit [Escherichia coli 53638]
 gi|188491415|gb|EDU66518.1| exodeoxyribonuclease VII, large subunit [Escherichia coli 53638]
          Length = 456

 Score =  382 bits (980), Expect = e-103,   Method: Composition-based stats.
 Identities = 145/506 (28%), Positives = 233/506 (46%), Gaps = 57/506 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQYKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANQRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSARQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +R  + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERQKKRMSFALENQLKRAGQQQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +                                          
Sbjct: 356 KIHRAQTRIQQLEYRLAE------------------------------------------ 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +           L++ +  +TL RGY+    T+ N + + + +     
Sbjct: 374 -----TLRAQLSATRERFGNAVTHLEAVSPLSTLARGYSVTTATDGNVLKKVKQVKAGEM 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTK 510
           +     DG   + V N  P K+   K
Sbjct: 429 LTTRLEDGWIESEVKNIQPVKKSRKK 454


>gi|260776625|ref|ZP_05885520.1| exodeoxyribonuclease VII large subunit [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260607848|gb|EEX34113.1| exodeoxyribonuclease VII large subunit [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 443

 Score =  382 bits (980), Expect = e-103,   Method: Composition-based stats.
 Identities = 140/495 (28%), Positives = 241/495 (48%), Gaps = 57/495 (11%)

Query: 7   KNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDA 66
            +  +   ++VS L+  ++ ++E+ +  V + GEIS +     SGH YF+LKD+ +++  
Sbjct: 2   SSLTNQNIFTVSRLNSEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYFTLKDSRAQVKC 60

Query: 67  IIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKK 126
            +++G   ++ F P+ G + LV  +++ +     YQ+IIES+ P G G L    E+ K K
Sbjct: 61  AMFRGNNRRVTFKPQNGNQVLVKARLSLYEPRGDYQLIIESMQPEGDGRLQQQFEELKMK 120

Query: 127 LLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDE 185
           L  EGLF+   K  +P  PK + V+TS TGA + DIL  +  R P L V+I+P  VQG++
Sbjct: 121 LAGEGLFAQTSKQTLPEHPKRVGVVTSKTGAALFDILDVLKRRDPSLPVVIYPTLVQGED 180

Query: 186 CPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIIS 245
              +IA AI   N+  E       D++I+ RGGGS+EDLW FN+E++ R IA S IPIIS
Sbjct: 181 AAIQIAQAIGCANSRNE------CDVLIVGRGGGSLEDLWCFNNEVVARTIAASQIPIIS 234

Query: 246 AIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKIN 305
           A+GHE D T+AD+ AD+RAPTP+ AAE+      H   ++   + +L++ I   +     
Sbjct: 235 AVGHEIDVTIADFVADMRAPTPSAAAELVSRDNSHKAQAINTRQHKLHSAIRHYLTKHKQ 294

Query: 306 TLNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLI 363
             ++L   L   +    L     +LD L   L+ ++E  +  + ++      +++    +
Sbjct: 295 NTSALQHRLERQHPSHQLQRQSQQLDELSVRLQRSMERYLTTRSQNVERQQYKLQLHSPV 354

Query: 364 HNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKL 423
             + + +  +    Q +EQ +   +    L  +                           
Sbjct: 355 ARLNEQKLSL----QRLEQTLMDAMDRKLLNSR--------------------------- 383

Query: 424 ITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKT 483
                             +++ T  L + +   TLKRGY+  QD +   +T+     T  
Sbjct: 384 ----------------HQLALATEKLDTVSPLATLKRGYSITQDASGKVLTKAAETKTGD 427

Query: 484 RILINFFDGQANAIV 498
            ++    DG+ ++ V
Sbjct: 428 TLVTRLSDGEIHSTV 442


>gi|153824580|ref|ZP_01977247.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae MZO-2]
 gi|149741798|gb|EDM55827.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae MZO-2]
          Length = 446

 Score =  382 bits (980), Expect = e-103,   Method: Composition-based stats.
 Identities = 144/496 (29%), Positives = 243/496 (48%), Gaps = 57/496 (11%)

Query: 6   QKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRID 65
             +  +   Y+VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++ 
Sbjct: 2   SSSLSNRNIYTVSRLNSEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSQAQVK 60

Query: 66  AIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKK 125
             ++KG    + F P+ G + LV  +++ +     YQII+ES+ P G G L    E+ K 
Sbjct: 61  CAMFKGNNRLVNFKPQNGQQVLVKARLSLYEPRGDYQIILESMQPEGDGRLQQQFEQLKM 120

Query: 126 KLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGD 184
           +L  EGLF+   K P+P  P+ + +ITS TGA + DIL  +  R P L V+I+P  VQG+
Sbjct: 121 QLAAEGLFAQTRKKPLPENPRCVGIITSRTGAALHDILHVLKRRDPNLPVVIYPTLVQGE 180

Query: 185 ECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPII 244
           E   +IA AI + NT  E       D++I+ RGGGS+EDLW FN E++ R IA S IPII
Sbjct: 181 EAAIQIAQAIGRANTRAE------CDVLIVGRGGGSLEDLWCFNHEIVARTIAASEIPII 234

Query: 245 SAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKI 304
           SA+GHE D T+AD+ AD+RAPTP+ AAE+      H Q +L   +A+L + +   +  + 
Sbjct: 235 SAVGHEIDVTIADFVADVRAPTPSAAAELVSRDHRHKQQALHQWQAKLASAMRHYLAQQD 294

Query: 305 NTLNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFL 362
                L   L   +    L   + +LD L   LE  ++  +  + + ++ + ++I+    
Sbjct: 295 TQFARLQHKLDKQHPQARLERQQQQLDELSLRLEQKMQQRLATQQQRWDRLSHKIELHSP 354

Query: 363 IHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKK 422
           IH I++ R ++++++Q I Q                                        
Sbjct: 355 IHLIRQQRFNLIQQEQRINQ---------------------------------------- 374

Query: 423 LITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATK 482
                   +   +      +++ +  L + +   TL RGY+  + T    + Q   +   
Sbjct: 375 -------SIQRYLIQSRHQLALLSEKLDAVSPLATLARGYSVTRTTQGELVRQSAQVKPG 427

Query: 483 TRILINFFDGQANAIV 498
             ++    DG+  + V
Sbjct: 428 DTLVTQLMDGEILSTV 443


>gi|323491639|ref|ZP_08096818.1| exodeoxyribonuclease VII large subunit [Vibrio brasiliensis LMG
           20546]
 gi|323314215|gb|EGA67300.1| exodeoxyribonuclease VII large subunit [Vibrio brasiliensis LMG
           20546]
          Length = 443

 Score =  381 bits (979), Expect = e-103,   Method: Composition-based stats.
 Identities = 142/495 (28%), Positives = 239/495 (48%), Gaps = 57/495 (11%)

Query: 7   KNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDA 66
            +  +   ++VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++  
Sbjct: 2   SSLTNQNIFTVSRLNAEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSRAQVKC 60

Query: 67  IIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKK 126
            +++G   ++ F P+ G + LV  +++ +     YQ+IIES+ P G G L    E+ K K
Sbjct: 61  AMFRGNNRRVTFKPQNGNQVLVKARLSLYEPRGDYQLIIESMQPEGDGRLQQQFEELKMK 120

Query: 127 LLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDE 185
           L  EGLF+   K P+P  PK + VITS TGA + DIL  +  R P L VI++P  VQG+E
Sbjct: 121 LAGEGLFAQTSKKPLPEHPKRVGVITSKTGAALFDILDVLKRRDPSLPVIVYPTMVQGEE 180

Query: 186 CPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIIS 245
              +IA AI   N+  E       D++I+ RGGGS+EDLW FN+E++ R IA S IPIIS
Sbjct: 181 AAIQIAQAIGCANSRNE------CDVLIVGRGGGSLEDLWCFNNEILARTIAASQIPIIS 234

Query: 246 AIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKIN 305
           A+GHE D T+AD+ AD+RAPTP+ AAE+      H   +LI+ + +L   +   +  +  
Sbjct: 235 AVGHEVDVTIADFVADMRAPTPSAAAELVSRDNSHKDQALISRQHKLVAAMRYYLSEQKR 294

Query: 306 TLNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLI 363
              SL   L   + +  L     +LD L   L  +++  I  +++    + +RI  +  +
Sbjct: 295 CAASLEHRLERQHPNYQLQRQSQQLDELEVRLHRSMQQYIGVRHQKVERLQHRIALNSPV 354

Query: 364 HNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKL 423
             + + +  +   +Q +   +                                       
Sbjct: 355 RRLAEQKATLQRLEQKLLDAM--------------------------------------- 375

Query: 424 ITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKT 483
                     K+ +    +++    L + +   TLKRGY+  Q      I +  ++ T  
Sbjct: 376 --------DRKLLNTRHQLALAAEKLDTVSPLATLKRGYSITQTEQGKVIVRGSDVKTGD 427

Query: 484 RILINFFDGQANAIV 498
            ++    DG+  + V
Sbjct: 428 TLVTRLSDGEVRSTV 442


>gi|327483549|gb|AEA77956.1| Exodeoxyribonuclease VII large subunit [Vibrio cholerae LMA3894-4]
          Length = 446

 Score =  381 bits (979), Expect = e-103,   Method: Composition-based stats.
 Identities = 144/496 (29%), Positives = 243/496 (48%), Gaps = 57/496 (11%)

Query: 6   QKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRID 65
             +  +   Y+VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++ 
Sbjct: 2   SSSLANRNIYTVSRLNSEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSQAQVK 60

Query: 66  AIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKK 125
             ++KG    + F P+ G + LV  +++ +     YQII+ES+ P G G L    E+ K 
Sbjct: 61  CAMFKGNNRLVNFKPQNGQQVLVKARLSLYEPRGDYQIILESMQPEGDGRLQQQFEQLKM 120

Query: 126 KLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGD 184
           +L  EGLF+   K P+P  P+ + +ITS TGA + DIL  +  R P L V+I+P  VQG+
Sbjct: 121 QLAAEGLFAQTRKKPLPENPRCVGIITSRTGAALHDILHVLKRRDPNLPVVIYPTLVQGE 180

Query: 185 ECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPII 244
           E   +IA AI + NT  E       D++I+ RGGGS+EDLW FN E++ R IA S IPII
Sbjct: 181 EAAIQIAQAIGRANTRAE------CDVLIVGRGGGSLEDLWCFNHEIVARTIAASEIPII 234

Query: 245 SAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKI 304
           SA+GHE D T+AD+ AD+RAPTP+ AAE+      H Q +L   +A+L + +   +  + 
Sbjct: 235 SAVGHEIDVTIADFVADVRAPTPSAAAELVSRDHRHKQQALHQWQAKLASAMRHYLAQQD 294

Query: 305 NTLNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFL 362
                L   L   +    L   + +LD L   LE  ++  +  + + ++ + ++I+    
Sbjct: 295 TQFARLQHKLDKQHPQARLERQQQQLDELSLRLEQKMQQRLATQQQRWDRLSHKIELHSP 354

Query: 363 IHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKK 422
           IH I++ R ++++++Q I Q                                        
Sbjct: 355 IHLIRQQRFNLIQQEQRINQ---------------------------------------- 374

Query: 423 LITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATK 482
                   +   +      +++ +  L + +   TL RGY+  + T    + Q   +   
Sbjct: 375 -------SIQRYLIQSRHQLALLSEKLDAVSPLATLARGYSVTRTTQGELVRQSAQVKPG 427

Query: 483 TRILINFFDGQANAIV 498
             ++    DG+  + V
Sbjct: 428 DTLVTQLMDGEILSTV 443


>gi|328472589|gb|EGF43452.1| exodeoxyribonuclease VII large subunit [Vibrio parahaemolyticus
           10329]
          Length = 443

 Score =  381 bits (979), Expect = e-103,   Method: Composition-based stats.
 Identities = 141/493 (28%), Positives = 238/493 (48%), Gaps = 57/493 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIW 69
            +   ++VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++   ++
Sbjct: 5   TNQNIFTVSRLNAEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSRAQVKCAMF 63

Query: 70  KGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLE 129
           +G   ++ F P  G + LV  +++ +     YQ+IIES+ P G G L    E+ K KL  
Sbjct: 64  RGNNRRVTFKPANGNQVLVKARLSLYEPRGDYQLIIESMQPEGDGRLQQEFEELKMKLAA 123

Query: 130 EGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPK 188
           EGLF+  +K P+P  PK + VITS TGA + DIL  +  R P L V+I+P  VQGD+   
Sbjct: 124 EGLFAQTNKLPLPEHPKRVGVITSKTGAALYDILDVLKRRDPSLPVVIYPTMVQGDDAAI 183

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           +IA AI + N+  E       D++I+ RGGGS+EDLW FN+E++ R IA S IPIISA+G
Sbjct: 184 QIAQAIGRANSRNE------CDVLIVGRGGGSLEDLWCFNNEILARTIAASQIPIISAVG 237

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HE D T+AD+ AD+RAPTP+ AAE+      H   SL+  + +L + +   +  +     
Sbjct: 238 HEVDMTIADFVADVRAPTPSAAAELVSRDNSHKDQSLVAKQHKLASAMRYYLAQQKQQSA 297

Query: 309 SLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNI 366
            LL  L   +    L     +LD L   L   ++  I  + +      +R++ +  I ++
Sbjct: 298 QLLHRLERQHPSYQLQRQSQQLDELDMRLRRAMQRFIDTRQQAVERKHHRLQLNSPIKHL 357

Query: 367 QKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITR 426
            + +  +   +                                                +
Sbjct: 358 AQQKSRLERVEH-----------------------------------------------K 370

Query: 427 IEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRIL 486
           +   +  K+ +    ++I    L + +   TLKRGY+  Q      +T   ++ T   ++
Sbjct: 371 LMDAMDRKLLTMRHQLAIAAEKLDTVSPLATLKRGYSITQTDQGKVVTSADDVKTGDLLV 430

Query: 487 INFFDGQANAIVI 499
               +G+ ++ V 
Sbjct: 431 TRLANGEIHSTVS 443


>gi|153800572|ref|ZP_01955158.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae MZO-3]
 gi|124123861|gb|EAY42604.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae MZO-3]
          Length = 446

 Score =  381 bits (979), Expect = e-103,   Method: Composition-based stats.
 Identities = 143/496 (28%), Positives = 243/496 (48%), Gaps = 57/496 (11%)

Query: 6   QKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRID 65
             +  +   Y+VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++ 
Sbjct: 2   SSSLANRNIYTVSRLNSEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSQAQVK 60

Query: 66  AIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKK 125
             ++KG    + F P+ G + LV  +++ +     YQII+ES+ P G G L    E+ K 
Sbjct: 61  CAMFKGNNRLVNFKPQNGQQVLVKARLSLYEPRGDYQIILESMQPEGDGRLQQQFEQLKM 120

Query: 126 KLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGD 184
           +L  EGLF+   K P+P  P+ + +ITS TGA + DIL  +  R P L V+I+P  VQG+
Sbjct: 121 QLAAEGLFAQTRKKPLPENPRCVGIITSRTGAALHDILHVLKRRDPNLPVVIYPTLVQGE 180

Query: 185 ECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPII 244
           E   +IA AI + NT  E       D++I+ RGGGS+EDLW FN E++ R IA S IPII
Sbjct: 181 EAAIQIAQAIGRANTRAE------CDVLIVGRGGGSLEDLWCFNHEIVARTIAASEIPII 234

Query: 245 SAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKI 304
           SA+GHE D T+AD+ AD+RAPTP+ AAE+      H Q +L   +A+L + +   +  + 
Sbjct: 235 SAVGHEIDVTIADFVADVRAPTPSAAAELVSRDHRHKQQALHQWQAKLASTMRHYLAQQD 294

Query: 305 NTLNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFL 362
                L   L   +    L   + +LD L   LE  ++  +  + + ++ + ++I+    
Sbjct: 295 TQFARLQHKLDKQHPQARLERQQQQLDELSLRLEQKMQQRLATQQQRWDRLSHKIELHSP 354

Query: 363 IHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKK 422
           IH +++ R ++++++Q I Q                                        
Sbjct: 355 IHLVRQQRFNLIQQEQRINQ---------------------------------------- 374

Query: 423 LITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATK 482
                   +   +      +++ +  L + +   TL RGY+  + T    + Q   +   
Sbjct: 375 -------SIQRYLIQSRHQLALLSEKLDAVSPLATLARGYSVTRTTQGELVRQSAQVKPG 427

Query: 483 TRILINFFDGQANAIV 498
             ++    DG+  + V
Sbjct: 428 DTLVTQLMDGEILSTV 443


>gi|301024738|ref|ZP_07188378.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 69-1]
 gi|300396407|gb|EFJ79945.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 69-1]
          Length = 458

 Score =  381 bits (979), Expect = e-103,   Method: Composition-based stats.
 Identities = 142/510 (27%), Positives = 229/510 (44%), Gaps = 57/510 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+K  +P     + VITS TGA + DIL  +  R P L VIIFP  VQGD+ 
Sbjct: 122 QAEGLFDQQYKKTLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIFPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIEMANQRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSARQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRAGQQQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +                                          
Sbjct: 356 RIHRAQTRIQQLEYRLAE------------------------------------------ 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +           L++ +  +TL RGY+     +   + Q + +     
Sbjct: 374 -----TLRAQLSATRERFGNAVTHLEAVSPLSTLARGYSVTSAADGAVLKQVKQVKAGDT 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTKKCQL 514
           +     DG   + V      ++   K    
Sbjct: 429 LTTRLGDGVVISEVSAVTKTRKPRKKAANP 458


>gi|303251375|ref|ZP_07337553.1| exodeoxyribonuclease VII large subunit [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|302649917|gb|EFL80095.1| exodeoxyribonuclease VII large subunit [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
          Length = 486

 Score =  381 bits (979), Expect = e-103,   Method: Composition-based stats.
 Identities = 142/494 (28%), Positives = 247/494 (50%), Gaps = 12/494 (2%)

Query: 12  HPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKG 71
           +   ++++L+Y +++++E+ L  V + GEIS +     SGH Y +LKD ++++   +++ 
Sbjct: 2   NNILTITQLNYSVRNLLETELGQVWLTGEISNF-SQPVSGHWYLTLKDENAQVRGAMFRM 60

Query: 72  TLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEG 131
              ++ F P+ G++ LV   ++ +     YQIIIES+ P+G G L    E+ K KL  EG
Sbjct: 61  KNQRVTFRPQNGMQVLVRASVSLYEPRGDYQIIIESMQPAGDGLLQQQFEQLKMKLAAEG 120

Query: 132 LFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEI 190
           LF+ + K  IP   K + +ITS +GA ++DIL  +  R P L +II+P  VQG E  ++I
Sbjct: 121 LFAQEKKKAIPPFTKRVGIITSSSGAALQDILNILKRRDPSLAIIIYPTLVQGKEATQDI 180

Query: 191 ANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHE 250
            N I   N  +E       D++I+ RGGGS+EDLW FN+E +  AI  S IPIISA+GHE
Sbjct: 181 VNTIDLANRRRE------CDVLIVGRGGGSLEDLWCFNEEAVAHAIFRSDIPIISAVGHE 234

Query: 251 TDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSL 310
           TD T+AD+ ADLR PTP+ AAE+    ++ L   L +   +L+    RL   K      L
Sbjct: 235 TDVTIADFVADLRVPTPSAAAELVSRDQQELVRQLQHQFDKLSLAFDRLWTEKQTYFERL 294

Query: 311 LKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQK 368
              L   +  + +   + RL +    LE+ +      + +    ++ R+ +      +Q+
Sbjct: 295 KLRLNAQHPARQVQVQQQRLAQFSYRLENAIHKTYLTEKQKLEQLLLRLTNQHPQRQLQQ 354

Query: 369 NRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIE 428
            +  + + +  + Q ++Q L     + K  +  +   R      +   +    +L  R++
Sbjct: 355 QQMQLKQAEYRLAQAIEQTLIRKQNQWKHIVEQVK--RNPLPYYVEKKNQQYAQLAQRLQ 412

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
           F +  K+     +       +   +    L RGY+  Q +    +   +NL   T+I   
Sbjct: 413 FAIEKKLTKEQQAFQELCTRIDGLSPLKILARGYSVTQTSKGEILRSTKNLKVGTQITTK 472

Query: 489 FFDGQANAIVINKA 502
              G+  + +I   
Sbjct: 473 LSQGEIVSEIIKIN 486


>gi|28897389|ref|NP_796994.1| exodeoxyribonuclease VII large subunit [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|153838535|ref|ZP_01991202.1| exodeoxyribonuclease VII, large subunit [Vibrio parahaemolyticus
           AQ3810]
 gi|260363547|ref|ZP_05776376.1| exodeoxyribonuclease VII, large subunit [Vibrio parahaemolyticus
           K5030]
 gi|260876348|ref|ZP_05888703.1| exodeoxyribonuclease VII, large subunit [Vibrio parahaemolyticus
           AN-5034]
 gi|260898619|ref|ZP_05907115.1| exodeoxyribonuclease VII, large subunit [Vibrio parahaemolyticus
           Peru-466]
 gi|260899281|ref|ZP_05907676.1| exodeoxyribonuclease VII, large subunit [Vibrio parahaemolyticus
           AQ4037]
 gi|31563075|sp|Q87S09|EX7L_VIBPA RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|28805601|dbj|BAC58878.1| exodeoxyribonuclease VII, large subunit [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|149748050|gb|EDM58909.1| exodeoxyribonuclease VII, large subunit [Vibrio parahaemolyticus
           AQ3810]
 gi|308086877|gb|EFO36572.1| exodeoxyribonuclease VII, large subunit [Vibrio parahaemolyticus
           Peru-466]
 gi|308092888|gb|EFO42583.1| exodeoxyribonuclease VII, large subunit [Vibrio parahaemolyticus
           AN-5034]
 gi|308106612|gb|EFO44152.1| exodeoxyribonuclease VII, large subunit [Vibrio parahaemolyticus
           AQ4037]
 gi|308113047|gb|EFO50587.1| exodeoxyribonuclease VII, large subunit [Vibrio parahaemolyticus
           K5030]
          Length = 443

 Score =  381 bits (979), Expect = e-103,   Method: Composition-based stats.
 Identities = 139/493 (28%), Positives = 240/493 (48%), Gaps = 57/493 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIW 69
            +   ++VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++   ++
Sbjct: 5   TNQNIFTVSRLNAEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSRAQVKCAMF 63

Query: 70  KGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLE 129
           +G   ++ F P  G + LV  +++ +     YQ+IIES+ P G G L    E+ K KL  
Sbjct: 64  RGNNRRVTFKPANGNQVLVKARLSLYEPRGDYQLIIESMQPEGDGRLQQEFEELKMKLAA 123

Query: 130 EGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPK 188
           EGLF+  +K P+P  PK + +ITS TGA + DIL  +  R P L V+I+P  VQGD+   
Sbjct: 124 EGLFAQTNKLPLPEHPKRVGIITSKTGAALYDILDVLKRRDPSLPVVIYPTMVQGDDAAI 183

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           +IA AI + N+  E       D++I+ RGGGS+EDLW FN+E++ R IA S IPIISA+G
Sbjct: 184 QIAQAIGRANSRNE------CDVLIVGRGGGSLEDLWCFNNEILARTIAASQIPIISAVG 237

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HE D T+AD+ AD+RAPTP+ AAE+      H   SL+  + +L + +   +  +     
Sbjct: 238 HEVDMTIADFVADVRAPTPSAAAELVSRDNSHKDQSLVAKQHKLASAMRYYLSQQKQQSA 297

Query: 309 SLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNI 366
            LL  L   +    L     +LD L   L   ++  I  + +      +R++ +  + ++
Sbjct: 298 QLLHRLERQHPSYQLQRQSQQLDELDMRLRRAMQRFIDTRQQAVERKHHRLQLNSPVKHL 357

Query: 367 QKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITR 426
            + +  +                                               +++  +
Sbjct: 358 AQQKSRL-----------------------------------------------ERVEHK 370

Query: 427 IEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRIL 486
           +   +  K+ +    ++I    L + +   TLKRGY+  Q      +T   ++ T   ++
Sbjct: 371 LLDTMDRKLLTMRHQLAIAAEKLDTVSPLATLKRGYSITQTEQGKVVTSADDVKTGDLLV 430

Query: 487 INFFDGQANAIVI 499
               +G+ ++ V 
Sbjct: 431 TRLANGEIHSTVS 443


>gi|294677914|ref|YP_003578529.1| exodeoxyribonuclease VII large subunit [Rhodobacter capsulatus SB
           1003]
 gi|294476734|gb|ADE86122.1| exodeoxyribonuclease VII, large subunit [Rhodobacter capsulatus SB
           1003]
          Length = 487

 Score =  381 bits (979), Expect = e-103,   Method: Composition-based stats.
 Identities = 191/522 (36%), Positives = 271/522 (51%), Gaps = 49/522 (9%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S + PE++VSE+S  +K ++E   + V VRGE+ G      SGH YF LKD ++ I A+
Sbjct: 15  PSGNTPEFTVSEISGAVKRVIEGEFTRVRVRGEV-GRVSRPGSGHLYFDLKDPNAVIAAV 73

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
            WKG + +++  PEEG+E +  GK+TTFPG SKYQ+I++ + P+G+G L+  LE R+K L
Sbjct: 74  SWKGQVARMQIRPEEGMEVIATGKLTTFPGQSKYQLIVDDVEPAGAGALMAMLEARRKAL 133

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECP 187
             EGLF    K PIP++P +I V+TSP+GAVIRDIL R+  RFP RV+I+PV VQG  C 
Sbjct: 134 AAEGLFDPARKKPIPYLPAVIGVVTSPSGAVIRDILHRLRDRFPRRVLIWPVAVQGQACA 193

Query: 188 KEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAI 247
            E+A AI   N L  G   PRPD+II+ARGGGS+EDLW FN+E +VRA A S IP+ISA+
Sbjct: 194 AEVAAAIRGFNALAPGGKVPRPDLIIVARGGGSLEDLWGFNEEAVVRAAAESKIPLISAV 253

Query: 248 GHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTL 307
           GHETD TL D+AAD RAPTPT AAEMAVPV+  L + L  ++AR++      +  +   L
Sbjct: 254 GHETDTTLIDFAADRRAPTPTAAAEMAVPVRAELATRLSEMQARISRATQTRMASRAQRL 313

Query: 308 NSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQ 367
             L +AL   +      R R D +   L   L +++ RK   F  +  RI    L   ++
Sbjct: 314 ADLSRALGRPEAITRPRRQRFDLVADRLLPALRMVVVRKRAAFAPLEARISPKLLQTYLR 373

Query: 368 KNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRI 427
             R  +      + +  +                                        R+
Sbjct: 374 VERDRLAGLSDRLLRAEQ---------------------------------------ARL 394

Query: 428 EFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILI 487
                          +    +LQ+  Y+ TL+RGY  ++   +  +T     A    + I
Sbjct: 395 TRA--------QDRFARLAAMLQTLGYQETLRRGYAVVRGPADQVLTSAATAAGLAPLEI 446

Query: 488 NFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
            F DG+   +  +   P     K         +    QG LF
Sbjct: 447 EFQDGRLRVLPSDAP-PPAPAPKPAAKPRKAAKTPPDQGSLF 487


>gi|162139561|ref|YP_217497.2| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|198243207|ref|YP_002216577.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|205353614|ref|YP_002227415.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|207857922|ref|YP_002244573.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|224582952|ref|YP_002636750.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|226697601|sp|B5FR54|EX7L_SALDC RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|226697602|sp|B5R571|EX7L_SALEP RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|226697603|sp|B5RCY1|EX7L_SALG2 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|254783707|sp|C0PYP2|EX7L_SALPC RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|197937723|gb|ACH75056.1| exodeoxyribonuclease VII, large subunit [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|205273395|emb|CAR38367.1| Exonuclease VII large subunit [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|206709725|emb|CAR34075.1| Exonuclease VII large subunit [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|224467479|gb|ACN45309.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|322715565|gb|EFZ07136.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
 gi|326624332|gb|EGE30677.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|326628713|gb|EGE35056.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
          Length = 449

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 143/499 (28%), Positives = 228/499 (45%), Gaps = 57/499 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           +S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   SSQTSSIFTVSRLNQTVRLLLEQEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIAESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  QHK P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQHKQPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANARGE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + + + RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEIVSRNQQELLRQIQSAQQRLGMAMDYYLANRSRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  I +  +    +  R+       
Sbjct: 296 FTQIFHRLQQQHPQLRLARQQTALERLRQRMGFALEARIKQANQRQQRVSQRLSQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +                                               
Sbjct: 356 RIHRAQSRIQQLEYR--------------------------------------------- 370

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
             +   +  ++             L++ +   TL RGYT    T+   + + + +     
Sbjct: 371 --LTENIRSRLSEQRERFGNAVTHLEAVSPLATLARGYTVSTTTDGKVLKKIKQVKAGDI 428

Query: 485 ILINFFDGQANAIVINKAP 503
           +     DG   + V +  P
Sbjct: 429 MTTRLEDGWLESEVKSVTP 447


>gi|168817734|ref|ZP_02829734.1| exodeoxyribonuclease VII, large subunit [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205344866|gb|EDZ31630.1| exodeoxyribonuclease VII, large subunit [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|320087005|emb|CBY96774.1| Exonuclease VII, large subunit [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
          Length = 449

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 143/499 (28%), Positives = 228/499 (45%), Gaps = 57/499 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           +S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   SSQTSSIFTVSRLNQTVRLLLEQEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIAESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  QHK P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQHKQPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANARGE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + + + RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEIVSRNQQELLRQIQSAQQRLGMAMDYYLANRSRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  I +  +    +  R+       
Sbjct: 296 FTQIFHRLQQQHPQLRLARQQTALERLRQRMGFALEARIKQATQRQQRVSQRLSQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +                                               
Sbjct: 356 RIHRAQSRIQQLEYR--------------------------------------------- 370

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
             +   +  ++             L++ +   TL RGYT    T+   + + + +     
Sbjct: 371 --LTENIRSRLSEQRERFGNAVTHLEAVSPLATLARGYTVSTTTDGKVLKKIKQVKAGDI 428

Query: 485 ILINFFDGQANAIVINKAP 503
           +     DG   + V +  P
Sbjct: 429 MTTRLEDGWLESEVKSVTP 447


>gi|16765832|ref|NP_461447.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|167991817|ref|ZP_02572916.1| exodeoxyribonuclease VII, large subunit [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|197262096|ref|ZP_03162170.1| exodeoxyribonuclease VII, large subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|22095670|sp|Q8ZN58|EX7L_SALTY RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|16421055|gb|AAL21406.1| exonuclease VII, large subunit [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|197240351|gb|EDY22971.1| exodeoxyribonuclease VII, large subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|205329864|gb|EDZ16628.1| exodeoxyribonuclease VII, large subunit [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|261247709|emb|CBG25536.1| Exonuclease VII large subunit [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267994624|gb|ACY89509.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301159062|emb|CBW18575.1| Probable exodeoxyribonuclease VII large subunit [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           SL1344]
 gi|312913498|dbj|BAJ37472.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|321222788|gb|EFX47859.1| Exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|323130840|gb|ADX18270.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|332989440|gb|AEF08423.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 449

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 143/499 (28%), Positives = 228/499 (45%), Gaps = 57/499 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           +S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   SSQTSSIFTVSRLNQTVRLLLEQEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIAESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  QHK P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQHKQPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANARGE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + + + RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEIVSRNQQELLRQIQSAQQRLGMAMDYYLANRSRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  I +  +    +  R+       
Sbjct: 296 FTQIFHRLQQQHPQLRLARQQTALERLRQRMGFALEARIKQANQRQQCVSQRLSQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +                                               
Sbjct: 356 RIHRAQSRIQQLEYR--------------------------------------------- 370

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
             +   +  ++             L++ +   TL RGYT    T+   + + + +     
Sbjct: 371 --LTENIRSRLSEQRERFGNAVTHLEAVSPLATLARGYTVSTTTDGKVLKKIKQVKAGDI 428

Query: 485 ILINFFDGQANAIVINKAP 503
           +     DG   + V +  P
Sbjct: 429 MTTRLEDGWLESEVKSVTP 447


>gi|194432106|ref|ZP_03064395.1| exodeoxyribonuclease VII, large subunit [Shigella dysenteriae 1012]
 gi|194419635|gb|EDX35715.1| exodeoxyribonuclease VII, large subunit [Shigella dysenteriae 1012]
 gi|332089722|gb|EGI94823.1| exodeoxyribonuclease VII, large subunit [Shigella dysenteriae
           155-74]
          Length = 456

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 146/506 (28%), Positives = 234/506 (46%), Gaps = 57/506 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+K P+P     + VITS TGA + DIL  +  R P L  II+P  VQGD+ 
Sbjct: 122 QAEGLFDQQYKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPAIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANQRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSARQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRAGQQQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +I                                         
Sbjct: 356 KIHRAQTRIQQLEYRLAEI----------------------------------------- 374

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +           L++ +  +TL RGY+    T+ N + + + +     
Sbjct: 375 ------LRAQLSATRERFGNAVTHLEAVSPLSTLARGYSVTTATDGNVLKKVKQVKAGEM 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTK 510
           +     DG   + V N  P K+   K
Sbjct: 429 LTTRLEDGWIESEVKNIQPVKKSRKK 454


>gi|254285484|ref|ZP_04960448.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae AM-19226]
 gi|150424346|gb|EDN16283.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae AM-19226]
          Length = 446

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 144/496 (29%), Positives = 243/496 (48%), Gaps = 57/496 (11%)

Query: 6   QKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRID 65
             +  +   Y+VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++ 
Sbjct: 2   SSSLANRNIYTVSRLNSEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSQAQVK 60

Query: 66  AIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKK 125
             ++KG    + F P+ G + LV  +++ +     YQII+ES+ P G G L    E+ K 
Sbjct: 61  CAMFKGNNRLVNFKPQNGQQVLVKARLSLYEPRGDYQIILESMQPEGDGRLQQQFEQLKM 120

Query: 126 KLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGD 184
           +L  EGLF+   K P+P  P+ + +ITS TGA + DIL  +  R P L V+I+P  VQG+
Sbjct: 121 QLAAEGLFAQTRKKPLPENPRCVGIITSRTGAALHDILHVLKRRDPNLPVVIYPTLVQGE 180

Query: 185 ECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPII 244
           E   +IA AI + NT  E       D++I+ RGGGS+EDLW FN E++ R IA S IPII
Sbjct: 181 EAAIQIAQAIGRANTRAE------CDVLIVGRGGGSLEDLWCFNHEIVARTIAASEIPII 234

Query: 245 SAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKI 304
           SA+GHE D T+AD+ AD+RAPTP+ AAE+      H Q +L   +A+L + +   +  + 
Sbjct: 235 SAVGHEIDVTIADFVADVRAPTPSAAAELVSRDHRHKQQALHQWQAKLASAMRHYLAQQD 294

Query: 305 NTLNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFL 362
                L   L   +    L   + +LD L   LE  ++  +  + + ++ + ++I+    
Sbjct: 295 TQFARLQHKLDKQHPQARLERQQQQLDELSLRLEQKMQQRLATQQQRWDRLSHKIELHSP 354

Query: 363 IHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKK 422
           IH I++ R ++++++Q I Q                                        
Sbjct: 355 IHLIRQQRFNLIQQEQRINQ---------------------------------------- 374

Query: 423 LITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATK 482
                   +   +      +++ +  L + +   TL RGY+  + T    + Q   +   
Sbjct: 375 -------SIQRYLIQSRHQLALLSEKLDAVSPLATLARGYSVTRTTQGELVRQSAQVKPG 427

Query: 483 TRILINFFDGQANAIV 498
             ++    DG+  + V
Sbjct: 428 DTLVTQLMDGKILSTV 443


>gi|317490877|ref|ZP_07949313.1| exodeoxyribonuclease VII [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316920424|gb|EFV41747.1| exodeoxyribonuclease VII [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 458

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 142/507 (28%), Positives = 231/507 (45%), Gaps = 57/507 (11%)

Query: 9   SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAII 68
               P ++VS L+  ++ ++E  +  + + GEIS      SSGH YF+LKD+ +++   +
Sbjct: 4   PSSPPIFTVSRLNQTVRQLLEMEMGQIWLSGEISNL-SQPSSGHWYFTLKDDRAQVRCAM 62

Query: 69  WKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLL 128
           ++ +  ++ F P+ G + L+   IT +     YQ+I ES+ P+G G L    E+ K++L 
Sbjct: 63  FRNSNRRVAFRPQNGQQILMRATITLYEPRGDYQLIAESMQPAGDGLLQQQFEQLKQRLQ 122

Query: 129 EEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECP 187
           EEGLF   HK P+P   + + V+TS +GA + DIL  +  R P L VII+P  VQG + P
Sbjct: 123 EEGLFDPAHKKPLPSPARCVGVVTSSSGAALHDILNVLQRRDPSLPVIIYPTAVQGVDAP 182

Query: 188 KEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAI 247
            +I  AI   N  KE       D++I+ RGGGS+EDLW FNDE + +AI  S IPI+SA+
Sbjct: 183 MQIVRAIELANQRKE------CDVLIVGRGGGSLEDLWSFNDERVAKAIFASQIPIVSAV 236

Query: 248 GHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTL 307
           GHETD T+AD+  DLRAPTP+ AAE+    +  L   +++ + R+   +   +       
Sbjct: 237 GHETDVTIADFVGDLRAPTPSAAAELVSRNQTELMRQMLSQQQRMEMAMDYYLARHQQRF 296

Query: 308 NSLLKALPNSDQTLSCSRY--RLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHN 365
             L   L      L  +R    L +L R L+  ++  +    R    +  R+        
Sbjct: 297 TRLNHRLQQQHPQLRLARQNTLLLKLRRRLDEAVQTRLRLAERQQERLSQRLNQQQPSAQ 356

Query: 366 IQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLIT 425
           IQ+N+Q + +                                                  
Sbjct: 357 IQRNQQRLAQIHNR---------------------------------------------- 370

Query: 426 RIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRI 485
            +E ++  ++ S           L+  +   TL RG++  Q  N N +   + +     +
Sbjct: 371 -MELLIQRQLSSSRERFGALCSQLEGVSPLATLSRGFSVTQSPNGNVLKSVKQVNNGELL 429

Query: 486 LINFFDGQANAIVINKAPPKEQPTKKC 512
                DG   + V    P  ++   K 
Sbjct: 430 KTRLQDGWIESTVTAITPHPKKRVSKR 456


>gi|16761429|ref|NP_457046.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|29140874|ref|NP_804216.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|213421227|ref|ZP_03354293.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Typhi str. E01-6750]
 gi|213647445|ref|ZP_03377498.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213852549|ref|ZP_03382081.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|22095668|sp|Q8Z4Q1|EX7L_SALTI RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|25289164|pir||AF0820 exodeoxyribonuclease VII (EC 3.1.11.6) - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)
 gi|16503729|emb|CAD02714.1| exodeoxyribonuclease large subunit [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29136499|gb|AAO68065.1| exodeoxyribonuclease large subunit [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
          Length = 449

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 144/499 (28%), Positives = 229/499 (45%), Gaps = 57/499 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           +S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   SSQTSSIFTVSRLNQTVRLLLEQEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIAESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  QHK P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 HAEGLFDQQHKQPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   NT  E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANTRGE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + + + RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEIVSRNQQELLRQIQSAQQRLGMAMDYYLANRSRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  I +  +    +  R+       
Sbjct: 296 FTQIFHRLQQQHPQLRLARQQTALERLRQRMGFALEARIKQATQRQQRVSQRLSQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +                                               
Sbjct: 356 RIHRVQSRIQQLEYR--------------------------------------------- 370

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
             +   +  ++             L++ +   TL RGYT    T+   + + + +     
Sbjct: 371 --LTENIRSRLSEQRERFGNAVTHLEAVSPLATLARGYTVSTTTDGKVLKKIKQVKAGDI 428

Query: 485 ILINFFDGQANAIVINKAP 503
           +     DG   + V +  P
Sbjct: 429 MTTRLEDGWLESEVKSVTP 447


>gi|49475937|ref|YP_033978.1| exodeoxyribonuclease VII large subunit [Bartonella henselae str.
           Houston-1]
 gi|81827691|sp|Q6G2I3|EX7L_BARHE RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|49238745|emb|CAF28004.1| Exodeoxyribonuclease large subunit [Bartonella henselae str.
           Houston-1]
          Length = 475

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 214/530 (40%), Positives = 311/530 (58%), Gaps = 56/530 (10%)

Query: 1   MNPFSQKN-SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKD 59
           MN F +K  + +  E+SVSE++  LK +VE    +V VRGEISGYRG H+SGHAYF+LKD
Sbjct: 1   MNLFFEKTGATNVAEFSVSEIAGALKRVVEEKFGYVRVRGEISGYRGAHASGHAYFALKD 60

Query: 60  NHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTA 119
           + +R++A+IW+G + K++F PEEG+E + +GK+TT+PGSSKYQI+IE+L P+G G L+T 
Sbjct: 61  DKARLEAVIWRGIMEKLKFPPEEGMEVIAVGKLTTYPGSSKYQIVIEALEPTGVGALMTL 120

Query: 120 LEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPV 179
           LE RKKK  EEGLF ++ K P+P++PKII V+TSPTGAVIRDI+ RIS RFPL ++++PV
Sbjct: 121 LENRKKKFAEEGLFDEEKKKPLPYMPKIIGVVTSPTGAVIRDIIHRISDRFPLHILVWPV 180

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
           +VQG+   +E+A A+   N L      P+PD++I+ARGGGS+EDLW FNDE++VRA+  S
Sbjct: 181 RVQGETSGREVAAAVKGFNVLPLEGLIPKPDLLIVARGGGSLEDLWGFNDEVVVRAVYES 240

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
           S+P+ISA+GHETDWTL DY AD RAPTPT AAE AVPVK  L+  +++L ARL   + R 
Sbjct: 241 SLPVISAVGHETDWTLIDYVADWRAPTPTAAAEKAVPVKIDLEVYVVSLGARLRTGLARY 300

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
             +    L ++++ALP +DQ  +  R   D +   LE  L +   +K  +F+ +  R   
Sbjct: 301 FDFHQQKLRAIIRALPTADQLFALPRRGFDEISSRLERALCVSCDKKRLYFHTLAIRFTP 360

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH 419
             L  N +K +    E    + +                                     
Sbjct: 361 RLL--NTEKAQHSAKEYTARLHRAFVH--------------------------------- 385

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
                          ++     + I  R+L+S +Y+N L+RG+      NN  I +   +
Sbjct: 386 --------------IVEKQRAQLEIAFRLLKSTSYQNILERGFVLALGQNNKPIKRLAQI 431

Query: 480 ATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
             K +I + FFDG+  +++  ++                + KQ  QG LF
Sbjct: 432 PEKEQINLRFFDGEI-SVITQESFFNR-----SSKSKRIKSKQDDQGTLF 475


>gi|82544958|ref|YP_408905.1| exodeoxyribonuclease VII large subunit [Shigella boydii Sb227]
 gi|123559008|sp|Q31XY1|EX7L_SHIBS RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|81246369|gb|ABB67077.1| exonuclease VII, large subunit [Shigella boydii Sb227]
          Length = 456

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 144/506 (28%), Positives = 234/506 (46%), Gaps = 57/506 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             E LF  Q+K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAECLFDQQYKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTSVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANQRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSTRQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRTGQQQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + + ++                                       
Sbjct: 356 KIHRAQTRIQQLEYRLAETLRV-------------------------------------- 377

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                    ++ +           L++ +  +TL RGY+    T+ N + + + +     
Sbjct: 378 ---------QLSATRERFGNAVTHLEAVSPLSTLARGYSVTTATDGNVLKKVKQVKAGEM 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTK 510
           +     DG   + V N  P K+   K
Sbjct: 429 LTTRLEDGWIESEVKNIQPVKKSRKK 454


>gi|192362513|ref|YP_001982570.1| exodeoxyribonuclease VII large subunit [Cellvibrio japonicus
           Ueda107]
 gi|190688678|gb|ACE86356.1| exodeoxyribonuclease VII, large subunit [Cellvibrio japonicus
           Ueda107]
          Length = 460

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 149/514 (28%), Positives = 244/514 (47%), Gaps = 65/514 (12%)

Query: 1   MNPFSQKN---------SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSG 51
           M+P S ++         S +    SVS+L+   + ++E+    + V GE+S    I SSG
Sbjct: 1   MHPMSHQDLFTSTPAHFSPEREIISVSQLNRRARQLLETQFPLLWVEGELSNV-SIPSSG 59

Query: 52  HAYFSLKDNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPS 111
           H YF+LKD+ +++   +++     + F P++G + L+  +++ + G   YQII+E +  +
Sbjct: 60  HWYFTLKDDQAQVRCAMFRNRNMLVRFKPQQGQQVLIRARVSLYEGRGDYQIIVEHMEEA 119

Query: 112 GSGTLLTALEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP 171
           G+G L  A E+ K +L +EGLF   +K P+P +P  I VITSPTGA IRDIL  +  RFP
Sbjct: 120 GTGALQRAFEQLKARLGQEGLFDPAYKKPLPGLPGRIGVITSPTGAAIRDILSVLERRFP 179

Query: 172 -LRVIIFPVKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDE 230
            + V + PV VQG E   +I  A+   N           D++I+ARGGGS+EDLW FN+E
Sbjct: 180 AIPVTLIPVAVQGKEAAPQIVRALELANR------SGLFDVLIVARGGGSLEDLWPFNEE 233

Query: 231 MIVRAIANSSIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEA 290
           ++ RAI  S +P+IS +GHE D+T+AD+ ADLRAPTP+ AAE+ VP         I  E 
Sbjct: 234 IVARAIFASRVPVISGVGHEVDFTIADFVADLRAPTPSAAAELVVPDGNDWLDKFIGFEV 293

Query: 291 RLNNIIIRLIKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHF 350
            L   ++R +++    L  L + L +  + L     RLD L   L+ +++  +       
Sbjct: 294 LLEEAMLRKLRHWQQRLTWLRQRLRHPRERLEQQGQRLDNLELRLKAHIQHQLGNYRHKL 353

Query: 351 NHIINRIKSDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTK 410
             +  R++       I +  + + ++QQ +                              
Sbjct: 354 EQLRLRLQPHHPQVRIVRLHEKLAQQQQRL------------------------------ 383

Query: 411 NRIFYLHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTN- 469
             +      ++    R    L               R+L +    NTL+RGY+       
Sbjct: 384 --VSLQKQQLQGYKQRFNAAL---------------RLLNTLNPLNTLERGYSLTSHAES 426

Query: 470 NNFITQKRNLATKTRILINFFDGQANAIVINKAP 503
              I+  + + T   +     +G+  + V    P
Sbjct: 427 GQLISSSKQIVTGELVKTRLAEGELISRVERTLP 460


>gi|229510708|ref|ZP_04400187.1| exodeoxyribonuclease VII large subunit [Vibrio cholerae B33]
 gi|229608638|ref|YP_002879286.1| exodeoxyribonuclease VII large subunit [Vibrio cholerae MJ-1236]
 gi|229350673|gb|EEO15614.1| exodeoxyribonuclease VII large subunit [Vibrio cholerae B33]
 gi|229371293|gb|ACQ61716.1| exodeoxyribonuclease VII large subunit [Vibrio cholerae MJ-1236]
          Length = 464

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 143/491 (29%), Positives = 241/491 (49%), Gaps = 57/491 (11%)

Query: 11  DHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           +   Y+VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++   ++K
Sbjct: 25  NRNIYTVSRLNSEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSQAQVKCAMFK 83

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           G    +   P+ G + LV  +++ +     YQII+ES+ P G G L    E+ K +L  E
Sbjct: 84  GNNRLVNIKPQNGQQVLVKARLSLYEPRGDYQIILESMQPEGDGRLQQQFEQLKMQLAAE 143

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKE 189
           GLF+   K P+P  P+ + +ITS TGA + DIL  +  R P L V+I+P  VQG+E   +
Sbjct: 144 GLFAQTRKKPLPENPRCVGIITSRTGAALHDILHVLKRRDPNLPVVIYPTLVQGEEAAIQ 203

Query: 190 IANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGH 249
           IA AI + NT  E       D++I+ RGGGS+EDLW FN E++ R IA S IPIISA+GH
Sbjct: 204 IAQAIGRANTRAE------CDVLIVGRGGGSLEDLWCFNHEIVARTIAASEIPIISAVGH 257

Query: 250 ETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNS 309
           E D T+AD+ AD+RAPTP+ AAE+      H Q +L   +A+L + +   +  +      
Sbjct: 258 EIDVTIADFVADVRAPTPSAAAELVSRDHRHKQQALHQWQAKLASTMRHYLAQQETQFAR 317

Query: 310 LLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQ 367
           L   L   +    L   + +LD L   LE  ++  +  + + ++ + ++I+    IH I+
Sbjct: 318 LQHKLDKQHPQARLERQQQQLDELSLRLEQKMQQRLATQQQRWDRLSHKIELHSPIHLIR 377

Query: 368 KNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRI 427
           + R ++++++Q I Q                                             
Sbjct: 378 QQRFNLIQQEQRINQ--------------------------------------------- 392

Query: 428 EFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILI 487
              +   +      +++ +  L + +   TL RGY+  + T    + Q   +     ++ 
Sbjct: 393 --SIQRYLIQSRHQLALLSEKLDAVSPLATLARGYSVTRTTQGELVRQSAQVKPGDTLVT 450

Query: 488 NFFDGQANAIV 498
              DG+  + V
Sbjct: 451 QLMDGEILSTV 461


>gi|303252815|ref|ZP_07338974.1| putative exodeoxyribonuclease VII large subunit [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|302648245|gb|EFL78442.1| putative exodeoxyribonuclease VII large subunit [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
          Length = 486

 Score =  381 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 142/494 (28%), Positives = 246/494 (49%), Gaps = 12/494 (2%)

Query: 12  HPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKG 71
           +   ++++L+Y +++++E+ L  V + GEIS +     SGH Y +LKD ++++   +++ 
Sbjct: 2   NNILTITQLNYSVRNLLETELGQVWLTGEISNF-SQPVSGHWYLTLKDENAQVRGAMFRM 60

Query: 72  TLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEG 131
              ++ F P+ G++ LV   ++ +     YQIIIES+ P+G G L    E+ K KL   G
Sbjct: 61  KNQRVIFRPQNGMQVLVRASVSLYEPRGDYQIIIESMQPAGDGLLQQQFEQLKMKLAASG 120

Query: 132 LFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEI 190
           LF+ + K  IP   K + +ITS +GA ++DIL  +  R P L +II+P  VQG E  ++I
Sbjct: 121 LFAQEKKKAIPPFTKRVGIITSSSGAALQDILNILKRRDPSLAIIIYPTLVQGKEATQDI 180

Query: 191 ANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHE 250
            N I   N  +E       D++I+ RGGGS+EDLW FN+E +  AI  S IPIISA+GHE
Sbjct: 181 VNTIDLANRRRE------CDVLIVGRGGGSLEDLWCFNEEAVAHAIFRSDIPIISAVGHE 234

Query: 251 TDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSL 310
           TD T+AD+ ADLRAPTP+ AAE+    ++ L   L +   +L+    RL   K      L
Sbjct: 235 TDVTIADFVADLRAPTPSAAAELVSRDQQELVRQLQHQFDKLSLAFDRLWTEKQTYFERL 294

Query: 311 LKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQK 368
              L   +  + +   + RL +    LE+ +      + +    ++ R+ +      +Q+
Sbjct: 295 KLRLNAQHPARQVQMQQQRLAQFSYRLENAIHKTYLTEKQKLEQLLLRLTNQHPQRQLQQ 354

Query: 369 NRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIE 428
            +  + + +  + Q ++Q L     + K  +  +   R      +   +    +L  R++
Sbjct: 355 QQMQLKQAEYRLAQAIEQTLIRKQNQWKHIVEQVK--RNPLPYCVEKKNQQYAQLAQRLQ 412

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
           F +  K+     +       +   +    L RGY+  Q +    +    NL   T+I   
Sbjct: 413 FAIEKKLTKEQQAFQELCTRIDGLSPLKILARGYSVTQTSKGEILRSTENLKVGTQITTK 472

Query: 489 FFDGQANAIVINKA 502
              G+  + +I   
Sbjct: 473 LSQGEIVSEIIKIN 486


>gi|153216237|ref|ZP_01950337.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae 1587]
 gi|124114382|gb|EAY33202.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae 1587]
          Length = 446

 Score =  381 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 144/496 (29%), Positives = 244/496 (49%), Gaps = 57/496 (11%)

Query: 6   QKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRID 65
             + ++   Y+VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++ 
Sbjct: 2   SSSLVNRNIYTVSRLNSEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSQAQVK 60

Query: 66  AIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKK 125
             ++KG    + F P+ G + LV  +++ +     YQII+ES+ P G G L    E+ K 
Sbjct: 61  CAMFKGNNRLVNFKPQNGQQVLVKARLSLYEPRGDYQIILESMQPEGDGRLQQQFEQLKM 120

Query: 126 KLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGD 184
           +L  EGLF+   K P+P  P+ + +ITS TGA + DIL  +  R P L V+I+P  VQG+
Sbjct: 121 QLAAEGLFAQTRKKPLPENPRCVGIITSRTGAALHDILHVLKRRDPNLPVVIYPTLVQGE 180

Query: 185 ECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPII 244
           E   +IA AI + NT  E       D++I+ RGGGS+EDLW FN E++ R IA S IPII
Sbjct: 181 EAAIQIAQAIGRANTRAE------CDVLIVGRGGGSLEDLWCFNHEIVARTIAASEIPII 234

Query: 245 SAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKI 304
           SA+GHE D T+AD+ AD+RAPTP+ AAE+      H Q +L   +A+L + +   +  + 
Sbjct: 235 SAVGHEIDVTIADFVADVRAPTPSAAAELVSRDHRHKQQALHQWQAKLASAMRHYLAQQD 294

Query: 305 NTLNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFL 362
                L   L   +    L   + +LD L   LE  ++  +  + + ++ + ++I+    
Sbjct: 295 TQFARLQHKLDKQHPQARLERQQQQLDELSLRLEQKMQQRLATQQQRWDRLSHKIELHSP 354

Query: 363 IHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKK 422
           IH I++ R ++++++Q I Q                                        
Sbjct: 355 IHLIRQQRFNLIQQEQRITQ---------------------------------------- 374

Query: 423 LITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATK 482
                   +   +      +++ +  L + +   TL RGY+  + T    + Q   +   
Sbjct: 375 -------SIQRYLIQSRHQLALLSEKLDAVSPLATLARGYSVTRTTQGELVRQSTQVKPG 427

Query: 483 TRILINFFDGQANAIV 498
             ++    DG+  + V
Sbjct: 428 DTLVTQLMDGEILSTV 443


>gi|193064750|ref|ZP_03045828.1| exodeoxyribonuclease VII, large subunit [Escherichia coli E22]
 gi|194427279|ref|ZP_03059829.1| exodeoxyribonuclease VII, large subunit [Escherichia coli B171]
 gi|260845139|ref|YP_003222917.1| exonuclease VII, large subunit XseA [Escherichia coli O103:H2 str.
           12009]
 gi|260856603|ref|YP_003230494.1| exonuclease VII, large subunit XseA [Escherichia coli O26:H11 str.
           11368]
 gi|192927633|gb|EDV82249.1| exodeoxyribonuclease VII, large subunit [Escherichia coli E22]
 gi|194414600|gb|EDX30872.1| exodeoxyribonuclease VII, large subunit [Escherichia coli B171]
 gi|257755252|dbj|BAI26754.1| exonuclease VII, large subunit XseA [Escherichia coli O26:H11 str.
           11368]
 gi|257760286|dbj|BAI31783.1| exonuclease VII, large subunit XseA [Escherichia coli O103:H2 str.
           12009]
 gi|323159379|gb|EFZ45364.1| exodeoxyribonuclease VII, large subunit [Escherichia coli E128010]
          Length = 456

 Score =  381 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 144/506 (28%), Positives = 234/506 (46%), Gaps = 57/506 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDLQYKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +   AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQTVRAIELANQRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSTRQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRTGQQQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + + ++                                       
Sbjct: 356 KIHRAQTRIQQLEYRLAETLRV-------------------------------------- 377

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                    ++ +           L++ +  +TL RGY+    T+ N + + + +     
Sbjct: 378 ---------QLSATRERFGNAVTHLEAVSPLSTLARGYSVTTATDGNVLKKVKQVKAGEM 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTK 510
           +     DG   + V N  P K+   K
Sbjct: 429 LTTRLEDGWIESEVKNIQPVKKSRKK 454


>gi|254225029|ref|ZP_04918643.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae V51]
 gi|125622416|gb|EAZ50736.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae V51]
          Length = 446

 Score =  381 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 144/496 (29%), Positives = 242/496 (48%), Gaps = 57/496 (11%)

Query: 6   QKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRID 65
             +  +   Y+VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++ 
Sbjct: 2   SSSLANRNIYTVSRLNSEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSQAQVK 60

Query: 66  AIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKK 125
             ++KG    + F P+ G + LV  +++ +     YQII+ES+ P G G L    E+ K 
Sbjct: 61  CAMFKGNNRLVNFKPQNGQQVLVKARLSLYEPRGDYQIILESMQPEGDGRLQQQFEQLKM 120

Query: 126 KLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGD 184
           +L  EGLF+   K P+P  P+ + +ITS TGA + DIL  +  R P L V+I+P  VQG+
Sbjct: 121 QLAAEGLFAQTRKKPLPENPRCVGIITSRTGAALHDILHVLKRRDPNLPVVIYPTLVQGE 180

Query: 185 ECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPII 244
           E   +IA AI + NT  E       D++I+ RGGGS+EDLW FN E++ R IA S IPII
Sbjct: 181 EAAIQIAQAIGRANTRAE------CDVLIVGRGGGSLEDLWCFNHEIVARTIAASEIPII 234

Query: 245 SAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKI 304
           SA+GHE D T+AD+ AD+RAPTP+ AAE+      H Q +L   +A+L + +   +  + 
Sbjct: 235 SAVGHEIDVTIADFVADVRAPTPSAAAELVSRDHRHKQQALHQWQAKLASAMRHYLAQQD 294

Query: 305 NTLNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFL 362
                L   L   +    L   + +LD L   LE  ++  +  + +  + + ++I+    
Sbjct: 295 TQFARLQHKLDKQHPQARLERQQQQLDELSLRLEQKMQQRLATQQQCRDRLSHKIELHSP 354

Query: 363 IHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKK 422
           IH I++ R ++++++Q I Q                                        
Sbjct: 355 IHLIRQQRFNLIQQEQRITQ---------------------------------------- 374

Query: 423 LITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATK 482
                   +   +      +++ +  L + +   TL RGY+  + T    + Q   +   
Sbjct: 375 -------SIQRYLIQSRHKLALLSEKLDAVSPLATLARGYSVTRTTQGELVRQSAQVKPG 427

Query: 483 TRILINFFDGQANAIV 498
             ++    DG+  + V
Sbjct: 428 DTLVTQLMDGEILSTV 443


>gi|148275|gb|AAA24766.1| exonuclease VII large subunit [Escherichia coli]
          Length = 456

 Score =  381 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 146/506 (28%), Positives = 234/506 (46%), Gaps = 57/506 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSSRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQYKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPAAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANQRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFTSRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSTRQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRTGQQQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +                                          
Sbjct: 356 KIHRAQTRIQQLEYRLAE------------------------------------------ 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +           L++ +  +TL RGY+    T+ N + + + +     
Sbjct: 374 -----TLRAQLSATRERFGNAVTHLEAVSPLSTLARGYSVTTATDGNVLKKVKQVKAGEM 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTK 510
           +     DG   + V N  P K+   K
Sbjct: 429 LTTRLEDGWIESEVKNIQPVKKSRKK 454


>gi|262192493|ref|ZP_06050644.1| exodeoxyribonuclease VII large subunit [Vibrio cholerae CT 5369-93]
 gi|262031652|gb|EEY50239.1| exodeoxyribonuclease VII large subunit [Vibrio cholerae CT 5369-93]
          Length = 446

 Score =  381 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 144/496 (29%), Positives = 242/496 (48%), Gaps = 57/496 (11%)

Query: 6   QKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRID 65
             +  +   Y+VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++ 
Sbjct: 2   SSSLANRNIYTVSRLNSEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSQAQVK 60

Query: 66  AIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKK 125
             ++KG    + F P+ G + LV  +++ +     YQII+ES+ P G G L    E+ K 
Sbjct: 61  CAMFKGNNRLVNFKPQNGQQVLVKARLSLYEPRGDYQIILESMQPEGDGRLQQQFEQLKM 120

Query: 126 KLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGD 184
           +L  EGLF+   K P+P  P+ + +ITS TGA + DIL  +  R P L V+I+P  VQG+
Sbjct: 121 QLAAEGLFAQTRKKPLPENPRCVGIITSRTGAALHDILHVLKRRDPNLPVVIYPTLVQGE 180

Query: 185 ECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPII 244
           E   +IA AI + NT  E       D++I+ RGGGS+EDLW FN E++ R IA S IPII
Sbjct: 181 EAAIQIAQAIGRANTRAE------CDVLIVGRGGGSLEDLWCFNHEIVARTIAASEIPII 234

Query: 245 SAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKI 304
           SA+GHE D T+AD+ AD+RAPTP+ AAE+      H Q +L   +A+L + I   +  + 
Sbjct: 235 SAVGHEIDVTIADFVADVRAPTPSAAAELVSRDHRHKQQALHQWQAKLASSIRHYLAQQD 294

Query: 305 NTLNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFL 362
                L   L   +    L   + +LD L   LE  ++  +  + + ++ + ++I+    
Sbjct: 295 TQFARLQHKLDKQHPQARLERQQQQLDELSLRLEQKMQQRLATQQQRWDRLSHKIELHSP 354

Query: 363 IHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKK 422
           IH I++ R ++++++  I Q                                        
Sbjct: 355 IHLIRQQRFNLIQQEHRINQ---------------------------------------- 374

Query: 423 LITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATK 482
                   +   +      +++ +  L + +   TL RGY+  + T    + Q   +   
Sbjct: 375 -------SIQRYLIQSRHQLALLSEKLDAVSPLATLARGYSVTRTTQGELVRQSAQVKPG 427

Query: 483 TRILINFFDGQANAIV 498
             ++    DG+  + V
Sbjct: 428 DTLVTQLMDGEILSTV 443


>gi|168261451|ref|ZP_02683424.1| exodeoxyribonuclease VII, large subunit [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|205349375|gb|EDZ36006.1| exodeoxyribonuclease VII, large subunit [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
          Length = 449

 Score =  380 bits (976), Expect = e-103,   Method: Composition-based stats.
 Identities = 144/499 (28%), Positives = 228/499 (45%), Gaps = 57/499 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           +S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   SSQTSSIFTVSRLNQTVRLLLEQEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIAESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  QHK P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQHKQPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANARGE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + + + RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEIVSRNQQELLRQIQSAQQRLGMAMDYYLANRSRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  I +  +    +  R+       
Sbjct: 296 FTQIFHRLQQQHPQLRLARQQTALERLRQRMGFALEARIKQANQRQQRVSQRLSQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +                                               
Sbjct: 356 RIHRAQSRIQQLEYR--------------------------------------------- 370

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
             +   +  ++             L++ +   TL RGYT    TN   + + + +     
Sbjct: 371 --LTENIRSRLSEQRERFGNAVTHLEAVSPLATLARGYTVSTTTNGKVLKKIKQVKAGDI 428

Query: 485 ILINFFDGQANAIVINKAP 503
           +     DG   + V +  P
Sbjct: 429 MTTRLEDGWLESEVKSVTP 447


>gi|229525410|ref|ZP_04414815.1| exodeoxyribonuclease VII large subunit [Vibrio cholerae bv.
           albensis VL426]
 gi|229338991|gb|EEO04008.1| exodeoxyribonuclease VII large subunit [Vibrio cholerae bv.
           albensis VL426]
          Length = 464

 Score =  380 bits (976), Expect = e-103,   Method: Composition-based stats.
 Identities = 142/491 (28%), Positives = 240/491 (48%), Gaps = 57/491 (11%)

Query: 11  DHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           +   Y+VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++   ++K
Sbjct: 25  NRNIYTVSRLNSEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSQAQVKCAMFK 83

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           G    + F P+ G + LV  +++ +     YQII+ES+ P G G L    E+ K +L  E
Sbjct: 84  GNNRLVNFKPQNGQQVLVKARLSLYEPRGDYQIILESMQPEGDGRLQQQFEQLKMQLAAE 143

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRF-PLRVIIFPVKVQGDECPKE 189
           GLF+   K P+P  P+ + +ITS TGA + DIL  +  R   L V+I+P  VQG+E   +
Sbjct: 144 GLFAQTRKKPLPDNPRCVGIITSRTGAALHDILHVLKRRDSNLPVVIYPTLVQGEEAAIQ 203

Query: 190 IANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGH 249
           IA AI + NT  E       D++I+ RGGGS+EDLW FN E++ R IA S IPIISA+GH
Sbjct: 204 IAQAIGRANTRAE------CDVLIVGRGGGSLEDLWCFNHEIVARTIAASEIPIISAVGH 257

Query: 250 ETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNS 309
           E D T+AD+ AD+RAPTP+ AAE+      H Q +L   +A+L + +   +  +      
Sbjct: 258 EIDVTIADFVADVRAPTPSAAAELVSRDHRHKQQALHQWQAKLASAMRHYLAQQDTQFAR 317

Query: 310 LLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQ 367
           L   L   +    L   + +LD L    E  ++  +  + + ++ + ++I+    IH I+
Sbjct: 318 LQHKLDKQHPQARLERQQQQLDELSLRFEQKMQQRLATQQQRWDRLSHKIELHSPIHLIR 377

Query: 368 KNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRI 427
           + R ++++++Q I Q                                             
Sbjct: 378 QQRFNLIQQEQRINQ--------------------------------------------- 392

Query: 428 EFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILI 487
              +   +      +++ +  L + +   TL RGY+  + T    + Q   +     ++ 
Sbjct: 393 --SIQRYLIQSRHQLALLSEKLDAVSPLATLARGYSVTRTTQGELVRQSAQVKPGDTLVT 450

Query: 488 NFFDGQANAIV 498
              DG+  + V
Sbjct: 451 QLMDGEILSTV 461


>gi|148825322|ref|YP_001290075.1| exodeoxyribonuclease VII large subunit [Haemophilus influenzae
           PittEE]
 gi|148715482|gb|ABQ97692.1| exodeoxyribonuclease VII large subunit [Haemophilus influenzae
           PittEE]
          Length = 442

 Score =  380 bits (976), Expect = e-103,   Method: Composition-based stats.
 Identities = 141/494 (28%), Positives = 236/494 (47%), Gaps = 57/494 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           N++    YSVS+L+   + ++E + S + + GEIS +     SGH Y +LKD ++++   
Sbjct: 2   NNMSDNIYSVSQLNSAARQMLEGHFSQIWLTGEISNFT-QPVSGHWYLTLKDENAQVRCA 60

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++    ++ F P+ G++ LV   ++ +     YQ+II+S+ P+G G L    E  K KL
Sbjct: 61  MFRMKNLRVAFRPQNGMQVLVRANVSLYEPRGDYQLIIDSMHPAGEGLLQQQFEALKMKL 120

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF+   K  +P   K + +ITS TGA ++DIL  ++ R P L+V+I+P  VQG E 
Sbjct: 121 AAEGLFAQNLKKNLPHFSKAVGIITSSTGAALQDILHILARRDPSLKVVIYPTAVQGKEA 180

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
             EI   I   N  +E       D++I+ RGGGS+EDLW FN+E + RAI  S++PIISA
Sbjct: 181 TAEIVQMIELANARQE------VDVLIVGRGGGSLEDLWCFNEEEVARAIFRSTLPIISA 234

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   L + + RL+    RL   K   
Sbjct: 235 VGHETDVTIADFVADLRAPTPSAAAELVSRNQDELLQQLRHQQQRLDMAFDRLFTRKSQR 294

Query: 307 LNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
           L  L   L   +    L   + + ++L   L+  +        + F  +  R+K + L +
Sbjct: 295 LKQLALRLHNQHPQNQLRVQQAKNEQLTHRLQLAMLRQFENTQQKFTALSVRLKQNPLPY 354

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            +Q+++Q + + Q                                               
Sbjct: 355 RVQRHQQRLEQLQVR--------------------------------------------- 369

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
             + F ++ ++      ++     L   +    L RGY+  ++     I   +++     
Sbjct: 370 --LNFCVNRQVTERQNKLATLCGKLDGLSPLKVLARGYSIAENPQGKAIVSVKDVNQGDF 427

Query: 485 ILINFFDGQANAIV 498
           I     DG+  + V
Sbjct: 428 ITTQVADGKIVSKV 441


>gi|168466742|ref|ZP_02700596.1| exodeoxyribonuclease VII, large subunit [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|195630784|gb|EDX49376.1| exodeoxyribonuclease VII, large subunit [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
          Length = 449

 Score =  380 bits (976), Expect = e-103,   Method: Composition-based stats.
 Identities = 144/499 (28%), Positives = 228/499 (45%), Gaps = 57/499 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           +S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   SSQTSSIFTVSRLNQTVRLLLEQEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIAESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  QHK P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQHKQPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANARGE------CDVLIIGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + + + RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEIVSRNQQELLRQIQSAQQRLGMAMDYYLANRSRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  I +  +    +  R+       
Sbjct: 296 FTQIFHRLQQQHPQLRLARQQTALERLRQRMGFALEARIKQATQRQQRVSQRLSQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +                                               
Sbjct: 356 RIHRAQSRIQQLEYR--------------------------------------------- 370

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
             +   +  ++             L++ +   TL RGYT    TN   + + + +     
Sbjct: 371 --LTENIRSRLSEQRERFGNAVTHLEAVSPLATLARGYTVSTTTNGKVLKKIKQVKAGDI 428

Query: 485 ILINFFDGQANAIVINKAP 503
           +     DG   + V +  P
Sbjct: 429 MTTRLEDGWLESEVKSVTP 447


>gi|197250739|ref|YP_002147465.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|226697600|sp|B5F187|EX7L_SALA4 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|197214442|gb|ACH51839.1| exodeoxyribonuclease VII, large subunit [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
          Length = 449

 Score =  380 bits (976), Expect = e-103,   Method: Composition-based stats.
 Identities = 144/499 (28%), Positives = 228/499 (45%), Gaps = 57/499 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           +S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   SSQTSSIFTVSRLNQTVRLLLEQEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIAESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  QHK P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 HSEGLFDQQHKQPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANARGE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + + + RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEIVSRNQQELLRRIQSAQQRLGMAMDYYLANRSRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  I +  +    +  R+       
Sbjct: 296 FTQIFHRLQQQHPQLRLARQQTALERLRQRMGFALEARIKQATQRQQRVSQRLSQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +                                               
Sbjct: 356 RIHRAQSRIQQLEYR--------------------------------------------- 370

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
             +   +  ++             L++ +   TL RGYT    TN   + + + +     
Sbjct: 371 --LTENIRSRLSEQRERFGNAVTHLEAVSPLATLARGYTVSTTTNGKVLKKIKQVKAGDI 428

Query: 485 ILINFFDGQANAIVINKAP 503
           +     DG   + V +  P
Sbjct: 429 MTTRLEDGWLESEVKSVTP 447


>gi|168238180|ref|ZP_02663238.1| exodeoxyribonuclease VII, large subunit [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|194736915|ref|YP_002115575.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|226697607|sp|B4TR85|EX7L_SALSV RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|194712417|gb|ACF91638.1| exodeoxyribonuclease VII, large subunit [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197288884|gb|EDY28257.1| exodeoxyribonuclease VII, large subunit [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
          Length = 449

 Score =  380 bits (976), Expect = e-103,   Method: Composition-based stats.
 Identities = 142/499 (28%), Positives = 227/499 (45%), Gaps = 57/499 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           +S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   SSQTSSIFTVSRLNQTVRLLLEQEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIAESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  QHK  +P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQHKQQLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANARGE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + + + RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEIVSRNQQELLRQIQSAQQRLGMAMDYYLANRSRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  I +  +    +  R+       
Sbjct: 296 FTQIFHRLQQQHPQLRLARQQTALERLRQRMGFALEARIKQATQRQQRVSQRLSQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +                                               
Sbjct: 356 RIHRAQSRIQQLEYR--------------------------------------------- 370

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
             +   +  ++             L++ +   TL RGYT    T+   + + + +     
Sbjct: 371 --LTENIRSRLSEQRERFGNAVTHLEAVSPLATLARGYTVSTTTDGKVLKKIKQVKAGDI 428

Query: 485 ILINFFDGQANAIVINKAP 503
           +     DG   + V +  P
Sbjct: 429 MTTRLEDGWLESEVKSVTP 447


>gi|269965176|ref|ZP_06179310.1| exodeoxyribonuclease VII large subunit [Vibrio alginolyticus 40B]
 gi|269830162|gb|EEZ84389.1| exodeoxyribonuclease VII large subunit [Vibrio alginolyticus 40B]
          Length = 496

 Score =  380 bits (976), Expect = e-103,   Method: Composition-based stats.
 Identities = 138/492 (28%), Positives = 234/492 (47%), Gaps = 57/492 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIW 69
            +   ++VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++   ++
Sbjct: 58  TNQNIFTVSRLNAEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSRAQVKCAMF 116

Query: 70  KGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLE 129
           +G   ++ F P  G + LV  +++ +     YQ+IIES+ P G G L    E+ K KL  
Sbjct: 117 RGNNRRVTFKPANGNQVLVKARLSLYEPRGDYQLIIESMQPEGDGRLQQEFEELKMKLAA 176

Query: 130 EGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPK 188
           EGLF+  +K  +P  PK + VITS TGA + DIL  +  R P L V+I+P  VQG++   
Sbjct: 177 EGLFAQINKQSLPEHPKRVGVITSKTGAALYDILDVLKRRDPSLPVVIYPTVVQGEDAAI 236

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           +IA AI + N+  E       D++I+ RGGGS+EDLW FN+E++ R IA S IPIISA+G
Sbjct: 237 QIAQAIGRANSRDE------CDVLIVGRGGGSLEDLWCFNNEILARTIAASQIPIISAVG 290

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HE D T+AD+ AD+RAPTP+ AAE+      H   +L+  + +L + +   +  +     
Sbjct: 291 HEVDVTIADFVADVRAPTPSAAAELVSRDNSHKDQALVTRQHKLASAMRYYLAQQKQQSA 350

Query: 309 SLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNI 366
            L+  L   +    L     +LD L   L+  +   I  + +       R++ +  +  +
Sbjct: 351 QLVHRLERQHPSYRLQRQTQQLDELDMRLQRVMSRFIALRQQRIERQHYRLQLNSPVTRL 410

Query: 367 QKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITR 426
            + +  +   +Q +                                              
Sbjct: 411 SEQKSKLERVEQKL---------------------------------------------- 424

Query: 427 IEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRIL 486
               +  K+ +    ++I    L + +   TLKRGY+  Q      ITQ  ++ +   ++
Sbjct: 425 -MDAMDRKLLTMRHQLAIAAEKLDTVSPLATLKRGYSITQTEQGKVITQSSDVKSGDVLI 483

Query: 487 INFFDGQANAIV 498
               +G   + V
Sbjct: 484 TRLAEGDVRSTV 495


>gi|46143328|ref|ZP_00204443.1| COG1570: Exonuclease VII, large subunit [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
          Length = 486

 Score =  380 bits (976), Expect = e-103,   Method: Composition-based stats.
 Identities = 143/494 (28%), Positives = 246/494 (49%), Gaps = 12/494 (2%)

Query: 12  HPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKG 71
           +   ++++L+Y +++++E+ L  V + GEIS +     SGH Y +LKD ++++   ++  
Sbjct: 2   NNILTITQLNYSVRNLLETELGQVWLTGEISNF-SQPVSGHWYLTLKDENAQVRGAMFTM 60

Query: 72  TLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEG 131
              ++ F P+ G++ LV   ++ +     YQIIIES+ P+G G L    E+ K KL  EG
Sbjct: 61  KNQRVTFRPQNGMQVLVPASVSLYDPRGDYQIIIESMQPAGDGLLQQQFEQLKMKLAAEG 120

Query: 132 LFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEI 190
           LF+ + K  IP   K + +ITS +GA ++DIL  +  R P L +II+P  VQG E  ++I
Sbjct: 121 LFAQEKKKAIPPFAKRVGIITSSSGAALQDILNILKRRDPSLAIIIYPTLVQGKEATQDI 180

Query: 191 ANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHE 250
            N I   N  +E       D++I+ RGGGS+EDLW FN+E +  AI  S IPIISA+GHE
Sbjct: 181 VNTIDLANRRRE------CDVLIVGRGGGSLEDLWCFNEEAVAHAIFRSDIPIISAVGHE 234

Query: 251 TDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSL 310
           TD T+AD+ ADLRAPTP+ AAE+    ++ L   L +   +L+    RL   K      L
Sbjct: 235 TDVTIADFVADLRAPTPSAAAELVSRDQQELVRQLQHQFDKLSLAFDRLWTEKQTYFERL 294

Query: 311 LKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQK 368
              L   +  + +   + RL +    LE+ +      + +    ++ R+ +      +Q+
Sbjct: 295 KLRLNAQHPARQVQMQQQRLAQFSYRLENAIHKTYLTEKQKLEQLLLRLTNQHPQRQLQQ 354

Query: 369 NRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIE 428
            +  + + +  + Q ++Q L     + K  +  +   R      +   +    +L  R++
Sbjct: 355 QQMQLKQAEYRLAQAIEQTLIRKQNQWKHIVEQVK--RNPLPYCVEKKNQQYAQLAQRLQ 412

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
           F +  K+     +       +   +    L RGY+  Q +    +    NL   T+I   
Sbjct: 413 FAIEKKLTKEQQAFQELCTRIDGLSPLKILARGYSVTQTSKGEILRSTENLKVGTQITTK 472

Query: 489 FFDGQANAIVINKA 502
              G+  + +I   
Sbjct: 473 LSQGEIVSEIIKIN 486


>gi|153821384|ref|ZP_01974051.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae B33]
 gi|126521094|gb|EAZ78317.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae B33]
          Length = 446

 Score =  380 bits (976), Expect = e-103,   Method: Composition-based stats.
 Identities = 143/496 (28%), Positives = 242/496 (48%), Gaps = 57/496 (11%)

Query: 6   QKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRID 65
             +  +   Y+VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++ 
Sbjct: 2   SSSLANRNIYTVSRLNSEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSQAQVK 60

Query: 66  AIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKK 125
             ++KG    +   P+ G + LV  +++ +     YQII+ES+ P G G L    E+ K 
Sbjct: 61  CAMFKGNNRLVNIKPQNGQQVLVKARLSLYEPRGDYQIILESMQPEGDGRLQQQFEQLKM 120

Query: 126 KLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGD 184
           +L  EGLF+   K P+P  P+ + +ITS TGA + DIL  +  R P L V+I+P  VQG+
Sbjct: 121 QLAAEGLFAQTRKKPLPENPRCVGIITSRTGAALHDILHVLKRRDPNLPVVIYPTLVQGE 180

Query: 185 ECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPII 244
           E   +IA AI + NT  E       D++I+ RGGGS+EDLW FN E++ R IA S IPII
Sbjct: 181 EAAIQIAQAIGRANTRAE------CDVLIVGRGGGSLEDLWCFNHEIVARTIAASEIPII 234

Query: 245 SAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKI 304
           SA+GHE D T+AD+ AD+RAPTP+ AAE+      H Q +L   +A+L + +   +  + 
Sbjct: 235 SAVGHEIDVTIADFVADVRAPTPSAAAELVSRDHRHKQQALHQWQAKLASTMRHYLAQQE 294

Query: 305 NTLNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFL 362
                L   L   +    L   + +LD L   LE  ++  +  + + ++ + ++I+    
Sbjct: 295 TQFARLQHKLDKQHPQARLERQQQQLDELSLRLEQKMQQRLATQQQRWDRLSHKIELHSP 354

Query: 363 IHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKK 422
           IH I++ R ++++++Q I Q                                        
Sbjct: 355 IHLIRQQRFNLIQQEQRINQ---------------------------------------- 374

Query: 423 LITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATK 482
                   +   +      +++ +  L + +   TL RGY+  + T    + Q   +   
Sbjct: 375 -------SIQRYLIQSRHQLALLSEKLDAVSPLATLARGYSVTRTTQGELVRQSAQVKPG 427

Query: 483 TRILINFFDGQANAIV 498
             ++    DG+  + V
Sbjct: 428 DTLVTQLMDGEILSTV 443


>gi|168232076|ref|ZP_02657134.1| exodeoxyribonuclease VII, large subunit [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|194471378|ref|ZP_03077362.1| exodeoxyribonuclease VII, large subunit [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194457742|gb|EDX46581.1| exodeoxyribonuclease VII, large subunit [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|205333639|gb|EDZ20403.1| exodeoxyribonuclease VII, large subunit [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
          Length = 449

 Score =  380 bits (975), Expect = e-103,   Method: Composition-based stats.
 Identities = 144/499 (28%), Positives = 228/499 (45%), Gaps = 57/499 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           +S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   SSQTSSIFTVSRLNQTVRLLLEQEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIAESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  QHK P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 HSEGLFDQQHKQPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANARGE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + + + RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEIVSRNQQELLRQIQSAQQRLGMAMDYYLANRSRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  I +  +    +  R+       
Sbjct: 296 FTQIFHRLQQQHPQLRLARQQTALERLRQRIGFALEARIKQATQRQQRVSQRLSQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +                                               
Sbjct: 356 RIHRAQSRIQQLEYR--------------------------------------------- 370

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
             +   +  ++             L++ +   TL RGYT    TN   + + + +     
Sbjct: 371 --LTENIRSRLSEQRERFGNAVTHLEAVSPLATLARGYTVSTTTNGKVLKKIKQVKAGDI 428

Query: 485 ILINFFDGQANAIVINKAP 503
           +     DG   + V +  P
Sbjct: 429 MTTRLEDGWLESEVKSVTP 447


>gi|331669255|ref|ZP_08370103.1| exodeoxyribonuclease VII, large subunit [Escherichia coli TA271]
 gi|331064449|gb|EGI36360.1| exodeoxyribonuclease VII, large subunit [Escherichia coli TA271]
          Length = 500

 Score =  380 bits (975), Expect = e-103,   Method: Composition-based stats.
 Identities = 145/515 (28%), Positives = 238/515 (46%), Gaps = 57/515 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQYKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANQRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSTRQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRTGQQQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + + ++                                       
Sbjct: 356 KIHRAQTRIQQLEYRLAETLRV-------------------------------------- 377

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                    ++ +           L++ +  +TL RGY+    T+ N + + + +     
Sbjct: 378 ---------QLSATRERFGNAVTHLEAVSPLSTLARGYSVTTATDGNVLKKVKQVKAGEM 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKR 519
           +     DG   + V N  P K +  +  +    +R
Sbjct: 429 LTTRLEDGWIESEVKNIQPVKNRVKRCIKPARIQR 463


>gi|331648203|ref|ZP_08349293.1| exodeoxyribonuclease VII, large subunit [Escherichia coli M605]
 gi|281179560|dbj|BAI55890.1| exonuclease VII large subunit [Escherichia coli SE15]
 gi|330912281|gb|EGH40791.1| exodeoxyribonuclease 7 large subunit [Escherichia coli AA86]
 gi|331043063|gb|EGI15203.1| exodeoxyribonuclease VII, large subunit [Escherichia coli M605]
          Length = 455

 Score =  380 bits (975), Expect = e-103,   Method: Composition-based stats.
 Identities = 141/507 (27%), Positives = 229/507 (45%), Gaps = 57/507 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFHPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+K  +P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDLQYKKSLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IPI+SA
Sbjct: 182 PGQIVRAIELANKRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPIVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSARQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  ++       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRAGQQQQRLTRQLVHQNPQS 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +                                          
Sbjct: 356 RIHRAQTRIQQLEYRLAE------------------------------------------ 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +           L++ +  +TL RGY+     +   + Q + +     
Sbjct: 374 -----TLRAQLSATRERFGNAVTHLEAVSPLSTLARGYSVTSAADGAVLKQVKQVKVGDT 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTKK 511
           +     DG   + V      ++   K 
Sbjct: 429 LTTRLGDGVVVSEVSAVTKTRKPRKKT 455


>gi|262172164|ref|ZP_06039842.1| exodeoxyribonuclease VII large subunit [Vibrio mimicus MB-451]
 gi|261893240|gb|EEY39226.1| exodeoxyribonuclease VII large subunit [Vibrio mimicus MB-451]
          Length = 446

 Score =  380 bits (975), Expect = e-103,   Method: Composition-based stats.
 Identities = 139/496 (28%), Positives = 242/496 (48%), Gaps = 57/496 (11%)

Query: 6   QKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRID 65
             +  +   Y+VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++ 
Sbjct: 2   SSSLANRNIYTVSRLNAEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSQAQVK 60

Query: 66  AIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKK 125
             ++KG    + F P+ G + LV  +++ +     YQII+ES+ P G G L    E+ K 
Sbjct: 61  CAMFKGNNRLVNFKPQNGQQVLVKARLSLYEPRGDYQIILESMQPEGDGRLQQQFEQLKM 120

Query: 126 KLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGD 184
           +L  EGLF+   K P+P  P+ + +ITS TGA + DIL  +  R P L V+I+P  VQG+
Sbjct: 121 QLAAEGLFAQTRKKPLPENPRCVGIITSRTGAALHDILHVLKRRDPNLPVVIYPTLVQGE 180

Query: 185 ECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPII 244
           +   +IA AI + N+  E       D++I+ RGGGS+EDLW FN E++ R IA S IPII
Sbjct: 181 DAAIQIAQAIGRANSRAE------CDVLIVGRGGGSLEDLWCFNHEIVARTIAASDIPII 234

Query: 245 SAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKI 304
           SA+GHE D T+AD+ AD+RAPTP+ AAE+      H Q +L   +A+L + +   +  + 
Sbjct: 235 SAVGHEIDVTIADFVADVRAPTPSAAAELVSRDNRHKQQALHQWQAKLASGMRHYLAQQH 294

Query: 305 NTLNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFL 362
                +   L   +    L   + +LD L   LE  +   +  + + ++ + ++I+ +  
Sbjct: 295 TQFARIQHKLDKQHPQARLERQQQQLDELSLRLEQKMHQRLATQQQRWDRLSHKIQLNSP 354

Query: 363 IHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKK 422
            H I++ R ++L+++Q + Q                                        
Sbjct: 355 THLIRQQRFNLLQQEQRLTQ---------------------------------------- 374

Query: 423 LITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATK 482
                   + H +      +++ +  + + +   TL RGY+  +      + Q   +   
Sbjct: 375 -------SIQHHLIQSRHQLALLSEKMDAVSPLATLARGYSVTRTAQGELVRQSAQVKPG 427

Query: 483 TRILINFFDGQANAIV 498
             ++    DG+  + V
Sbjct: 428 DTLVTQLMDGEILSTV 443


>gi|204929707|ref|ZP_03220781.1| exodeoxyribonuclease VII, large subunit [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|204321426|gb|EDZ06626.1| exodeoxyribonuclease VII, large subunit [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
          Length = 449

 Score =  380 bits (975), Expect = e-103,   Method: Composition-based stats.
 Identities = 142/499 (28%), Positives = 228/499 (45%), Gaps = 57/499 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           +S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   SSQTSSIFTVSRLNQTVRLLLEQEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQ+I ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQMIAESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  QHK P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQHKQPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIKLANARGE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + + + RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEIVSRNQQELLRQIQSAQQRLGMAMDYYLANRSRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  I +  +    +  R+       
Sbjct: 296 FTQIFHRLQQQHPQLRLARQQTALERLRQRMGFALEARIKQATQRQQRVSQRLSQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +                                               
Sbjct: 356 RIHRAQSRIQQLEYR--------------------------------------------- 370

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
             +   +  ++             L++ +   TL RGYT    T+   + + + +     
Sbjct: 371 --LTENIRSRLSEQRERFGNAVTHLEAVSPLATLARGYTVSTTTDGKVLKKIKQVKAGDI 428

Query: 485 ILINFFDGQANAIVINKAP 503
           +     DG   + V +  P
Sbjct: 429 MTTRLEDGWLESEVKSVTP 447


>gi|313650995|gb|EFS15395.1| exodeoxyribonuclease VII, large subunit [Shigella flexneri 2a str.
           2457T]
          Length = 456

 Score =  380 bits (975), Expect = e-103,   Method: Composition-based stats.
 Identities = 146/506 (28%), Positives = 234/506 (46%), Gaps = 57/506 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+  +G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQAAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             E LF  Q+K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAECLFDQQYKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTSVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANQRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSARQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRAGQQQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +I                                         
Sbjct: 356 KIHRTQTRIQQLEYRLAEI----------------------------------------- 374

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +           L++ +  +TL RGY+    T+ N + + + + T   
Sbjct: 375 ------LRAQLSATRERFGNAVTHLEAVSPLSTLARGYSVTTATDGNVLKKVKQVKTGEM 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTK 510
           +     DG   + V N  P K+   K
Sbjct: 429 LTTRLEDGWIESEVKNIQPVKKSRKK 454


>gi|145632644|ref|ZP_01788378.1| exodeoxyribonuclease VII large subunit [Haemophilus influenzae
           3655]
 gi|144986839|gb|EDJ93391.1| exodeoxyribonuclease VII large subunit [Haemophilus influenzae
           3655]
          Length = 442

 Score =  380 bits (975), Expect = e-103,   Method: Composition-based stats.
 Identities = 142/494 (28%), Positives = 238/494 (48%), Gaps = 57/494 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           N++    YSVS+L+  ++ ++E + S + + GEIS +     SGH Y +LKD ++++   
Sbjct: 2   NNMSDNIYSVSQLNSAVRQMLEGHFSQIWLTGEISNFT-QPVSGHWYLTLKDENAQVRCA 60

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++    ++ F P+ G++ LV   ++ +     YQ+II+S+ P+G G L    E  K KL
Sbjct: 61  MFRMKNLRVAFRPQNGMQVLVRANVSLYEPRGDYQLIIDSMHPAGEGLLQQQFEALKMKL 120

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF+   K  +P   K + +ITS TGA ++DIL  ++ R P L+V+I+P  VQG E 
Sbjct: 121 AAEGLFAQNLKKNLPHFSKAVGIITSSTGAALQDILHILARRDPSLKVVIYPTAVQGKEA 180

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
             EI   I   N  +E       D++I+ RGGGS+EDLW FN+E + RAI  S++PIISA
Sbjct: 181 TAEIVQMIELANLRQE------VDVLIVGRGGGSLEDLWCFNEEDVARAIFRSTLPIISA 234

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   L + + RL+    RL   K   
Sbjct: 235 VGHETDVTIADFVADLRAPTPSAAAELVSRNQDELLQQLRHQQQRLDMAFDRLFTRKSQR 294

Query: 307 LNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
           L  L   L   +    L   + + ++L   L+  +        + F  +  R+K + L +
Sbjct: 295 LKQLALRLHNQHPQNQLRAQQAKNEQLTHRLQLAILRQFENTQQKFTALSVRLKQNPLPY 354

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            +Q+++QH+ + Q                                               
Sbjct: 355 QVQRHQQHLEQLQVR--------------------------------------------- 369

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
             + F ++ ++      ++     L   +    L RGY+  ++     I   +++     
Sbjct: 370 --LNFCVNRQVTERQNKLATLCGKLDGLSPLKVLARGYSIAENPQGKAIVSVKDVNQGDF 427

Query: 485 ILINFFDGQANAIV 498
           I     DG+  + V
Sbjct: 428 ITTQVADGKIVSKV 441


>gi|320196343|gb|EFW70967.1| Exodeoxyribonuclease VII large subunit [Escherichia coli WV_060327]
          Length = 458

 Score =  380 bits (975), Expect = e-103,   Method: Composition-based stats.
 Identities = 142/510 (27%), Positives = 229/510 (44%), Gaps = 57/510 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQLKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IPI+SA
Sbjct: 182 PGQIVRAIELANLRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPIVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSTHQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  ++       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRAGQQQLRLTRQLVQQNPQS 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +                                          
Sbjct: 356 RIHRAQTRIQQLEYRLAE------------------------------------------ 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +           L++ +  +TL RGY+     +   + Q + +     
Sbjct: 374 -----TLRAQLSATRERFGNAVTHLEAVSPLSTLARGYSVTSAADGAVLKQVKQVKVGET 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTKKCQL 514
           +     DG   + V      ++   K    
Sbjct: 429 LTTRLGDGVVISEVSAVTKTRKSRKKTSNP 458


>gi|238913649|ref|ZP_04657486.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
          Length = 449

 Score =  379 bits (974), Expect = e-103,   Method: Composition-based stats.
 Identities = 145/499 (29%), Positives = 228/499 (45%), Gaps = 57/499 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           +S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   SSQTSSIFTVSRLNQTVRLLLEQEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIAESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  QHK P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 HSEGLFDQQHKQPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IPI+SA
Sbjct: 182 PGQIVRAIELANVRGE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPIVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + + + RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEIVSRNQQELLRQIQSAQQRLGMAMDNYLANRSRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  I +  +    +  R+       
Sbjct: 296 FTQIFHRLQQQHPQLRLARQQTALERLRQRMGFALEARIKQATQRQQRVSQRLSQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +                                               
Sbjct: 356 RIHRAQSRIQQLEYR--------------------------------------------- 370

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
             +   +  ++             L++ +   TL RGYT    TN   + + + +     
Sbjct: 371 --LTENIRSRLSEQRERFGNAVTHLEAVSPLATLARGYTVSTTTNGKVLKKIKQVKAGDI 428

Query: 485 ILINFFDGQANAIVINKAP 503
           +     DG   + V +  P
Sbjct: 429 MTTRLEDGWLESEVKSVTP 447


>gi|323967954|gb|EGB63366.1| exodeoxyribonuclease VII [Escherichia coli M863]
 gi|327252212|gb|EGE63884.1| exodeoxyribonuclease VII, large subunit [Escherichia coli STEC_7v]
          Length = 455

 Score =  379 bits (974), Expect = e-103,   Method: Composition-based stats.
 Identities = 144/507 (28%), Positives = 233/507 (45%), Gaps = 57/507 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+++++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDNAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q KNP+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQFKNPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANLRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + + + RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVHSAQQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTTLERLQKRMSFALENQLKRAGQQQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +                                          
Sbjct: 356 KIHRAQTRIQQLEYRLAE------------------------------------------ 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +       T   L++ +  +TL RGY+     +   + Q + +     
Sbjct: 374 -----TLRAQLSATRERFGNTVTHLEAVSPLSTLARGYSVTSAADGAVLKQVKQVKVGET 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTKK 511
           +     DG   + V      ++   K 
Sbjct: 429 LTTRLGDGVVISEVSAVTKSRKPRKKT 455


>gi|121601929|ref|YP_989310.1| exodeoxyribonuclease VII large subunit [Bartonella bacilliformis
           KC583]
 gi|189037838|sp|A1UTK7|EX7L_BARBK RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|120614106|gb|ABM44707.1| exodeoxyribonuclease VII, large subunit [Bartonella bacilliformis
           KC583]
          Length = 476

 Score =  379 bits (974), Expect = e-103,   Method: Composition-based stats.
 Identities = 210/527 (39%), Positives = 307/527 (58%), Gaps = 56/527 (10%)

Query: 4   FSQKN-SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHS 62
           F++K  + +  E+SVSE++  LK +VE    +V +RGEISGYRG H+SGHAYF+LKD+ +
Sbjct: 5   FTEKPVATNVAEFSVSEIANALKRVVEDKFGYVRIRGEISGYRGAHASGHAYFALKDDKA 64

Query: 63  RIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEK 122
           R++A+IW   + K+ F PEEG+E + +GK+TT+PGSSKYQI+IE+L P+G G L+T LE 
Sbjct: 65  RLEAVIWLSVMKKLSFPPEEGMEVIAVGKLTTYPGSSKYQIVIEALEPTGVGALMTLLEN 124

Query: 123 RKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQ 182
           RKKKL EEGLF   +K P+P++PKII V+TSPTGAVIRDI+ RI  RFPL ++++PV+VQ
Sbjct: 125 RKKKLAEEGLFDAANKKPLPYMPKIIGVVTSPTGAVIRDIIHRIFDRFPLHILVWPVRVQ 184

Query: 183 GDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIP 242
           G+ C +E+A+A+   N L  G   P+PD+II+ARGGGS+EDLW FNDE +VRA+  S+IP
Sbjct: 185 GETCGREVASAVEGFNALFLGGGIPKPDLIIVARGGGSLEDLWGFNDEAVVRAVYASAIP 244

Query: 243 IISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKY 302
           +ISA+GHETDWTL DYAAD RAPTPTGAAE AVPVK  ++  L ++ +R    + R   +
Sbjct: 245 VISAVGHETDWTLIDYAADWRAPTPTGAAERAVPVKLDIEVHLASINSRFRVGLARYFDF 304

Query: 303 KINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFL 362
               L +L++ LP  DQ  +  R   D +   L+  L +   +K  +F+ +  R     L
Sbjct: 305 HQQKLRALVRGLPTVDQLFALPRRGFDEISSRLQRALCVSYDKKCFYFHALSLRFSPRLL 364

Query: 363 IHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKK 422
             N +K +  I E    + +                                        
Sbjct: 365 --NTKKAQYAIQEYTGRLHR---------------------------------------- 382

Query: 423 LITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATK 482
                       ++     V +  R+L+S +Y+N L+RG+      ++  I +   L   
Sbjct: 383 -------AFLRNVEKQRAQVEMACRLLKSTSYQNILERGFVLALGKDHKPIKRLMQLPET 435

Query: 483 TRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
            +I + FFDG+ +    ++A  +    K+ +   +       QG LF
Sbjct: 436 GQISLRFFDGEIDVSTHDRAVNRSLKNKRIKSQKD------DQGLLF 476


>gi|163802482|ref|ZP_02196375.1| exodeoxyribonuclease VII large subunit [Vibrio sp. AND4]
 gi|159173783|gb|EDP58598.1| exodeoxyribonuclease VII large subunit [Vibrio sp. AND4]
          Length = 443

 Score =  379 bits (974), Expect = e-103,   Method: Composition-based stats.
 Identities = 137/494 (27%), Positives = 240/494 (48%), Gaps = 57/494 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           +  +   ++VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++   
Sbjct: 3   SQTNQNIFTVSRLNAEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSRAQVKCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++G   ++ F P  G + LV  +++ +     YQ+IIES+ P G G L    E  K KL
Sbjct: 62  MFRGNNRRVTFKPTNGNQVLVKARLSLYEPRGDYQLIIESMQPEGDGRLQQEFEALKMKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF+  +K  +P  P+ + VITS TGA + DIL  +  R P L V+++P  VQG++ 
Sbjct: 122 AAEGLFAQTNKQSLPEHPRRVGVITSKTGAALYDILDVLKRRDPSLPVVVYPTMVQGEDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
             +IA AI + N+  E       D++I+ RGGGS+EDLW FN+E++ R IA+S IPIISA
Sbjct: 182 AIQIAQAIGRANSRGE------CDVLIVGRGGGSLEDLWCFNNEILARTIASSQIPIISA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHE D T+AD+ AD+RAPTP+ AAE+      H   +L+  + +L + +   +  +   
Sbjct: 236 VGHEVDVTIADFVADMRAPTPSAAAELVSRDNSHKNQALVARQHKLASAMRYYLAQQKQQ 295

Query: 307 LNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
             SL+  L   +    L     +LD L   L+  ++  I  + +      +R++ +  + 
Sbjct: 296 SASLMHRLERQHPSYQLQRQTQQLDELDMRLQRAMQGFITTRQQAVERKHHRLQLNSPVK 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            + + +  +   +Q                                              
Sbjct: 356 RLAEQKSKLDRVEQ---------------------------------------------- 369

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
            ++   +  K+ +    ++I    L + +   TLKRGY+  Q      +TQ + + +   
Sbjct: 370 -KLMDAMDRKLLTMRHQLAIAAEKLDTVSPLATLKRGYSITQTEQGQIVTQAKEVKSGDV 428

Query: 485 ILINFFDGQANAIV 498
           ++    DG+  + V
Sbjct: 429 LVTRLSDGELRSTV 442


>gi|331684154|ref|ZP_08384750.1| exodeoxyribonuclease VII, large subunit [Escherichia coli H299]
 gi|331079106|gb|EGI50308.1| exodeoxyribonuclease VII, large subunit [Escherichia coli H299]
          Length = 458

 Score =  379 bits (974), Expect = e-103,   Method: Composition-based stats.
 Identities = 143/510 (28%), Positives = 230/510 (45%), Gaps = 57/510 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+++++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDNAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQLKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IPI+SA
Sbjct: 182 PGQIVRAIELANLRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPIVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSTHQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRAGQQQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +                                          
Sbjct: 356 RIHRAQTRIQQLEYRLAE------------------------------------------ 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +           L++ +  +TL RGY+     +   + Q + +     
Sbjct: 374 -----TLRAQLSATRERFGNAVTHLEAVSPLSTLARGYSVTSAADGAVLKQVKQVKVGET 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTKKCQL 514
           +     DG   + V      ++   K    
Sbjct: 429 LTTRLGDGVVISEVSAVTKTRKSRKKTSNP 458


>gi|326386127|ref|ZP_08207751.1| exodeoxyribonuclease VII large subunit [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326209352|gb|EGD60145.1| exodeoxyribonuclease VII large subunit [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 493

 Score =  379 bits (974), Expect = e-103,   Method: Composition-based stats.
 Identities = 186/523 (35%), Positives = 266/523 (50%), Gaps = 49/523 (9%)

Query: 6   QKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRID 65
           +    + P  S+SELS  LK  VE     V VRGE+SG +   +SGH Y SLKD ++R+D
Sbjct: 19  EAAGDNAPALSISELSQLLKRTVEDRFGFVRVRGELSGVK-RAASGHLYLSLKDENARLD 77

Query: 66  AIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKK 125
            ++W+G++ ++ F P +G+E +  GK+TT+PG S YQI+I+ +  +G G LL  LEK K 
Sbjct: 78  GVMWRGSVQRLGFQPADGVEVIATGKLTTYPGRSNYQIVIDRMEIAGEGALLALLEKTKA 137

Query: 126 KLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDE 185
           +L  EGLF    K P+P++P++I V+TSPTGAVIRDIL R+  RFP  V+++PV VQG  
Sbjct: 138 RLAAEGLFDPARKRPLPYLPRVIGVVTSPTGAVIRDILHRLRDRFPSHVVVWPVLVQGQG 197

Query: 186 CPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIIS 245
              ++A A+   + L+ G    RPD++I+ARGGGSIEDLW FN+E +VRAIA S+IP+IS
Sbjct: 198 AASQVAAAVRGFSELEPGGPVARPDLVIVARGGGSIEDLWSFNEEEVVRAIAASTIPVIS 257

Query: 246 AIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKIN 305
           A+GHETD TLAD+AAD RAPTPT AAEMAVPV+  L + L +LEAR    + R +     
Sbjct: 258 AVGHETDTTLADFAADRRAPTPTAAAEMAVPVRAELMAGLADLEARRQRALGRQLAQARE 317

Query: 306 TLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHN 365
            L+   + LP     LS    RLD L   L  +L                 +        
Sbjct: 318 RLDQRARRLPPPHALLSGQAQRLDDLGERLRRSLGHRTELAAAMLARHAGSL-------- 369

Query: 366 IQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLIT 425
                                           + A+L     + + R+  L    + L+ 
Sbjct: 370 --------------------------------RPALLETRLRRERERLLALRLRPEALLQ 397

Query: 426 RIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRI 485
           RIE             V    R+ +S   +  L RGY  + D+    +  +   A +  +
Sbjct: 398 RIETA--------RGRVDALDRLRRSLDPEAPLARGYVLVTDSAGRVVKTRSAAAGEAEL 449

Query: 486 LINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGEL 528
            + F DG    +         +PT +             Q +L
Sbjct: 450 TLKFADGSLGVVPAGAGSTGGEPTPRPARAKTPPSTGDRQPKL 492


>gi|126725606|ref|ZP_01741448.1| exodeoxyribonuclease VII, large subunit [Rhodobacterales bacterium
           HTCC2150]
 gi|126704810|gb|EBA03901.1| exodeoxyribonuclease VII, large subunit [Rhodobacterales bacterium
           HTCC2150]
          Length = 510

 Score =  379 bits (974), Expect = e-103,   Method: Composition-based stats.
 Identities = 196/532 (36%), Positives = 285/532 (53%), Gaps = 25/532 (4%)

Query: 1   MNPFSQKNSL--DHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLK 58
           M+          + PE++V+E+S  +K  +E + S V VR E+ G      SGH Y  LK
Sbjct: 1   MSDLIDDPQEGENAPEFTVTEISGAVKRTIEGSFSRVRVRAEL-GRVSRPRSGHVYLDLK 59

Query: 59  DNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLT 118
           D+ S +  +IWKG  +++   PEEG+E +  G++TTF G SKYQ++IE L P+G G L+ 
Sbjct: 60  DDKSVLSGVIWKGVASRLATQPEEGLEVVATGRLTTFGGQSKYQMVIEDLAPAGMGALMA 119

Query: 119 ALEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFP 178
            LEKRK+    EGLF    K P+P++P++I V+TSP+GAVIRDIL R+  RFP RV+I+P
Sbjct: 120 MLEKRKQAFAAEGLFDASRKQPLPYLPEVIGVVTSPSGAVIRDILHRLRDRFPRRVLIWP 179

Query: 179 VKVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIAN 238
           V VQG +C  E+A AI   N L  G   PRPD++I+ARGGGS+EDLW FN+E +VRA A 
Sbjct: 180 VAVQGQKCAPEVARAIAGFNALTPGGALPRPDLLIVARGGGSVEDLWGFNEEAVVRAAAA 239

Query: 239 SSIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIR 298
           S IP+ISA+GHETD TL DY +DLRAPTPT AAE AVPV+  L S +  L AR    + +
Sbjct: 240 SDIPLISAVGHETDTTLIDYVSDLRAPTPTAAAEAAVPVRMELMSVIDELGARSGRALRQ 299

Query: 299 LIKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIK 358
            I  + +    L + LP  +Q +  +R RLD L   L   L  +  R+    + I   ++
Sbjct: 300 GIMQRRDRARDLARILPKPEQLVENARQRLDTLSDRLPKALASVRQRRQVALSRISGGLR 359

Query: 359 SDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHT 418
              L   ++  R+   +  + +   + +    +  E +                      
Sbjct: 360 PTTLQRRLEAERRRSDDLARRLGPALVRGRDRLVQENRR------------------SRE 401

Query: 419 HIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRN 478
           ++  +  R +   + +I    T++S   R+ Q+  YK TLKRGY  ++      ITQ+  
Sbjct: 402 NLDVVFARFQRAANSQISDWKTALSGAERMRQTLGYKETLKRGYAVVRGA-GQVITQREE 460

Query: 479 LATKTRILINFFDGQANAIVINKAPPKEQPT-KKCQLHNNKREKQGTQGELF 529
            A    + I F DG+ N  V      ++  T          +     QG LF
Sbjct: 461 AAKHHALEIEFHDGRVN--VGETQTAEKTATVTPVMKPKKPKPTDKDQGSLF 510


>gi|322613746|gb|EFY10685.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322619511|gb|EFY16387.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322625016|gb|EFY21845.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322629541|gb|EFY26317.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322634028|gb|EFY30765.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322635534|gb|EFY32245.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322639891|gb|EFY36568.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322644413|gb|EFY40954.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322649134|gb|EFY45574.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322655223|gb|EFY51532.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322658270|gb|EFY54536.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322664271|gb|EFY60468.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322669438|gb|EFY65587.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322673165|gb|EFY69271.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322676557|gb|EFY72625.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322683307|gb|EFY79321.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322685807|gb|EFY81800.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323192517|gb|EFZ77746.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323199562|gb|EFZ84653.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323204663|gb|EFZ89661.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323208111|gb|EFZ93056.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323210165|gb|EFZ95066.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323217032|gb|EGA01754.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323219227|gb|EGA03723.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323225452|gb|EGA09683.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323229279|gb|EGA13403.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323235406|gb|EGA19490.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323237408|gb|EGA21471.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323245162|gb|EGA29163.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323248865|gb|EGA32791.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323253153|gb|EGA36985.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323255386|gb|EGA39154.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323260590|gb|EGA44200.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323266366|gb|EGA49854.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323269803|gb|EGA53253.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
          Length = 449

 Score =  379 bits (974), Expect = e-103,   Method: Composition-based stats.
 Identities = 142/499 (28%), Positives = 228/499 (45%), Gaps = 57/499 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           +S     ++VS L+  ++ ++E  +  V + GE+S +    +SGH YF+LKD+ +++   
Sbjct: 3   SSQTSSIFTVSRLNQTVRLLLEQEMGQVWISGELSNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIAESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  QHK P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQHKQPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANARGE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + + + RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEIVSRNQQELLRQIQSAQQRLGMAMDYYLANRSRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  I +  +    +  R+       
Sbjct: 296 FTQIFHRLQQQHPQLRLARQQTALERLRQRMGFALEARIKQATQRQQRVSQRLSQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +                                               
Sbjct: 356 RIHRAQSRIQQLEYR--------------------------------------------- 370

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
             +   +  ++             L++ +   TL RGYT    T+   + + + +     
Sbjct: 371 --LTENIRSRLSEQRERFGNAVTHLEAVSPLATLARGYTVSTTTDGKVLKKIKQVKAGDI 428

Query: 485 ILINFFDGQANAIVINKAP 503
           +     DG   + V +  P
Sbjct: 429 MTTRLEDGWLESEVKSVTP 447


>gi|254450924|ref|ZP_05064361.1| exodeoxyribonuclease VII, large subunit [Octadecabacter antarcticus
           238]
 gi|198265330|gb|EDY89600.1| exodeoxyribonuclease VII, large subunit [Octadecabacter antarcticus
           238]
          Length = 515

 Score =  379 bits (974), Expect = e-103,   Method: Composition-based stats.
 Identities = 171/530 (32%), Positives = 266/530 (50%), Gaps = 18/530 (3%)

Query: 1   MNPFSQKNSL-DHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKD 59
           M+   +  +  + PE++V+ELS  +K  +E    HV V+ E+ G      SGH YF LKD
Sbjct: 3   MDLTDEPEAAGNTPEFTVTELSGAVKRAIEGEFGHVRVKAEV-GRVVHARSGHLYFDLKD 61

Query: 60  NHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTA 119
           + + +    WKG +  +  +PEEG+E +V G++TTF   SKYQ+    +  +G G L+  
Sbjct: 62  DRNVLACTTWKGQVADLSVIPEEGMEVVVKGRMTTFGSQSKYQLNATEVAVAGVGALMAM 121

Query: 120 LEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPV 179
           L++RKK L  EGLF+ + K  +PF+P +I VITSPTGAV+RDIL R+  RFP +VI++PV
Sbjct: 122 LDQRKKALEAEGLFAAERKQALPFLPDVIGVITSPTGAVVRDILHRLRDRFPRKVIVWPV 181

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
            VQG +C  ++A AI   N +  G   PRPD+II+ARGGGSIEDLW FN+E++ RA A S
Sbjct: 182 AVQGKDCAPQVARAIDGFNAMTSGGALPRPDLIIVARGGGSIEDLWGFNEEIVARAAAAS 241

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
           +IP+ISAIGHETD TL D+ +D RAPTP+ AAEMAVPV+  L +++  + AR    +   
Sbjct: 242 TIPLISAIGHETDTTLIDFVSDQRAPTPSAAAEMAVPVRLELMAAVDQMGARATRAVTDG 301

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
           +  +   +  L + LP   Q    ++ R D    +L+  L   +             ++ 
Sbjct: 302 VARRKQRVADLARVLPKPKQLTEDAKQRFDYWSEKLDVALIGRVAAGRLRLGDASGLLRP 361

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH 419
             L + +   R+ +      +   + +       +   +   L    E            
Sbjct: 362 SVLGNRLTLGRERMSGLNARLGPALGRMAAQARRDLDGQARRL--RPETIAVAQTRAVKD 419

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
           +   + R+      + +   + +    R+ ++  Y+ TLKRGY  ++  +   +T  +  
Sbjct: 420 LAATLRRMTTAAHTQTQKQRSRLEALDRMRETLGYRETLKRGYAVVRG-DGVVVTTAKAA 478

Query: 480 ATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
                + I F DG                          +     QG LF
Sbjct: 479 KAALTLDIEFADGTM-------------APTSKLAKPKGKMPPPDQGSLF 515


>gi|320180499|gb|EFW55430.1| Exodeoxyribonuclease VII large subunit [Shigella boydii ATCC 9905]
          Length = 456

 Score =  379 bits (974), Expect = e-103,   Method: Composition-based stats.
 Identities = 146/506 (28%), Positives = 234/506 (46%), Gaps = 57/506 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+K P+P     + VITS TGA + DIL  +  R P L  II+P  VQGD+ 
Sbjct: 122 QAEGLFDQQYKKPLPSPAHCVGVITSKTGATLHDILHVLKRRDPSLPAIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANQRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQMQSARQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRAGQQQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +I                                         
Sbjct: 356 KIHRAQTRIQQLEYRLAEI----------------------------------------- 374

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +           L++ +  +TL RGY+    T+ N + + + +     
Sbjct: 375 ------LRAQLSATRERFGNAVTHLEAVSPLSTLARGYSVTTATDGNVLKKVKQVKAGEM 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTK 510
           +     DG   + V N  P K+   K
Sbjct: 429 LTTRLEDGWIESEVKNIQPVKKSRKK 454


>gi|261252186|ref|ZP_05944759.1| exodeoxyribonuclease VII large subunit [Vibrio orientalis CIP
           102891]
 gi|260935577|gb|EEX91566.1| exodeoxyribonuclease VII large subunit [Vibrio orientalis CIP
           102891]
          Length = 443

 Score =  379 bits (973), Expect = e-103,   Method: Composition-based stats.
 Identities = 138/495 (27%), Positives = 239/495 (48%), Gaps = 57/495 (11%)

Query: 7   KNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDA 66
            +  +   ++VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++  
Sbjct: 2   SSLTNQNIFTVSRLNAEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSRAQVKC 60

Query: 67  IIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKK 126
            +++G   ++ F P+ G + LV  +++ +     YQ+IIES+ P G G L    E+ K K
Sbjct: 61  AMFRGNNRRVTFKPKNGNQVLVKARLSLYEPRGDYQLIIESMQPEGDGRLQQQFEELKMK 120

Query: 127 LLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDE 185
           L  EGLF+   K P+P  PK + VITS TGA + DIL  +  R P L V+++P  VQG+E
Sbjct: 121 LAGEGLFAQTSKKPLPEHPKRVGVITSKTGAALYDILDVLKRRDPSLPVVVYPTMVQGEE 180

Query: 186 CPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIIS 245
              +IA AI   N+  E       D++I+ RGGGS+EDLW FN+E++ R IA S IPIIS
Sbjct: 181 AAIQIAQAIGCANSRNE------CDVLIVGRGGGSLEDLWCFNNEILARTIAASQIPIIS 234

Query: 246 AIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKIN 305
           A+GHE D T+AD+ AD+RAPTP+ AAE+      H   +L++ + +L + +   +  +  
Sbjct: 235 AVGHEVDVTIADFVADMRAPTPSAAAELVSRDNSHKDQALLSRQNKLVSAMRYYLSEQKR 294

Query: 306 TLNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLI 363
               LL  L   +    L     +LD L   L  ++E  + ++ +       R++ +  +
Sbjct: 295 HNALLLHRLERQHPSYQLQRQSQQLDELEVRLHRSMERYLSQRSQKVERQQYRLELNSPV 354

Query: 364 HNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKL 423
             + + +  +   +Q +   +                                       
Sbjct: 355 KRLSEQKSTLQRLEQKLLDAM--------------------------------------- 375

Query: 424 ITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKT 483
                     ++ +    +++    L + +   TLKRGY+  Q      +T+  ++ T  
Sbjct: 376 --------DRRLLNTRHQLALAAEKLDTVSPLATLKRGYSISQTEQGKVLTKTSDIKTGD 427

Query: 484 RILINFFDGQANAIV 498
            ++    DG+  + V
Sbjct: 428 TLVTRLSDGEIRSTV 442


>gi|145628760|ref|ZP_01784560.1| exodeoxyribonuclease VII large subunit [Haemophilus influenzae
           22.1-21]
 gi|144979230|gb|EDJ88916.1| exodeoxyribonuclease VII large subunit [Haemophilus influenzae
           22.1-21]
          Length = 442

 Score =  379 bits (973), Expect = e-103,   Method: Composition-based stats.
 Identities = 145/494 (29%), Positives = 237/494 (47%), Gaps = 57/494 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           N++    YSVS+L+   + I+E + S + + GEIS +     SGH Y +LKD ++++   
Sbjct: 2   NNMSDNIYSVSQLNSAARQILEGHFSQIWLTGEISNFT-QPVSGHWYLTLKDKNAQVRCA 60

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++    ++ F P+ G++ LV   ++ +     YQ+II+S+ P+G G L    E  K KL
Sbjct: 61  MFRMKNLRVAFRPQNGMQVLVRANVSLYEPRGDYQLIIDSMHPAGEGLLQQQFEALKMKL 120

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF+   K  +P   K + +ITS TGA ++DIL  ++ R P L+VII+P  VQG E 
Sbjct: 121 AAEGLFAQNLKKNLPHFSKAVGIITSSTGAALQDILHILARRDPSLKVIIYPTAVQGKEA 180

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
             EI   I   N  +E       D++I+ RGGGS+EDLW FN+E + RAI  S++PIISA
Sbjct: 181 TAEIVQMIELANARQE------VDVLIVGRGGGSLEDLWCFNEEEVARAIFRSTLPIISA 234

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   L + + RL+    RL   K   
Sbjct: 235 VGHETDVTIADFVADLRAPTPSAAAELVSRNQDELLQQLRHQQQRLDMAFDRLFTRKSQR 294

Query: 307 LNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
           L  L   L   +    L   + + ++L   L+  +        + F  +  R+K + L +
Sbjct: 295 LKQLALRLQNQHPQNQLRAQQAKNEQLAHRLQLAILRQFENTQQKFTALSVRLKQNPLPY 354

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            IQ+++QH+ + Q                                               
Sbjct: 355 RIQRHQQHLEQLQVR--------------------------------------------- 369

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
             + F ++ ++      ++     L   +    L RGY+  ++     I   +++     
Sbjct: 370 --LNFCVNRQVTERQNKLATLCGKLDGLSPLKVLARGYSIAENPQGKAIVSVKDVNQGDF 427

Query: 485 ILINFFDGQANAIV 498
           I     DG+  + V
Sbjct: 428 ITTQVADGKIVSKV 441


>gi|260869198|ref|YP_003235600.1| exonuclease VII, large subunit XseA [Escherichia coli O111:H- str.
           11128]
 gi|257765554|dbj|BAI37049.1| exonuclease VII, large subunit XseA [Escherichia coli O111:H- str.
           11128]
 gi|323177367|gb|EFZ62955.1| exodeoxyribonuclease VII, large subunit [Escherichia coli 1180]
          Length = 456

 Score =  379 bits (973), Expect = e-103,   Method: Composition-based stats.
 Identities = 144/506 (28%), Positives = 234/506 (46%), Gaps = 57/506 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDLQYKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +   AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQTVRAIELANQRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSTRQRLEMAMDYYLANRTRL 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRTGQQQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + + ++                                       
Sbjct: 356 KIHRAQTRIQQLEYRLAETLRV-------------------------------------- 377

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                    ++ +           L++ +  +TL RGY+    T+ N + + + +     
Sbjct: 378 ---------QLSATRERFGNAVTHLEAVSPLSTLARGYSVTTATDGNVLKKVKQVKAGEM 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTK 510
           +     DG   + V N  P K+   K
Sbjct: 429 LTTRLEDGWIESEVKNIQPVKKSRKK 454


>gi|254563195|ref|YP_003070290.1| exonuclease VII, large subunit OB-fold nucleic acid binding domain
           [Methylobacterium extorquens DM4]
 gi|254270473|emb|CAX26473.1| putative exonuclease VII, large subunit OB-fold nucleic acid
           binding domain [Methylobacterium extorquens DM4]
          Length = 522

 Score =  379 bits (973), Expect = e-103,   Method: Composition-based stats.
 Identities = 202/549 (36%), Positives = 287/549 (52%), Gaps = 68/549 (12%)

Query: 2   NPFSQKN-SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
            P        + PE+SV +L+  LK  +E    HV +RGEI+GYRG H SGHAYFSLKD 
Sbjct: 21  EPAPSALLQANTPEWSVGDLAAALKRTLEDAFGHVRLRGEITGYRGPHGSGHAYFSLKDG 80

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            ++IDA++WKG L ++   P+EG+E +  GKITTF G S YQI+I+S+ P+G G  +  L
Sbjct: 81  SAKIDAVVWKGVLGRLRQKPKEGLEVVATGKITTFAGKSSYQIVIDSMEPAGIGAWMALL 140

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           E+RK++L  EGLF    K PIPF+P++I V+TSPTGAVIRDIL R+  RFP  V+++PV+
Sbjct: 141 EERKRQLAAEGLFETDRKRPIPFLPRVIGVVTSPTGAVIRDILHRLEDRFPRPVLVWPVR 200

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQG+   +EIA AI   N L      PRPD++I+ARGGGSIEDLW FN+E +VRA A S 
Sbjct: 201 VQGEGAAEEIAAAIRGFNALSPDGPIPRPDVLIVARGGGSIEDLWAFNEEAVVRAAAESE 260

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP+ISA+GHETD TL D+A+D RAPTPTGAAEMAVPV+  L + +  L AR    ++R I
Sbjct: 261 IPLISAVGHETDTTLIDFASDRRAPTPTGAAEMAVPVRAELAAQVHELGARQAGTMLRRI 320

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           + +     +L++A+P +D  L+  R RLD                       + +     
Sbjct: 321 ERERADFRALVRAIPGADAFLAVKRQRLD-----------------------LADARLRP 357

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420
            L  N + +R+ +      + +      R   +   E  A L  +  + +  +  +    
Sbjct: 358 ALAANARDSRERLNRVADRLTR------RSPAIALAEARARLAAIDHRPRTAMSRIVER- 410

Query: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480
                                +   T +L + +YK  L RGY  ++D +   +      A
Sbjct: 411 -----------------RRDRLDALTSLLGALSYKAVLARGYALVRDADGLPVRSAAAAA 453

Query: 481 TKTRILINFFDGQANAIVIN-----------KAPPKEQPTKKCQLHNNKREKQGT----- 524
              R  + F DG   A                APP  +P +  +    +   +       
Sbjct: 454 QAARFQLQFADGALFARPEEAPDDPVAPPVADAPPSPRPKRAPRRAAPEPAPKPEKVTAE 513

Query: 525 ----QGELF 529
               QG LF
Sbjct: 514 PAARQGSLF 522


>gi|148827599|ref|YP_001292352.1| exodeoxyribonuclease VII large subunit [Haemophilus influenzae
           PittGG]
 gi|148718841|gb|ABQ99968.1| exodeoxyribonuclease VII large subunit [Haemophilus influenzae
           PittGG]
          Length = 442

 Score =  379 bits (973), Expect = e-103,   Method: Composition-based stats.
 Identities = 143/494 (28%), Positives = 236/494 (47%), Gaps = 57/494 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           N++    YSVS+L+   + ++E + S + + GEIS +     SGH Y +LKD ++++   
Sbjct: 2   NNMSDNIYSVSQLNSAARQMLEGHFSQIWLTGEISNFT-QPVSGHWYLTLKDENAQVRCA 60

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++    ++ F P+ G++ LV   ++ +     YQ+II+S+ P+G G L    E  K KL
Sbjct: 61  MFRMKNLRVAFRPQNGMQVLVRANVSLYEPRGDYQLIIDSMHPAGEGLLQQQFEALKMKL 120

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF+   K  +P   K + +ITS TGA ++DIL  ++ R P L+V+I+P  VQG E 
Sbjct: 121 ATEGLFAQNLKKNLPHFSKAVGIITSSTGAALQDILHILARRDPSLKVVIYPTAVQGKEA 180

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
             EI   I   N  +E       D++I+ RGGGS+EDLW FN+E + RAI  S++PIISA
Sbjct: 181 TAEIVQMIELANARQE------VDVLIVGRGGGSLEDLWCFNEEEVARAIFRSTLPIISA 234

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   L + + RL+    RL   K   
Sbjct: 235 VGHETDVTIADFVADLRAPTPSAAAELVSRNQDELLQQLRHQQQRLDMAFDRLFTRKSQR 294

Query: 307 LNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
           L  L   L   +    L   + +  +L   L+  +        + F  +  R+K + L +
Sbjct: 295 LKQLTLRLHNQHPQNQLRVQQAKNAQLTHRLQLAILRQFENTQQKFTALSVRLKQNPLPY 354

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            IQ+++QH+ + Q                                               
Sbjct: 355 RIQRHQQHLEQLQVR--------------------------------------------- 369

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
             + F ++ ++      ++     L   +    L RGY+  ++     I   +++     
Sbjct: 370 --LNFCVNRQVTERQNKLATLCGKLDGLSPLKVLARGYSIAENPQGKAIVSVKDVNQGDF 427

Query: 485 ILINFFDGQANAIV 498
           I     DG+  + V
Sbjct: 428 ITTQVADGKIVSKV 441


>gi|56412606|ref|YP_149681.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197361541|ref|YP_002141177.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|81821470|sp|Q5PI54|EX7L_SALPA RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|226697606|sp|B5BAZ3|EX7L_SALPK RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|56126863|gb|AAV76369.1| exodeoxyribonuclease large subunit [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197093017|emb|CAR58453.1| exodeoxyribonuclease large subunit [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
          Length = 449

 Score =  379 bits (973), Expect = e-103,   Method: Composition-based stats.
 Identities = 142/499 (28%), Positives = 228/499 (45%), Gaps = 57/499 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           +S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   SSQTSSIFTVSRLNQTVRLLLEQEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQ+I ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQVIAESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  QHK P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQHKQPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANARGE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + + + RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEIVSRNQQELLRQIQSAQQRLGMAMDYYLANRSRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  I +  +    +  R+       
Sbjct: 296 FTQIFHRLQQQHPQLRLARQQTALERLRQRMGFALEARIKQANQRQQRVSQRLSQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +                                               
Sbjct: 356 RIHRAQSRIQQLEYR--------------------------------------------- 370

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
             +   +  ++             L++ +   TL RGYT    T+   + + + +     
Sbjct: 371 --LTENIRSRLSEQRERFGNAVTHLEAVSPLATLARGYTVSTTTDGKVLKKIKQVNAGDI 428

Query: 485 ILINFFDGQANAIVINKAP 503
           +     DG   + V +  P
Sbjct: 429 MTTRLEDGWLESEVKSVTP 447


>gi|200386969|ref|ZP_03213581.1| exodeoxyribonuclease VII, large subunit [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|199604067|gb|EDZ02612.1| exodeoxyribonuclease VII, large subunit [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
          Length = 449

 Score =  379 bits (973), Expect = e-103,   Method: Composition-based stats.
 Identities = 143/499 (28%), Positives = 227/499 (45%), Gaps = 57/499 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           +S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   SSQTSSIFTVSRLNQTVRLLLEQEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIAESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  QHK P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQHKQPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + R I  S IP++SA
Sbjct: 182 PGQIVRAIELANARGE------CDVLIVGRGGGSLEDLWSFNDERVARTIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + + + RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEIVSRNQQELLRQIQSAQQRLGMAMDYYLANRSRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  I +  +    +  R+       
Sbjct: 296 FTQIFHRLQQQHPQLRLARQQTALERLRQRMGFALEARIKQATQRQQRVSQRLSQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +                                               
Sbjct: 356 RIHRAQSRIQQLEYR--------------------------------------------- 370

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
             +   +  ++             L++ +   TL RGYT    TN   + + + +     
Sbjct: 371 --LTENIRSRLSEQRERFGNAVTHLEAVSPLATLARGYTVSTTTNGKVLKKIKQVKAGDI 428

Query: 485 ILINFFDGQANAIVINKAP 503
           +     DG   + V +  P
Sbjct: 429 MTTRLEDGWLESEVKSVTP 447


>gi|258619963|ref|ZP_05715003.1| exodeoxyribonuclease VII large subunit [Vibrio mimicus VM573]
 gi|258587696|gb|EEW12405.1| exodeoxyribonuclease VII large subunit [Vibrio mimicus VM573]
          Length = 446

 Score =  379 bits (973), Expect = e-103,   Method: Composition-based stats.
 Identities = 139/496 (28%), Positives = 240/496 (48%), Gaps = 57/496 (11%)

Query: 6   QKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRID 65
             +  +   Y+VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++ 
Sbjct: 2   SSSLANRNIYTVSRLNAEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSQAQVK 60

Query: 66  AIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKK 125
             ++KG    + F P+ G + LV  +++ +     YQII+ES+ P G G L    E+ K 
Sbjct: 61  CAMFKGNNRLVNFKPQNGQQVLVKARLSLYEPRGDYQIILESMQPEGDGRLQQQFEQLKM 120

Query: 126 KLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGD 184
            L  EGLF+   K P+P  P+ + +ITS TGA + DIL  +  R P L V+I+P  VQG+
Sbjct: 121 LLAAEGLFAQTRKKPLPENPRCVGIITSRTGAALHDILHVLKRRDPNLPVVIYPTLVQGE 180

Query: 185 ECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPII 244
           +   +IA AI + N+  E       D++I+ RGGGS+EDLW FN E++ R IA S IPII
Sbjct: 181 DAAIQIAQAIGRANSRAE------CDVLIVGRGGGSLEDLWCFNHEIVARTIAASDIPII 234

Query: 245 SAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKI 304
           SA+GHE D T+AD+ AD+RAPTP+ AAE+      H Q +L   +A+L + +   +  + 
Sbjct: 235 SAVGHEIDVTIADFVADVRAPTPSAAAELVSRDNRHKQQALHQWQAKLASGMRHYLAQQH 294

Query: 305 NTLNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFL 362
                +   L   +    L   + +LD L   LE  +   +  + + +  + ++I+ +  
Sbjct: 295 TQFARIQHKLDKQHPQARLERQQQQLDELSLRLEQKIHQRLATQQQRWERLSHKIQLNSP 354

Query: 363 IHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKK 422
            H I++ R ++L+++Q + Q                                        
Sbjct: 355 THLIRQQRFNLLQQEQRLTQ---------------------------------------- 374

Query: 423 LITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATK 482
                   + H +      +++ +  + + +   TL RGY+  +      + Q   +   
Sbjct: 375 -------SIQHHLIQSRHQLALLSEKMDAVSPLATLARGYSVTRTAQGELVRQSAQVKPG 427

Query: 483 TRILINFFDGQANAIV 498
             ++    DG+  + V
Sbjct: 428 DTLVTQLMDGEILSTV 443


>gi|254506777|ref|ZP_05118917.1| exodeoxyribonuclease VII, large subunit [Vibrio parahaemolyticus
           16]
 gi|219550358|gb|EED27343.1| exodeoxyribonuclease VII, large subunit [Vibrio parahaemolyticus
           16]
          Length = 443

 Score =  379 bits (973), Expect = e-103,   Method: Composition-based stats.
 Identities = 139/495 (28%), Positives = 236/495 (47%), Gaps = 57/495 (11%)

Query: 7   KNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDA 66
            +  +   ++VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++  
Sbjct: 2   SSLTNQNIFTVSRLNSEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSRAQVKC 60

Query: 67  IIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKK 126
            +++G   ++ F P+ G + LV  +++ +     YQ+IIES+ P G G L    ++ K K
Sbjct: 61  AMFRGNNRRVTFKPQNGNQVLVKARLSLYEPRGDYQLIIESMQPEGDGRLQQQFDELKMK 120

Query: 127 LLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDE 185
           L  EGLF+  +K P+P  PK + ++TS TGA + DIL  +  R P L V+I+P  VQG+E
Sbjct: 121 LAGEGLFAQTNKQPLPEHPKCVGIVTSKTGAALFDILDVLKRRDPSLPVVIYPTMVQGEE 180

Query: 186 CPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIIS 245
              +IA AI   N+  E       D++I+ RGGGS+EDLW FN+E++ R IA S IPIIS
Sbjct: 181 AAIQIAQAIGCANSRNE------CDVLIVGRGGGSLEDLWCFNNEILARTIAASQIPIIS 234

Query: 246 AIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKIN 305
           A+GHE D T+AD+ AD+RAPTP+ AAE+      H    + + + +L + +   +     
Sbjct: 235 AVGHEIDVTIADFVADMRAPTPSAAAELVSRDNSHKDQVITSHQHKLASAMRHYLSQHKQ 294

Query: 306 TLNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLI 363
           T  SLL  L   +    L     +LD L   L+  +E  +  + +      ++++    I
Sbjct: 295 TNASLLHRLEKQHPRHQLQRQSQQLDDLDMRLQRGMERYLSGRAQKIERQQHKLQLHSPI 354

Query: 364 HNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKL 423
             + +    +   +Q +   +                                       
Sbjct: 355 KRLNEQASSLQRLEQKLLDAM--------------------------------------- 375

Query: 424 ITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKT 483
                     K+ +    +++    L +     TLKRGY+  Q+   + IT+     T  
Sbjct: 376 --------DRKLLNTRHQLALAAEKLDTVNPLATLKRGYSITQNQQGDVITKASQTKTGD 427

Query: 484 RILINFFDGQANAIV 498
            ++    DG+  + V
Sbjct: 428 TLVTRLSDGEIRSTV 442


>gi|197334825|ref|YP_002155393.1| exodeoxyribonuclease VII, large subunit [Vibrio fischeri MJ11]
 gi|226697620|sp|B5FAX9|EX7L_VIBFM RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|197316315|gb|ACH65762.1| exodeoxyribonuclease VII, large subunit [Vibrio fischeri MJ11]
          Length = 449

 Score =  379 bits (973), Expect = e-103,   Method: Composition-based stats.
 Identities = 138/496 (27%), Positives = 238/496 (47%), Gaps = 57/496 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIW 69
            +   ++VS L+  ++ ++E+ +  V + GEIS       SGH Y +LKD+ +++   ++
Sbjct: 5   SNPRIFTVSRLNAEVRLLLENEMGIVWLVGEISNLTV-PVSGHWYLTLKDSQAQVKCAMF 63

Query: 70  KGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLE 129
           KG   ++ F P+ G + LV  +++ +     YQ+IIES+ P G G L    ++ K  L  
Sbjct: 64  KGNNRRVTFKPQNGKQVLVKARLSLYEPRGDYQLIIESMQPEGDGRLQQEFDQLKMSLAA 123

Query: 130 EGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPK 188
           EGLF+   K  +P  PK + +ITS TGA + DIL  +  R P L V+I+P  VQG     
Sbjct: 124 EGLFAQTAKKTLPEQPKRVGIITSQTGAALFDILHVLKRRDPNLPVVIYPTMVQGSGAAI 183

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           +IA AI + N+  E       DI+I+ RGGGS+EDLW FN+E++ R IA S IPI+SA+G
Sbjct: 184 QIAQAIGRANSRNE------CDILIVGRGGGSLEDLWCFNEEIVARTIAASEIPIVSAVG 237

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HE D T+AD+ AD+RAPTP+ AAE+          ++ + + RLN+ + R + ++  +L+
Sbjct: 238 HEIDVTIADFVADVRAPTPSAAAELVSRDLSAQLQTVAHQKRRLNSAMERYLSHQQRSLS 297

Query: 309 SLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNI 366
           +    +   +    L+    RLD L + L ++++  + R+     ++  R+ +      I
Sbjct: 298 AYQHRIEKQHPQMQLNNQSQRLDDLNQRLMNHIQQRLQRQQYRVENLTLRLNNLSPTKRI 357

Query: 367 QKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITR 426
            +++ HI E ++ +                                              
Sbjct: 358 SQDKLHIEELKRRLL--------------------------------------------- 372

Query: 427 IEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRIL 486
               +   +      +++    L + +   TL RGY+   + +   IT  + +     I 
Sbjct: 373 --DSMDRNLLMQRHQLALAAEKLDTVSPLATLMRGYSITHNQDGKVITSTKQVELGDNIT 430

Query: 487 INFFDGQANAIVINKA 502
             F DG   + V   +
Sbjct: 431 TRFADGDITSTVTKAS 446


>gi|194445807|ref|YP_002041771.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|226697605|sp|B4T0N9|EX7L_SALNS RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|194404470|gb|ACF64692.1| exodeoxyribonuclease VII, large subunit [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
          Length = 449

 Score =  379 bits (973), Expect = e-103,   Method: Composition-based stats.
 Identities = 142/499 (28%), Positives = 228/499 (45%), Gaps = 57/499 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           +S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   SSQTSSIFTVSRLNQTVRLLLEQEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQ+I ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQVIAESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  QHK P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQHKQPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANARGE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + + + RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEIVSRNQQELLRQIQSAQQRLGMAMDYYLANRSRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  I +  +    +  R+       
Sbjct: 296 FTQIFHRLQQQHPQLRLARQQTALERLRQRMGFALEARIKQATQRQQRVSQRLSQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +                                               
Sbjct: 356 RIHRAQSRIQQLEYR--------------------------------------------- 370

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
             +   +  ++             L++ +   TL RGYT    T+   + + + +     
Sbjct: 371 --LTENIRSRLSEQRERFGNAVTHLEAVSPLATLARGYTVSTTTDGKVLKKIKQVNAGDI 428

Query: 485 ILINFFDGQANAIVINKAP 503
           +     DG   + V +  P
Sbjct: 429 MTTRLEDGWLESEVKSVTP 447


>gi|258541125|ref|YP_003186558.1| exodeoxyribonuclease VII large subunit [Acetobacter pasteurianus
           IFO 3283-01]
 gi|256632203|dbj|BAH98178.1| exodeoxyribonuclease VII large subunit [Acetobacter pasteurianus
           IFO 3283-01]
 gi|256635260|dbj|BAI01229.1| exodeoxyribonuclease VII large subunit [Acetobacter pasteurianus
           IFO 3283-03]
 gi|256638315|dbj|BAI04277.1| exodeoxyribonuclease VII large subunit [Acetobacter pasteurianus
           IFO 3283-07]
 gi|256641369|dbj|BAI07324.1| exodeoxyribonuclease VII large subunit [Acetobacter pasteurianus
           IFO 3283-22]
 gi|256644424|dbj|BAI10372.1| exodeoxyribonuclease VII large subunit [Acetobacter pasteurianus
           IFO 3283-26]
 gi|256647479|dbj|BAI13420.1| exodeoxyribonuclease VII large subunit [Acetobacter pasteurianus
           IFO 3283-32]
 gi|256650532|dbj|BAI16466.1| exodeoxyribonuclease VII large subunit [Acetobacter pasteurianus
           IFO 3283-01-42C]
 gi|256653523|dbj|BAI19450.1| exodeoxyribonuclease VII large subunit [Acetobacter pasteurianus
           IFO 3283-12]
          Length = 484

 Score =  379 bits (973), Expect = e-103,   Method: Composition-based stats.
 Identities = 165/502 (32%), Positives = 260/502 (51%), Gaps = 30/502 (5%)

Query: 6   QKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRID 65
              S + PE++VSE+S  ++  +E   S V VRGEI+  +    SGH YFSLKD   +I 
Sbjct: 8   PSASNNVPEFTVSEISGAIRRTLEGTFSRVRVRGEITELKRYP-SGHVYFSLKDERGKIS 66

Query: 66  AIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKK 125
            ++W+G+++++   PE G+E +  GKI+ +   S YQ+++E +  +G G LL  +E+ + 
Sbjct: 67  GVVWRGSVSRLGLAPENGVEIIATGKISAYGERSSYQLVVERMEYAGEGALLARIERLRI 126

Query: 126 KLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDE 185
           +L EEGLF    K  IP +P++I V+TSP GAV+ DI   +  RFP  VI++PV VQG+ 
Sbjct: 127 RLAEEGLFDTACKKAIPLLPRVIGVVTSPQGAVLHDICTTLQRRFPRPVIVWPVPVQGEG 186

Query: 186 CPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIIS 245
               IA AI   + L      PRPD++I+ARGGGS+EDL  FNDE +VRA A  +IP+IS
Sbjct: 187 AAARIAAAIDGFSQLDGQGAVPRPDVLIVARGGGSLEDLMAFNDEAVVRAAAACTIPLIS 246

Query: 246 AIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKIN 305
           A+GHETD TL D+A+D RAPTPT AAEMAVPV+  L + + +  AR    + RL++    
Sbjct: 247 AVGHETDTTLIDFASDRRAPTPTAAAEMAVPVRTELLADIEHRNARALGALSRLLQTARL 306

Query: 306 TLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHN 365
            L+    A+P+    L  +R +LD   R L+  L  ++ R+      I   + +      
Sbjct: 307 RLDRASSAMPDLPSLLQTARMQLDDRGRRLDVALPALVQRRKADLVAIERHMPAV----- 361

Query: 366 IQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLIT 425
                  +  ++  +  +       +    +++ A L  LR                   
Sbjct: 362 ----ETLLAGRRTRLAVLANMLQASMAHTFQKQDARLGRLRISPAP-------------- 403

Query: 426 RIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRI 485
                L   ++   T+++     L++ + +  L RGY  +       +T    L    R+
Sbjct: 404 -----LQALVRERRTALAGIAGQLEAVSPRAVLARGYALVT-AEGRPVTSAEQLRDGERV 457

Query: 486 LINFFDGQANAIVINKAPPKEQ 507
            + F DG   A++ +     +Q
Sbjct: 458 ELTFGDGARPAVIGDGTRQPKQ 479


>gi|218701016|ref|YP_002408645.1| exodeoxyribonuclease VII large subunit [Escherichia coli IAI39]
 gi|226694649|sp|B7NQV5|EX7L_ECO7I RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|218371002|emb|CAR18830.1| exonuclease VII, large subunit [Escherichia coli IAI39]
          Length = 455

 Score =  379 bits (972), Expect = e-103,   Method: Composition-based stats.
 Identities = 142/507 (28%), Positives = 230/507 (45%), Gaps = 57/507 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQYKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANQRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSARQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRAGQQQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +                                          
Sbjct: 356 KIHRAQTRIQQLEYRLAE------------------------------------------ 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +           L++ +  +TL RGY+     +   + Q + +     
Sbjct: 374 -----TLRAQLSATRERFGNAVTHLEAVSPLSTLARGYSVTSAADGAVLKQVKQVKVGET 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTKK 511
           +     DG   + V      ++   K 
Sbjct: 429 LTTRLGDGVVISEVSAVTKSRKPRKKA 455


>gi|301169099|emb|CBW28696.1| exonuclease VII, large subunit [Haemophilus influenzae 10810]
          Length = 439

 Score =  379 bits (972), Expect = e-103,   Method: Composition-based stats.
 Identities = 142/492 (28%), Positives = 235/492 (47%), Gaps = 57/492 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIW 69
           +    YSVS+L+   + ++E N   + + GEIS +     SGH Y +LKD ++++   ++
Sbjct: 1   MSDNIYSVSQLNSAARQMLEGNFCQIWLTGEISNFT-QPVSGHWYLTLKDENAQVRCAMF 59

Query: 70  KGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLE 129
           +    ++ F P+ G++ LV   ++ +     YQ+II+S+ P+G G L    E  K KL  
Sbjct: 60  RMKNLRVAFRPQNGMQVLVRANVSLYEPRGDYQLIIDSMHPAGEGLLQQQFEALKMKLAA 119

Query: 130 EGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPK 188
           EGLF+   K  +P   K + +ITS TGA ++DIL  ++ R P L+V+I+P  VQG E   
Sbjct: 120 EGLFAQNLKKNLPHFSKAVGIITSSTGAALQDILHILARRDPSLKVVIYPTAVQGKEATA 179

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           EI   I   N  +E       D++I+ RGGGS+EDLW FN+E + RAI  S++PIISA+G
Sbjct: 180 EIVQMIELANVRQE------VDVLIVGRGGGSLEDLWCFNEEEVARAIFRSTLPIISAVG 233

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HETD T+AD+ ADLRAPTP+ AAE+    ++ L   L + + RL+    RL   K   L 
Sbjct: 234 HETDVTIADFVADLRAPTPSAAAELVSRNQDELLQQLRHQQQRLDMAFDRLFTRKSQRLK 293

Query: 309 SLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNI 366
            L   L   +    L   + + ++L   L+  +        + F  + +R+K + L + I
Sbjct: 294 QLALRLQNQHPQNQLRAQQAKNEQLTHRLQLAILRQFENTQQKFTALSSRLKQNPLPYRI 353

Query: 367 QKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITR 426
           Q+++QH+ + Q                                                 
Sbjct: 354 QRHQQHLEQLQVR----------------------------------------------- 366

Query: 427 IEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRIL 486
           + F ++ ++      ++     L   +    L RGY+  ++     I   +++     I 
Sbjct: 367 LNFSINRQVTERQNKLATLCGKLDGLSPLKVLARGYSIAENPQGKAIVSVKDVKQGDFIT 426

Query: 487 INFFDGQANAIV 498
               DG+  + V
Sbjct: 427 TQVADGKIVSKV 438


>gi|91211832|ref|YP_541818.1| exodeoxyribonuclease VII large subunit [Escherichia coli UTI89]
 gi|117624736|ref|YP_853649.1| exodeoxyribonuclease VII large subunit [Escherichia coli APEC O1]
 gi|218559433|ref|YP_002392346.1| exodeoxyribonuclease VII large subunit [Escherichia coli S88]
 gi|237705016|ref|ZP_04535497.1| exodeoxyribonuclease VII large subunit [Escherichia sp. 3_2_53FAA]
 gi|122422914|sp|Q1R8M7|EX7L_ECOUT RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|158512548|sp|A1AE45|EX7L_ECOK1 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|226694647|sp|B7MHZ0|EX7L_ECO45 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|91073406|gb|ABE08287.1| exodeoxyribonuclease VII large subunit [Escherichia coli UTI89]
 gi|115513860|gb|ABJ01935.1| exodeoxyribonuclease VII large subunit [Escherichia coli APEC O1]
 gi|218366202|emb|CAR03948.1| exonuclease VII, large subunit [Escherichia coli S88]
 gi|226901382|gb|EEH87641.1| exodeoxyribonuclease VII large subunit [Escherichia sp. 3_2_53FAA]
 gi|294489850|gb|ADE88606.1| exodeoxyribonuclease VII, large subunit [Escherichia coli IHE3034]
 gi|307625938|gb|ADN70242.1| exodeoxyribonuclease VII large subunit [Escherichia coli UM146]
 gi|315288086|gb|EFU47486.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 110-3]
 gi|323949166|gb|EGB45057.1| exodeoxyribonuclease VII [Escherichia coli H252]
 gi|323955747|gb|EGB51505.1| exodeoxyribonuclease VII [Escherichia coli H263]
          Length = 458

 Score =  379 bits (972), Expect = e-103,   Method: Composition-based stats.
 Identities = 141/510 (27%), Positives = 229/510 (44%), Gaps = 57/510 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQLKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+K  +P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDLQYKKSLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IPI+SA
Sbjct: 182 PGQIVRAIELANQRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPIVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSTHQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  ++       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALESQLKRAGQQQQRLTRQLVQQNPQS 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +                                          
Sbjct: 356 RIHRAQTRIQQLEYRLAE------------------------------------------ 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +           L++ +  +TL RGY+     +   + Q + +     
Sbjct: 374 -----TLRAQLSATRERFGNAVTHLEAVSPLSTLARGYSVTSAADGAVLKQVKQVKVGET 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTKKCQL 514
           +     DG   + V      ++   K    
Sbjct: 429 LTTRLGDGVVISEVSAVTKTRKSRKKTSNP 458


>gi|147675003|ref|YP_001216251.1| exodeoxyribonuclease VII large subunit [Vibrio cholerae O395]
 gi|262168786|ref|ZP_06036481.1| exodeoxyribonuclease VII large subunit [Vibrio cholerae RC27]
 gi|172047437|sp|A5F3E9|EX7L_VIBC3 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|146316886|gb|ABQ21425.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae O395]
 gi|227012590|gb|ACP08800.1| exodeoxyribonuclease VII, large subunit [Vibrio cholerae O395]
 gi|262022904|gb|EEY41610.1| exodeoxyribonuclease VII large subunit [Vibrio cholerae RC27]
          Length = 446

 Score =  379 bits (972), Expect = e-103,   Method: Composition-based stats.
 Identities = 143/496 (28%), Positives = 242/496 (48%), Gaps = 57/496 (11%)

Query: 6   QKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRID 65
             +  +   Y+VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++ 
Sbjct: 2   SSSLANRNIYTVSRLNSEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSQAQVK 60

Query: 66  AIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKK 125
             ++KG    + F P+ G + LV  +++ +     YQII+ES+ P G G L    E+ K 
Sbjct: 61  CAMFKGNNRLVNFKPQNGQQVLVKARLSLYEPRGDYQIILESMQPEGDGRLQQQFEQLKM 120

Query: 126 KLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGD 184
           +L  EGLF+   K P+P  P+ + +ITS TGA + DIL  +  R P L V+I+P  VQG+
Sbjct: 121 QLAAEGLFAQTRKKPLPENPRCVGIITSRTGAALHDILHVLKRRDPNLPVVIYPTLVQGE 180

Query: 185 ECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPII 244
           E   +IA AI + NT  E       D++I+ RGGGS+EDLW FN E++ R IA S IPII
Sbjct: 181 EAAIQIAQAIGRANTRAE------CDVLIVGRGGGSLEDLWCFNHEIVARTIAASEIPII 234

Query: 245 SAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKI 304
           SA+GHE D T+AD+ AD+RAPTP+ AAE+      H Q +L   +A+L + +   +  + 
Sbjct: 235 SAVGHEIDVTIADFVADVRAPTPSAAAELVSRDHRHKQQALHQWQAKLASTMRHYLAQQE 294

Query: 305 NTLNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFL 362
                L   L   +    L   + +LD L   LE  ++  +  + + ++ + ++I+    
Sbjct: 295 TQFARLQHKLDKQHPQARLERQQQQLDELSLRLEQKMQQRLATQQQRWDRLSHKIELHSP 354

Query: 363 IHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKK 422
           IH I++ R ++++++Q I Q                                        
Sbjct: 355 IHLIRQQRFNLIQQEQRINQ---------------------------------------- 374

Query: 423 LITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATK 482
                   +   +      +++ +  L + +    L RGY+  + T    + Q   +   
Sbjct: 375 -------SIQRYLIQSRHQLALLSEKLDAVSPLAALARGYSVTRTTQGELVRQSAQVKPG 427

Query: 483 TRILINFFDGQANAIV 498
             ++    DG+  + V
Sbjct: 428 DTLVTQLMDGEILSTV 443


>gi|240850521|ref|YP_002971920.1| exodeoxyribonuclease VII large subunit [Bartonella grahamii as4aup]
 gi|240267644|gb|ACS51232.1| exodeoxyribonuclease VII large subunit [Bartonella grahamii as4aup]
          Length = 476

 Score =  379 bits (972), Expect = e-103,   Method: Composition-based stats.
 Identities = 208/530 (39%), Positives = 305/530 (57%), Gaps = 56/530 (10%)

Query: 1   MNPFSQKNS-LDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKD 59
           ++ FS+K    +  E++VSE++  LK +VE    +V VRGEISGYRG H+SGHAYF+LKD
Sbjct: 2   VSLFSEKTGVTNVAEFTVSEIAGALKRVVEEKFGYVRVRGEISGYRGTHASGHAYFALKD 61

Query: 60  NHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTA 119
           + +R++A+IW+G + K++F PEEG+E + +GK+TT+PGSSKYQI+IE+L P+G G L+T 
Sbjct: 62  DKARLEAVIWRGVMEKLKFPPEEGMEVVAVGKLTTYPGSSKYQIVIEALEPTGVGALMTL 121

Query: 120 LEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPV 179
           LE RKKK +EEGLF +  K P+P++P+II V+TSPTGAVIRDI+ RIS RFPL ++++PV
Sbjct: 122 LENRKKKFVEEGLFDEAKKKPLPYMPRIIGVVTSPTGAVIRDIIHRISDRFPLHILVWPV 181

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
           +VQG+   +E+A A+   N L  G   P+PD+II+ARGGGS+EDLW FNDE +VRA+  S
Sbjct: 182 RVQGETSGREVAVAVEGFNALAPGGFIPKPDLIIVARGGGSLEDLWGFNDEAVVRAVYAS 241

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
           ++P+ISA+GHETDWTL DY AD RAPTPTGAAE AVPVK  L+  + +L ARL   ++R 
Sbjct: 242 ALPVISAVGHETDWTLIDYVADWRAPTPTGAAEKAVPVKLDLEVCVASLGARLRKGLVRS 301

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
             +    L +  + LP  DQ  +  R   D +   L+  L +   +K   F     R++ 
Sbjct: 302 FDFHQQKLRAARRGLPTVDQLFALPRRGFDEISNRLQRALCVSYDKKCFSF--HTLRLRL 359

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH 419
              + N +K +++  E    + +                                     
Sbjct: 360 SLRLLNSEKAQRNTKEYTARLHR------------------------------------- 382

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
                          ++     + +  R+L+S +Y+N L+RG+      +N  I +    
Sbjct: 383 ----------AFVRSVEKQRAQMELAFRLLKSTSYQNILERGFVLALGQDNKPIKRLIQF 432

Query: 480 ATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
               +I + FFDG  +  +      K    K+ +L          QG LF
Sbjct: 433 PDTGQISLRFFDGDISVAIQEPVFSKRSKHKQIKL------PSDDQGTLF 476


>gi|325496461|gb|EGC94320.1| exodeoxyribonuclease VII large subunit [Escherichia fergusonii
           ECD227]
          Length = 455

 Score =  379 bits (972), Expect = e-103,   Method: Composition-based stats.
 Identities = 144/506 (28%), Positives = 232/506 (45%), Gaps = 57/506 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+++++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDNAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRASITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q KNP+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQFKNPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANLRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSTRQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTTLERLQKRMSFALENQLKRAGQQQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +                                          
Sbjct: 356 KIHRAQTRIQQLEYRLAE------------------------------------------ 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +       T   L++ +  +TL RGY+     +   + Q + +     
Sbjct: 374 -----TLRAQLSATRERFGNTVTHLEAVSPLSTLARGYSVTSAADGAVLKQVKQVKVGET 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTK 510
           +     DG   + V      ++   K
Sbjct: 429 LTTRLGDGVVISEVSAVTKSRKPRKK 454


>gi|324113000|gb|EGC06976.1| exodeoxyribonuclease VII [Escherichia fergusonii B253]
          Length = 455

 Score =  379 bits (972), Expect = e-103,   Method: Composition-based stats.
 Identities = 144/506 (28%), Positives = 232/506 (45%), Gaps = 57/506 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+++++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDNAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q KNP+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQFKNPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANLRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSTRQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTTLERLQKRMSFALENQLKRAGQQQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +                                          
Sbjct: 356 KIHRAQTRIQQLEYRLAE------------------------------------------ 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +       T   L++ +  +TL RGY+     +   + Q + +     
Sbjct: 374 -----TLRAQLSATRERFGNTVTHLEAVSPLSTLARGYSVTSAADGAVLKQVKQVKVGET 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTK 510
           +     DG   + V      ++   K
Sbjct: 429 LTTRLGDGVVISEVSAVTKSRKPRKK 454


>gi|89055791|ref|YP_511242.1| exodeoxyribonuclease VII large subunit [Jannaschia sp. CCS1]
 gi|88865340|gb|ABD56217.1| Exodeoxyribonuclease VII large subunit [Jannaschia sp. CCS1]
          Length = 519

 Score =  379 bits (972), Expect = e-103,   Method: Composition-based stats.
 Identities = 193/528 (36%), Positives = 290/528 (54%), Gaps = 11/528 (2%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           +    + + + PE++VSE+S  +K  VE   +HV VRGE+ G   +  SGH Y  LKD+ 
Sbjct: 3   DLIDDEGTGNSPEFTVSEISGAVKRTVEGAFAHVRVRGEV-GRLSLPRSGHIYLDLKDDR 61

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           S + +++WKG  N++   PEEG+E +  G++TTFPG SKYQ++I+ L P+G+G L+  LE
Sbjct: 62  SVLASVVWKGVANRLTHRPEEGMEVIATGRLTTFPGQSKYQLVIDDLQPAGAGALMAMLE 121

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           KR+K L  EGLF D  K P+PF+P++I V+TSP+GAVIRDIL R+  RFP +V+I+PV V
Sbjct: 122 KRRKALAAEGLFDDARKQPLPFLPEVIGVVTSPSGAVIRDILHRLRDRFPRKVLIWPVAV 181

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QG +C  ++ANAI   N L  G   PRPD++I+ARGGGS+EDLW FN+E +VRA A+S+I
Sbjct: 182 QGAKCGPDVANAIRGFNALTPGGALPRPDLLIVARGGGSLEDLWGFNEEEVVRATADSTI 241

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETD TL DYA+D RAPTPTGAAE AVPV+  + + L   E  L   +   + 
Sbjct: 242 PLISAVGHETDTTLIDYASDYRAPTPTGAAEKAVPVRMDMLNWLRQQEGILTRAMTGALT 301

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
            +   L  L +ALP SD  +  +R RLD     L   L           + +  R+    
Sbjct: 302 MRAQRLADLSRALPRSDALMEPARQRLDLAGLRLAPALASRTKDARAQLDRLAARLDP-A 360

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIK 421
           L   + + R  + E+   +      ++        +++ +  +  ++   R   +   + 
Sbjct: 361 LDRAVARKRLALGERAAGLTPARLANVVRQGRRDLDRLTV-RLDPQRLTARTSKMEERLG 419

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLAT 481
           +   R     +  ++    ++    R+ ++  Y  TL RGY  I+   +  +T K   + 
Sbjct: 420 QARARFAQAANLSVRKRREALDSLDRLRRTLGYTETLGRGYAVIRAGED-VLTSKAAASA 478

Query: 482 KTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
              + I F DG+               T K      K +    QG LF
Sbjct: 479 HAAMEIQFSDGRLGVTPTG-------ATPKAVKKAPKAKLPKDQGSLF 519


>gi|59711243|ref|YP_204019.1| exodeoxyribonuclease VII large subunit [Vibrio fischeri ES114]
 gi|81311004|sp|Q5E765|EX7L_VIBF1 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|59479344|gb|AAW85131.1| exonuclease VII, large subunit [Vibrio fischeri ES114]
          Length = 449

 Score =  378 bits (971), Expect = e-103,   Method: Composition-based stats.
 Identities = 137/496 (27%), Positives = 238/496 (47%), Gaps = 57/496 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIW 69
            +   ++VS L+  ++ ++E+ +  V + GEIS       SGH Y +LKD+ +++   ++
Sbjct: 5   SNPRIFTVSRLNAEVRLLLENEMGIVWLVGEISNLTV-PVSGHWYLTLKDSQAQVKCAMF 63

Query: 70  KGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLE 129
           KG   ++ F P+ G + LV  +++ +     YQ+IIES+ P G G L    ++ K  L  
Sbjct: 64  KGNNRRVNFKPQNGKQVLVKARLSLYEPRGDYQLIIESMQPEGDGRLQQEFDQLKMSLAA 123

Query: 130 EGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPK 188
           EGLF+   K  +P  PK + +ITS TGA + DIL  +  R P L ++I+P  VQG     
Sbjct: 124 EGLFAQTAKKSLPEQPKRVGIITSQTGAALFDILHVLKRRDPNLPIVIYPTMVQGSGAAI 183

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           +IA AI + N+  E       DI+I+ RGGGS+EDLW FN+E++ R IA S IPI+SA+G
Sbjct: 184 QIAQAIGRANSRNE------CDILIVGRGGGSLEDLWCFNEEIVARTIAASEIPIVSAVG 237

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HE D T+AD+ AD+RAPTP+ AAE+          ++ + + RLN+ + R + ++  +L+
Sbjct: 238 HEIDVTIADFVADVRAPTPSAAAELVSRDLSAQLQTVAHQKRRLNSAMERYLSHQQRSLS 297

Query: 309 SLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNI 366
           +    +   +    L+    RLD L + L ++++  + R+     ++  R+ +      I
Sbjct: 298 AYQHRIEKQHPQMQLNNQSQRLDDLNQRLMNHIQQRLQRQQYRVENLTLRLNNLSPTKRI 357

Query: 367 QKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITR 426
            +++ HI E ++ +                                              
Sbjct: 358 SQDKLHIEELKRRLL--------------------------------------------- 372

Query: 427 IEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRIL 486
               +   +      +++    L + +   TL RGY+   + +   IT  + +     I 
Sbjct: 373 --DSMDRNLLMQRHQLALAAEKLDTVSPLATLMRGYSITHNQDGKIITSTKQVELGDNIT 430

Query: 487 INFFDGQANAIVINKA 502
             F DG   + V   +
Sbjct: 431 TRFADGDITSTVTKAS 446


>gi|91225132|ref|ZP_01260354.1| exodeoxyribonuclease VII large subunit [Vibrio alginolyticus 12G01]
 gi|91190075|gb|EAS76346.1| exodeoxyribonuclease VII large subunit [Vibrio alginolyticus 12G01]
          Length = 443

 Score =  378 bits (971), Expect = e-102,   Method: Composition-based stats.
 Identities = 139/492 (28%), Positives = 235/492 (47%), Gaps = 57/492 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIW 69
            +   ++VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++   ++
Sbjct: 5   TNQNIFTVSRLNAEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSRAQVKCAMF 63

Query: 70  KGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLE 129
           +G   ++ F P  G + LV  +++ +     YQ+IIES+ P G G L    E+ K KL  
Sbjct: 64  RGNNRRVTFKPANGNQVLVKARLSLYEPRGDYQLIIESMQPEGDGRLQQEFEELKMKLAA 123

Query: 130 EGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPK 188
           EGLF+  +K P+P  PK + VITS TGA + DIL  +  R P L V+I+P  VQG++   
Sbjct: 124 EGLFAQTNKQPLPEHPKRVGVITSKTGAALYDILDVLKRRDPSLPVVIYPTVVQGEDAAI 183

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           +IA AI + N+  E       D++I+ RGGGS+EDLW FN+E++ R IA S IPIISA+G
Sbjct: 184 QIAQAIGRANSRDE------CDVLIVGRGGGSLEDLWCFNNEILARTIAASQIPIISAVG 237

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HE D T+AD+ AD+RAPTP+ AAE+      H   +L+  + +L + +   +  +     
Sbjct: 238 HEVDVTIADFVADVRAPTPSAAAELVSRDNSHKDQALVTRQHKLASAMRYYLAQQKQQSA 297

Query: 309 SLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNI 366
            L+  L   +    L     +LD L   L+  +   I  + +       R++ +  +  +
Sbjct: 298 QLVHRLERQHPSYRLQRQTQQLDELDMRLQRAMSRFIALRQQRIERQHYRLQLNSPVTRL 357

Query: 367 QKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITR 426
            + +  +   +Q +                                              
Sbjct: 358 AEQKSKLERVEQKL---------------------------------------------- 371

Query: 427 IEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRIL 486
               +  K+ +    ++I    L + +   TLKRGY+  Q      ITQ  ++ +   ++
Sbjct: 372 -MDAMDRKLLTMRHQLAIAAEKLDTVSPLATLKRGYSITQTEQGKVITQSSDVKSGDVLI 430

Query: 487 INFFDGQANAIV 498
               +G   + V
Sbjct: 431 TRLAEGDVRSTV 442


>gi|315300488|gb|EFU59717.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 16-3]
          Length = 458

 Score =  378 bits (971), Expect = e-102,   Method: Composition-based stats.
 Identities = 141/510 (27%), Positives = 230/510 (45%), Gaps = 57/510 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+K  +P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDLQYKKSLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IPI+SA
Sbjct: 182 PGQIVRAIELANKRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPIVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSTHQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  ++       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRAGQQQQRLTRQLVQQNPQS 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +                                          
Sbjct: 356 RIHRAQTRIQQLEYRLAE------------------------------------------ 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +           L++ +  +TL RGY+     +   + Q + +     
Sbjct: 374 -----TLRAQLSATRERFGNAVTHLEAVSPLSTLARGYSVTSAADGAVLKQVKQVKVGET 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTKKCQL 514
           ++    DG   + V      ++   K    
Sbjct: 429 LITRLGDGVVISEVSAVTKTRKSRKKTSNP 458


>gi|229844440|ref|ZP_04464580.1| exodeoxyribonuclease VII large subunit [Haemophilus influenzae
           6P18H1]
 gi|229812689|gb|EEP48378.1| exodeoxyribonuclease VII large subunit [Haemophilus influenzae
           6P18H1]
          Length = 439

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 140/492 (28%), Positives = 234/492 (47%), Gaps = 57/492 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIW 69
           + +  YSVS+L+   + I+E N   + + GEIS +     SGH Y +LKD ++++   ++
Sbjct: 1   MSNNIYSVSQLNSAARQILEGNFCQIWLTGEISNFT-QPVSGHWYLTLKDENAQVRCAMF 59

Query: 70  KGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLE 129
           +    ++ F P+ G++ LV   ++ +     YQ+II+S+ P+G G L    E  K KL  
Sbjct: 60  RMKNLRVAFRPQNGMQVLVRANVSLYEPRGDYQLIIDSMHPAGEGLLQQQFEALKMKLAA 119

Query: 130 EGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPK 188
           EGLF+   K  +P   K + +ITS TGA ++DIL  ++ R P L+V+I+P  VQG E   
Sbjct: 120 EGLFAQNLKKNLPHFSKAVGIITSSTGAALQDILHILARRDPSLKVVIYPTAVQGKEATA 179

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           EI   I   N  +E       D++I+ RGGGS+EDLW FN+E + RAI  S++PIISA+G
Sbjct: 180 EIVQMIELANVRQE------VDVLIVGRGGGSLEDLWCFNEEEVARAIFRSTLPIISAVG 233

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HETD T+AD+ ADLRAPTP+ AAE+    ++ L   L + + RL+    RL   K   L 
Sbjct: 234 HETDVTIADFVADLRAPTPSAAAELVSRNQDELLQQLRHQQQRLDMAFDRLFTRKSQRLK 293

Query: 309 SLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNI 366
            L   L   +    L   + + ++L   L+  +        + F  +  R+K + L + +
Sbjct: 294 QLALRLHNQHPQNQLRAQQAKNEQLTHRLQLAMLRQFENTQQKFTALSVRLKQNPLPYQV 353

Query: 367 QKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITR 426
           Q+++Q + + +                                                 
Sbjct: 354 QRHQQRLEQLKVR----------------------------------------------- 366

Query: 427 IEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRIL 486
           + F ++ ++      ++     L   +    L RGY+  ++     I   +++     I 
Sbjct: 367 LNFCVNRQVTERQNKLATLCGKLDGLSPLKVLARGYSIAENPQGKAIVSVKDVKQGDFIT 426

Query: 487 INFFDGQANAIV 498
               DG+  + V
Sbjct: 427 TQVADGKIVSKV 438


>gi|262395111|ref|YP_003286965.1| exodeoxyribonuclease VII large subunit [Vibrio sp. Ex25]
 gi|262338705|gb|ACY52500.1| exodeoxyribonuclease VII large subunit [Vibrio sp. Ex25]
          Length = 443

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 139/492 (28%), Positives = 235/492 (47%), Gaps = 57/492 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIW 69
            +   ++VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++   ++
Sbjct: 5   TNQNIFTVSRLNAEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSRAQVKCAMF 63

Query: 70  KGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLE 129
           +G   ++ F P  G + LV  +++ +     YQ+IIES+ P G G L    E+ K KL  
Sbjct: 64  RGNNRRVTFKPTNGNQVLVKARLSLYEPRGDYQLIIESMQPEGDGRLQQEFEELKMKLAA 123

Query: 130 EGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPK 188
           EGLF+  +K P+P  PK + VITS TGA + DIL  +  R P L V+I+P  VQG++   
Sbjct: 124 EGLFAQTNKQPLPEHPKRVGVITSKTGAALYDILDVLKRRDPSLPVVIYPTVVQGEDAAI 183

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           +IA AI + N+  E       D++I+ RGGGS+EDLW FN+E++ R IA S IPIISA+G
Sbjct: 184 QIAQAIGRANSRDE------CDVLIVGRGGGSLEDLWCFNNEILARTIAASQIPIISAVG 237

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HE D T+AD+ AD+RAPTP+ AAE+      H   +L+  + +L + +   +  +     
Sbjct: 238 HEVDVTIADFVADVRAPTPSAAAELVSRDNSHKDQALVTRQHKLASAMRYYLAQQKQQSA 297

Query: 309 SLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNI 366
            L+  L   +    L     +LD L   L+  +   I  + +       R++ +  +  +
Sbjct: 298 QLVHRLERQHPSYRLQRQTQQLDELDMRLQRAMSRFIALRQQRIERQHYRLQLNSPVTRL 357

Query: 367 QKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITR 426
            + +  +   +Q +                                              
Sbjct: 358 AEQKSKLERVEQKL---------------------------------------------- 371

Query: 427 IEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRIL 486
               +  K+ +    ++I    L + +   TLKRGY+  Q      ITQ  ++ +   ++
Sbjct: 372 -MDAMDRKLLTMRHQLAIAAEKLDTVSPLATLKRGYSITQTEQGKVITQSSDVKSGDVLI 430

Query: 487 INFFDGQANAIV 498
               +G   + V
Sbjct: 431 TRLAEGDVRSTV 442


>gi|319403786|emb|CBI77370.1| exodeoxyribonuclease VII large subunit [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 477

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 208/530 (39%), Positives = 303/530 (57%), Gaps = 54/530 (10%)

Query: 1   MNPFSQKN-SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKD 59
           M+ F +K+ + +  E+SVSE++  LK IVE    +V VRGEISGYRG+H+SGHAYF+LKD
Sbjct: 1   MDLFLEKSVATNAAEFSVSEIAGALKRIVEEKFGYVRVRGEISGYRGVHASGHAYFALKD 60

Query: 60  NHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTA 119
           + +R++A+IW+G + K++F PEEG+E + +GK+TT+ GSSKYQIII+SL P+G G L+T 
Sbjct: 61  DKARLEAVIWRGVIEKLQFPPEEGMEVVAVGKLTTYQGSSKYQIIIDSLEPTGVGALMTL 120

Query: 120 LEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPV 179
           LE RKKK  +EGLF +  K  +P++P++I V+TSPTGAVIRDI+ RIS RFPL + ++PV
Sbjct: 121 LENRKKKFADEGLFDEAKKKKLPYMPRVIGVVTSPTGAVIRDIIHRISDRFPLHIFVWPV 180

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
           +VQG+   +E+A AI   N L       +PD+II+ARGGGS+EDLW FNDE +VRA++ S
Sbjct: 181 RVQGETSGQEVAAAIAGFNALPLESAISKPDLIIVARGGGSLEDLWGFNDEAVVRAVSVS 240

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
           +IPIISA+GHETDWTL DY AD RAPTPTGAAE AVPVK  L++ L +L  R      R 
Sbjct: 241 AIPIISAVGHETDWTLIDYVADWRAPTPTGAAEKAVPVKFDLETHLASLSLRFRVGAARY 300

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
             +    L+++++ LP +DQ  +  R   D +   L+  L +   +K  +F  ++ R+  
Sbjct: 301 FSFYKQKLSTVVRGLPTADQLFALPRRSFDEISSRLQRALCVNYDKKRFYFYTLVIRLSP 360

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH 419
             L  N +K +Q+  E    +                                       
Sbjct: 361 RLL--NTKKAQQNTKEYTVRLHHAFL---------------------------------- 384

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
                          ++     + +  R+L+S +Y++ L+RG+       N  I +    
Sbjct: 385 -------------RNVEKKRAQIKMAFRLLKSTSYQSILERGFVLALGQENKPIKRLAQF 431

Query: 480 ATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
               +I + FFDG+ N    N        +        K+ +   QG LF
Sbjct: 432 PKTGQISLRFFDGEINVSTCN----SVSKSVPKPKKRLKQWQDDDQGTLF 477


>gi|300940244|ref|ZP_07154842.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 21-1]
 gi|300454940|gb|EFK18433.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 21-1]
          Length = 455

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 142/507 (28%), Positives = 229/507 (45%), Gaps = 57/507 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQLKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANQRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSARQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRAGQQQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +                                          
Sbjct: 356 KIHRAQTRIQQLEYRLAE------------------------------------------ 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +           L++ +  +TL RGY+     +   + Q + +     
Sbjct: 374 -----TLRAQLSATRERFGNAVTHLEAVSPLSTLARGYSVTSAADGAVLKQVKQVKVGET 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTKK 511
           +     DG   + V      ++   K 
Sbjct: 429 LTTRLGDGVVISEVSAVTKSRKPRKKA 455


>gi|161612734|ref|YP_001586699.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|189037842|sp|A9N216|EX7L_SALPB RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|161362098|gb|ABX65866.1| hypothetical protein SPAB_00433 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 449

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 143/499 (28%), Positives = 228/499 (45%), Gaps = 57/499 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           +S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   SSQTSSIFTVSRLNQTVRLLLEQEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIAESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  QHK P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQHKQPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  + IP++SA
Sbjct: 182 PGQIVRAIELANARGE------CDVLIIGRGGGSLEDLWSFNDERVARAIFANRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + + + RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEIVSRNQQELLRQIQSAQQRLGMAMDYYLANRSRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  I +  +    +  R+       
Sbjct: 296 FTQIFHRLQQQHPQLRLARQQTALERLRQRMGFALEARIKQATQRQQRVSQRLSQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +                                               
Sbjct: 356 RIHRAQSRIQQLEYR--------------------------------------------- 370

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
             +   +  ++             L++ +   TL RGYT    TN   + + + +     
Sbjct: 371 --LTENIRSRLSEQRERFGNAVTHLEAVSPLATLARGYTVSTTTNGKVLKKIKQVKAGDI 428

Query: 485 ILINFFDGQANAIVINKAP 503
           +     DG   + V +  P
Sbjct: 429 MTTRLEDGWLESEVKSVTP 447


>gi|309972444|gb|ADO95645.1| Exodeoxyribonuclease VII, large subunit [Haemophilus influenzae
           R2846]
          Length = 439

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 141/492 (28%), Positives = 234/492 (47%), Gaps = 57/492 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIW 69
           +    YSVS+L+   + ++E N S + + GEIS +     SGH Y +LKD ++++   ++
Sbjct: 1   MSDNIYSVSQLNSAARQMLEGNFSQIWLTGEISNFT-QPVSGHWYLTLKDENAQVRCAMF 59

Query: 70  KGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLE 129
           +    ++ F P+ G++ LV   ++ +     YQ+II+S+ P+G G L    E  K KL  
Sbjct: 60  RMKNLRVAFRPQNGMQVLVRANVSLYEPRGDYQLIIDSMHPAGEGLLQQQFEALKMKLAA 119

Query: 130 EGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPK 188
           EGLF+   K  +P   K + +ITS TGA ++DIL  ++ R P L+V+I+P  VQG E   
Sbjct: 120 EGLFAQNLKKNLPHFSKAVGIITSSTGAALQDILHILARRDPSLKVVIYPTAVQGKEATA 179

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           EI   I   N  +E       D++I+ RGGGS+EDLW FN+E + RAI  S++PIISA+G
Sbjct: 180 EIVQMIELANVRQE------VDVLIVGRGGGSLEDLWCFNEEEVARAIFRSTLPIISAVG 233

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HETD T+AD+ ADLRAPTP+ AAE+    ++ L   L + + RL+    RL   K   L 
Sbjct: 234 HETDVTIADFVADLRAPTPSAAAELVSRNQDELLQQLRHQQQRLDMAFDRLFTRKSQRLK 293

Query: 309 SLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNI 366
            L   L   +    L   + +  +L   L+  +        + F  + +R+K + L + +
Sbjct: 294 QLTLRLYNQHPQNQLRAQQAKNAQLTHRLQLAMLRQFENTQQKFTALSSRLKQNPLPYRV 353

Query: 367 QKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITR 426
           Q+++Q + + Q                                                 
Sbjct: 354 QRHQQRLEQLQVR----------------------------------------------- 366

Query: 427 IEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRIL 486
           + F ++ ++      ++     L   +    L RGY+  ++     I   +++     I 
Sbjct: 367 LNFCVNRQVTERQNKLATLCGKLDGLSPLKVLARGYSIAENPQGKAIVSVKDVNQGDLIT 426

Query: 487 INFFDGQANAIV 498
               DG+  + V
Sbjct: 427 TQVADGKIMSKV 438


>gi|145636335|ref|ZP_01792004.1| exodeoxyribonuclease VII large subunit [Haemophilus influenzae
           PittHH]
 gi|145270500|gb|EDK10434.1| exodeoxyribonuclease VII large subunit [Haemophilus influenzae
           PittHH]
          Length = 442

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 144/494 (29%), Positives = 238/494 (48%), Gaps = 57/494 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           N++    YSVS+L+   + I+E + S + + GEIS +     SGH Y +LKD ++++   
Sbjct: 2   NNMSDNIYSVSQLNSAARQILEGHFSQIWLTGEISNFT-QPVSGHWYLTLKDENAQVRCA 60

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++    ++ F P+ G++ LV   ++ +     YQ+II+S+ P+G G L    E  K KL
Sbjct: 61  MFRMKNLRVAFRPQNGMQVLVRANVSLYEPRGDYQLIIDSMHPAGEGLLQQQFEALKMKL 120

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF+   K  +P   K + +ITS TGA ++DIL  ++ R P L+V+I+P  VQG E 
Sbjct: 121 ATEGLFAQNLKKNLPHFSKAVGIITSSTGAALQDILHILARRDPSLKVVIYPTAVQGKEA 180

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
             EI   I   N  +E       D++I+ RGGGS+EDLW FN+E + RAI  S++PIISA
Sbjct: 181 TAEIVQMIELANLRQE------VDVLIVGRGGGSLEDLWCFNEEEVARAIFRSTLPIISA 234

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   L + + RL+    RL   K   
Sbjct: 235 VGHETDVTIADFVADLRAPTPSAAAELVSRNQDELLQQLRHQQQRLDMAFDRLFTRKSQR 294

Query: 307 LNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
           L  L+  L   +    L   + + ++L   L+  +        + F  +  R+K + L +
Sbjct: 295 LKQLILRLQNQHPQNQLRAQQAKNEQLAHRLQLAMLRQFENTQQKFTALSVRLKQNPLPY 354

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            IQ+++QH+ + Q                                               
Sbjct: 355 RIQRHQQHLEQLQVR--------------------------------------------- 369

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
             + F ++ ++      ++     L   +    L RGY+  ++     I   +++     
Sbjct: 370 --LNFCVNRQVTERQNKLATLCGKLDGLSPLKVLARGYSIAENLQGKAIVSVKDVNQGDL 427

Query: 485 ILINFFDGQANAIV 498
           I     DG+  + V
Sbjct: 428 ITTQVADGKIVSKV 441


>gi|110642671|ref|YP_670401.1| exodeoxyribonuclease VII large subunit [Escherichia coli 536]
 gi|300998062|ref|ZP_07181922.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 200-1]
 gi|123343752|sp|Q0TEX9|EX7L_ECOL5 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|110344263|gb|ABG70500.1| exodeoxyribonuclease VII large subunit [Escherichia coli 536]
 gi|300304041|gb|EFJ58561.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 200-1]
 gi|324011222|gb|EGB80441.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 60-1]
          Length = 458

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 140/510 (27%), Positives = 230/510 (45%), Gaps = 57/510 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+K  +P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQYKKTLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANQRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASLIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + + + RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSAQQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  ++       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRAGQQQQRLTRQLVQQNPQS 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +                                          
Sbjct: 356 RIHRAQTRIQQLEYRLAE------------------------------------------ 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +           L++ +  +TL RGY+     +   + Q + +     
Sbjct: 374 -----TLRAQLSATRERFGNAVTHLEAVSPLSTLARGYSVTSAADGALLKQVKQVKVGET 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTKKCQL 514
           +     DG   + V      ++   K    
Sbjct: 429 LTTRLGDGVVISEVSAVTKTRKSRKKTSNP 458


>gi|218548057|ref|YP_002381848.1| exodeoxyribonuclease VII large subunit [Escherichia fergusonii ATCC
           35469]
 gi|226696187|sp|B7LKD2|EX7L_ESCF3 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|218355598|emb|CAQ88209.1| exonuclease VII, large subunit [Escherichia fergusonii ATCC 35469]
          Length = 455

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 140/506 (27%), Positives = 230/506 (45%), Gaps = 57/506 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+++++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDNAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q K  +P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQLKKTLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + R I  S IP++SA
Sbjct: 182 PGQIVRAIELANLRNE------CDVLIVGRGGGSLEDLWSFNDERVARGIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + + + RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSAQQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTTLERLQKRMSFALENQLKRAGQQQQRLTLRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  + + +  + +                                          
Sbjct: 356 KIHRAQTRVQQLEYRLAE------------------------------------------ 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +       T   L++ +  +TL RGY+     +   + Q + +     
Sbjct: 374 -----NLRAQLSAMRERFGNTVTHLEAVSPLSTLARGYSVTSAADGAVLKQVKQVKVGET 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTK 510
           +     DG   + V      ++   K
Sbjct: 429 LTTRLGDGVVISEVSAVTKSRKPRKK 454


>gi|323977312|gb|EGB72398.1| exodeoxyribonuclease VII [Escherichia coli TW10509]
          Length = 455

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 143/506 (28%), Positives = 233/506 (46%), Gaps = 57/506 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+++++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDNAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q KNP+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQFKNPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANLRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + + + RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSAQQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTTLERLQKRMSFALENQLKRAGQQQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +                                          
Sbjct: 356 KIHRAQTRIQQLEYRLAE------------------------------------------ 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +       T   L++ +  +TL RGY+     +   + Q + +     
Sbjct: 374 -----TLRAQLSATRERFGNTVTHLEAVSPLSTLARGYSVTSAADGAVLKQVKQVKVGET 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTK 510
           +     DG   + V      ++   +
Sbjct: 429 LTTRLGDGVVISEVSAVTKSRKPRKR 454


>gi|167549470|ref|ZP_02343229.1| exodeoxyribonuclease VII, large subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205325347|gb|EDZ13186.1| exodeoxyribonuclease VII, large subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
          Length = 449

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 144/499 (28%), Positives = 227/499 (45%), Gaps = 57/499 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           +S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   SSQTSSIFTVSRLNQTVRLLLEQEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII ES+ P G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIAESMQPVGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  QHK P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQHKQPLPSPAHGVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANARGE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + + + RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEIVSRNQQELLRQIQSAQQRLGMAMDYYLANRSRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  I +  +    +  R+       
Sbjct: 296 FTQIFHRLQQQHPQLRLARQQTALERLRQRMGFALEARIKQANQRQQRVSQRLSQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +                                               
Sbjct: 356 RIHRAQSRIQQLEYR--------------------------------------------- 370

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
             +   +  ++             L++ +   TL RGYT    TN   + + + +     
Sbjct: 371 --MTENIRSRLSEQRERFGNAVTHLEAVSPLATLARGYTVSTTTNGKVLKKIKQVKAGDI 428

Query: 485 ILINFFDGQANAIVINKAP 503
           +     DG   + V +  P
Sbjct: 429 MTTRLEDGWLESEVKSVTP 447


>gi|229846484|ref|ZP_04466592.1| exodeoxyribonuclease VII large subunit [Haemophilus influenzae
           7P49H1]
 gi|229810577|gb|EEP46295.1| exodeoxyribonuclease VII large subunit [Haemophilus influenzae
           7P49H1]
          Length = 442

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 143/494 (28%), Positives = 236/494 (47%), Gaps = 57/494 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           N++    YSVS+L+   + I+E + S + + GEIS +     SGH Y +LKD ++++   
Sbjct: 2   NNMSDNIYSVSQLNSATRQILEGHFSQIWLTGEISNFT-QPVSGHWYLTLKDENAQVRCA 60

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++    ++ F P+ G++ LV   ++ +     YQ+II+S+ P+G G L    E  K KL
Sbjct: 61  MFRMKNLRVAFRPQNGMQVLVRANVSLYEPRGDYQLIIDSMHPAGEGLLQQQFEALKMKL 120

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF+   K  +P   K + +ITS TGA ++DIL  ++ R P L+V+I+P  VQG E 
Sbjct: 121 AAEGLFAQNLKKNLPHFSKAVGLITSSTGAALQDILHILARRDPSLKVVIYPTAVQGKEA 180

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
             EI   I   N  +E       D++I+ RGGGS+EDLW FN+E + RAI  S++PIISA
Sbjct: 181 TAEIVQMIELANARQE------VDVLIVGRGGGSLEDLWCFNEEEVARAIFRSTLPIISA 234

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   L + + RL+    RL   K   
Sbjct: 235 VGHETDVTIADFVADLRAPTPSAAAELVSRNQDELLQQLRHQQQRLDMAFDRLFTRKSQR 294

Query: 307 LNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
           L  L   L   +    L   + + ++L   L+  +        + F  +  R+K + L +
Sbjct: 295 LKQLALRLQNQHPQNQLRAQQAKNEQLTHRLQLAILRQFENTQQKFTALSVRLKQNPLPY 354

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            IQ+ +Q + + +                                               
Sbjct: 355 RIQRYQQGLEQLKVR--------------------------------------------- 369

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
             + F ++ ++  C   ++     L   +    L RGY+  ++     I   +++     
Sbjct: 370 --LNFCVNRQVTECQNKLATLCGKLDGLSPLKVLARGYSIAENPQGKAIVSVKDVNQGDF 427

Query: 485 ILINFFDGQANAIV 498
           I     DG+  + V
Sbjct: 428 ITTQVADGKIVSKV 441


>gi|269103268|ref|ZP_06155965.1| exodeoxyribonuclease VII large subunit [Photobacterium damselae
           subsp. damselae CIP 102761]
 gi|268163166|gb|EEZ41662.1| exodeoxyribonuclease VII large subunit [Photobacterium damselae
           subsp. damselae CIP 102761]
          Length = 448

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 137/501 (27%), Positives = 237/501 (47%), Gaps = 57/501 (11%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M  F+Q    ++  ++VS L+  ++ ++E+ +  V + GE+S +  +  SGH YF+LKD 
Sbjct: 1   MTMFAQPTQSNNRIFTVSTLNAQVRVLLENEMGIVWLVGELSNF-SMPVSGHWYFTLKDA 59

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            +++   ++KG   ++ F P  G + LV  +++ +     YQ+IIES+ P G G L    
Sbjct: 60  RAQVKCAMFKGNNRRVLFKPSNGTQVLVKARLSLYEPRGDYQLIIESMQPEGDGRLQQQF 119

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPV 179
           E+ K  L  EGLF+   K P+P  PK + +ITS TGA + DIL  +  R P L ++I+P 
Sbjct: 120 EQLKMSLAAEGLFAQSIKKPLPEQPKRVGIITSKTGAALFDILNVLRRRDPGLPIVIYPT 179

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
            VQG+     IA AI + N+ KE       D++I+ RGGGS+EDLW FN+E++ R I  S
Sbjct: 180 MVQGEGSAISIAQAIGRANSRKE------CDVLIVGRGGGSLEDLWAFNEEIVARTIVAS 233

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
            IPI+SA+GHE D T+AD+ AD+RAPTP+ AAE+      H   ++   + +LN+ +   
Sbjct: 234 EIPIVSAVGHEVDVTIADFVADVRAPTPSAAAELISRDMTHQTQAITQKKQQLNHAMRYY 293

Query: 300 IKYKINTLNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRI 357
           I  +      L   L   +    L+  +  LD L   L   ++  + +  +    I  ++
Sbjct: 294 IAKQQQQTQRLQHRLERQHPQMRLNQQQQHLDELTGHLHQAMQRKLTQADQRVERINYKL 353

Query: 358 KSDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLH 417
                   I++   H+ + ++ +                                     
Sbjct: 354 SLYSPSQTIKQLSHHLAQSERRL------------------------------------- 376

Query: 418 THIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKR 477
                        +     +    +++    L++ +   T+ RGY+  Q  + + I    
Sbjct: 377 ----------TDAMDRSQLTARHQLAMMAEKLEAVSPLATIARGYSITQKEDGSVIRSSE 426

Query: 478 NLATKTRILINFFDGQANAIV 498
            ++T  R++     G+  +IV
Sbjct: 427 QVSTGDRLVTKVAQGEIRSIV 447


>gi|145634607|ref|ZP_01790316.1| exodeoxyribonuclease VII large subunit [Haemophilus influenzae
           PittAA]
 gi|145268152|gb|EDK08147.1| exodeoxyribonuclease VII large subunit [Haemophilus influenzae
           PittAA]
          Length = 439

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 142/492 (28%), Positives = 234/492 (47%), Gaps = 57/492 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIW 69
           +    YSVS+L+   + ++E   S + + GEIS +     SGH Y +LKD ++++   ++
Sbjct: 1   MSDNIYSVSQLNSAARQMLEGKFSQIWLTGEISNFT-QPVSGHWYLTLKDENAQVRCAMF 59

Query: 70  KGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLE 129
           +    ++ F P+ G++ LV   ++ +     YQ+II+S+ P+G G L    E  K KL  
Sbjct: 60  RMKNLRVAFRPQNGMQVLVRANVSLYEPRGDYQLIIDSMHPAGEGLLQQQFEALKMKLAT 119

Query: 130 EGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPK 188
           EGLF+   K  +P   K + +ITS TGA ++DIL  ++ R P L+V+I+P  VQG E   
Sbjct: 120 EGLFAQNLKKNLPHFSKAVGIITSSTGAALQDILHILARRDPSLKVVIYPTAVQGKEATA 179

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           EI   I   N  +E       D++I+ RGGGS+EDLW FN+E + RAI  S++PIISA+G
Sbjct: 180 EIVQMIELANARQE------VDVLIVGRGGGSLEDLWCFNEEEVARAIFRSTLPIISAVG 233

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HETD T+AD+ ADLRAPTP+ AAE+    ++ L   L + + RL+    RL   K   L 
Sbjct: 234 HETDVTIADFVADLRAPTPSAAAELVSRNQDELLQQLRHQQQRLDMAFDRLFTRKSQRLK 293

Query: 309 SLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNI 366
            L   L   +    L   + + ++L   L+  +        + F  +  R+K + L + I
Sbjct: 294 QLALRLQNQHPQNQLRAQQAKNEQLTHRLQLAILRQFENTQQKFTALSVRLKQNPLPYRI 353

Query: 367 QKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITR 426
           Q+++QH+ + Q                                                 
Sbjct: 354 QRHQQHLEQLQVR----------------------------------------------- 366

Query: 427 IEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRIL 486
           + F ++ ++      ++     L   +    L RGY+  ++     I   +++     I 
Sbjct: 367 LNFSINRQVTERQNKLATLCGKLDGLSPLKVLARGYSIAENPQGKAIVSVKDVNQGDFIT 426

Query: 487 INFFDGQANAIV 498
               DG+  + V
Sbjct: 427 TQVADGKIVSKV 438


>gi|258627195|ref|ZP_05721983.1| exodeoxyribonuclease VII large subunit [Vibrio mimicus VM603]
 gi|258580497|gb|EEW05458.1| exodeoxyribonuclease VII large subunit [Vibrio mimicus VM603]
          Length = 446

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 139/496 (28%), Positives = 243/496 (48%), Gaps = 57/496 (11%)

Query: 6   QKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRID 65
             +  +   Y+VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++ 
Sbjct: 2   SSSLANRNIYTVSRLNAEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSQAQVK 60

Query: 66  AIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKK 125
             ++KG    + F P+ G + LV  +++ +     YQII+ES+ P G G L    E+ K 
Sbjct: 61  CAMFKGNNRLVNFKPQNGQQVLVKARLSLYEPRGDYQIILESMQPEGDGRLQQQFEQLKM 120

Query: 126 KLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGD 184
           +L  EGLF+   K P+P  P+ + +ITS TGA + DIL  +  R P L V+I+P  VQG+
Sbjct: 121 QLAAEGLFAQTRKKPLPENPRSVGIITSRTGAALHDILHVLKRRDPNLPVVIYPTLVQGE 180

Query: 185 ECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPII 244
           +   +IA AI + N+  E       D++I+ RGGGS+EDLW FN E++ R IA S+IPII
Sbjct: 181 DAAIQIAQAIGRANSRAE------CDVLIVGRGGGSLEDLWCFNHEIVARTIAASNIPII 234

Query: 245 SAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKI 304
           SA+GHE D T+AD+ AD+RAPTP+ AAE+      H Q +L   +A+L + +   +  + 
Sbjct: 235 SAVGHEIDVTIADFVADVRAPTPSAAAELVSRDNRHKQQALHQWQAKLASGMRHYLAQQH 294

Query: 305 NTLNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFL 362
                +   L   +    L   + +LD L   LE  +   +  + +  + + ++I+ +  
Sbjct: 295 TQFARIQHKLDKQHPQARLERQQQQLDELSLRLEQKMHQRLATQQQRSDRLSHKIQLNSP 354

Query: 363 IHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKK 422
            H I++ R ++L+++Q + Q+                                       
Sbjct: 355 THLIRQQRFNLLQQEQRLTQL--------------------------------------- 375

Query: 423 LITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATK 482
                   + H +      +++ +  + + +   TL RGY+  +      + Q   +   
Sbjct: 376 --------IQHHLIQSRHQLALLSEKMDAVSPLATLARGYSVTRTAQGELVRQSAQVKPG 427

Query: 483 TRILINFFDGQANAIV 498
             ++    DG+  + V
Sbjct: 428 DTLVTQLMDGEILSTV 443


>gi|306814424|ref|ZP_07448586.1| exodeoxyribonuclease VII large subunit [Escherichia coli NC101]
 gi|222034217|emb|CAP76958.1| exodeoxyribonuclease 7 large subunit [Escherichia coli LF82]
 gi|305851818|gb|EFM52270.1| exodeoxyribonuclease VII large subunit [Escherichia coli NC101]
 gi|312947083|gb|ADR27910.1| exodeoxyribonuclease VII large subunit [Escherichia coli O83:H1
           str. NRG 857C]
 gi|324008514|gb|EGB77733.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 57-2]
          Length = 458

 Score =  377 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 140/510 (27%), Positives = 228/510 (44%), Gaps = 57/510 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+K  +P     + VITS TGA + DIL  +  R P L VII+   VQGD+ 
Sbjct: 122 QTEGLFDLQYKKSLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYSTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IPI+SA
Sbjct: 182 PGQIVRAIELANKRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPIVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSTRQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  ++       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRAGQQQQRLTRQLVQQNPQS 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +                                          
Sbjct: 356 RIHRAQTRIQQLEYRLAE------------------------------------------ 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +           L++ +  +TL RGY+     +   + Q + +     
Sbjct: 374 -----TLRAQLSATRERFGNAVTHLEAVSPLSTLARGYSVTSAADGAVLKQVKQVKVGET 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTKKCQL 514
           +     DG   + V      ++   K    
Sbjct: 429 LTTRLGDGVVISEVSAVTKTRKSRKKTSNP 458


>gi|68249000|ref|YP_248112.1| exodeoxyribonuclease VII large subunit [Haemophilus influenzae
           86-028NP]
 gi|81336588|sp|Q4QNE5|EX7L_HAEI8 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|68057199|gb|AAX87452.1| exodeoxyribonuclease VII large subunit [Haemophilus influenzae
           86-028NP]
          Length = 439

 Score =  377 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 141/492 (28%), Positives = 233/492 (47%), Gaps = 57/492 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIW 69
           +    YSVS+L+   + ++E N S + + GEIS +     SGH Y +LKD ++++   ++
Sbjct: 1   MSDNIYSVSQLNSAARQMLEGNFSQIWLTGEISNFT-QPVSGHWYLTLKDENAQVRCAMF 59

Query: 70  KGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLE 129
           +    ++ F P+ G++ LV   ++ +     YQ+II+S+ P+G G L    E  K KL  
Sbjct: 60  RMKNLRVAFRPQNGMQVLVRANVSLYEPRGDYQLIIDSMHPAGEGLLQQQFEALKMKLAA 119

Query: 130 EGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPK 188
           EGLF+   K  +P   K + +ITS TGA ++DIL  ++ R P L+V+I+P  VQG E   
Sbjct: 120 EGLFAQNLKKTLPHFSKAVGIITSSTGAALQDILHILARRDPSLKVVIYPTAVQGKEATA 179

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           EI   I   N  +E       D++I+ RGGGS+EDLW FN+E + RAI  S++PIISA+G
Sbjct: 180 EIVQMIELANARQE------VDVLIVGRGGGSLEDLWCFNEEEVARAIFRSTLPIISAVG 233

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HETD T+AD+ ADLRAPTP+ AAE+    ++ L   L + + RL+    RL   K   L 
Sbjct: 234 HETDVTIADFVADLRAPTPSAAAELVSRNQDELLQQLRHQQQRLDMAFDRLFTRKSQRLK 293

Query: 309 SLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNI 366
            L   L   +    L   + + ++L   L+  +        + F  +  R+K + L + I
Sbjct: 294 QLALRLQNQHPQNQLRAQQAKNEQLTHRLQLAILRQFENTQQKFTALSVRLKQNPLPYRI 353

Query: 367 QKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITR 426
           Q+ +Q + + +                                                 
Sbjct: 354 QRYQQGLEQLKVR----------------------------------------------- 366

Query: 427 IEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRIL 486
           + F ++ ++      ++     L   +    L RGY+  ++     I   +++     I 
Sbjct: 367 LNFCVNRQVTERQNKLATLCGKLDGLSPLKVLARGYSIAENPQGKAIVSVKDVNQGDFIT 426

Query: 487 INFFDGQANAIV 498
               DG+  + V
Sbjct: 427 TQVADGKIVSKV 438


>gi|297581165|ref|ZP_06943089.1| exodeoxyribonuclease VII [Vibrio cholerae RC385]
 gi|297534481|gb|EFH73318.1| exodeoxyribonuclease VII [Vibrio cholerae RC385]
          Length = 446

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 143/496 (28%), Positives = 241/496 (48%), Gaps = 57/496 (11%)

Query: 6   QKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRID 65
             +  +   Y+VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++ 
Sbjct: 2   SSSLANRNIYTVSRLNSEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSQAQVK 60

Query: 66  AIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKK 125
             ++KG    + F P+ G + LV  +++ +     YQII+ES+   G G L    E+ K 
Sbjct: 61  CAMFKGNNRLVNFKPQNGQQVLVKARLSLYEPRGDYQIILESMQLEGDGRLQQQFEQLKM 120

Query: 126 KLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGD 184
           +L  EGLF+   K P+P  P+ + +ITS TGA + DIL  +  R P L V+I+P  VQG+
Sbjct: 121 QLAAEGLFAQTRKKPLPENPRCVGIITSRTGAALHDILHVLKRRDPNLPVVIYPTLVQGE 180

Query: 185 ECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPII 244
           E   +IA AI + NT  E       D++I+ RGGGS+EDLW FN E++ R IA S IPII
Sbjct: 181 EAAIQIAQAIGRANTRAE------CDVLIVGRGGGSLEDLWCFNHEIVARTIAASEIPII 234

Query: 245 SAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKI 304
           SA+GHE D T+AD+ AD+RAPTP+ AAE+      H Q +L   +A+L + +   +  + 
Sbjct: 235 SAVGHEIDVTIADFVADVRAPTPSAAAELVSRDHRHKQQALHQWQAKLASAMRHYLAQQD 294

Query: 305 NTLNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFL 362
                L   L   +    L   + +LD L   LE  ++  +  + +  + + ++I+    
Sbjct: 295 TQFARLQYKLDKQHPQARLERQQQQLDELSLRLEQKMQQRLATQQQRRDRLSHKIELHSP 354

Query: 363 IHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKK 422
           IH I++ R ++++++Q I Q                                        
Sbjct: 355 IHLIRQQRFNLIQQEQRINQ---------------------------------------- 374

Query: 423 LITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATK 482
                   +   +      +++ +  L + +   TL RGY+  + T    + Q   +   
Sbjct: 375 -------SIQRYLIQSRHQLALLSEKLDAVSPLATLARGYSVTRTTQGELVRQSAQVKPG 427

Query: 483 TRILINFFDGQANAIV 498
             ++    DG+  + V
Sbjct: 428 DTLVTQLMDGEILSTV 443


>gi|83647623|ref|YP_436058.1| exodeoxyribonuclease VII large subunit [Hahella chejuensis KCTC
           2396]
 gi|123531576|sp|Q2SCJ1|EX7L_HAHCH RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|83635666|gb|ABC31633.1| exodeoxyribonuclease VII, large subunit [Hahella chejuensis KCTC
           2396]
          Length = 444

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 152/499 (30%), Positives = 240/499 (48%), Gaps = 60/499 (12%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M+  S  +      +SV+EL+  ++ ++E +   V V GEIS +    SSGH YFSLKD+
Sbjct: 1   MSELSPHS-----PFSVTELNRQVRRLLEVSFMQVWVTGEISNF-SCPSSGHWYFSLKDD 54

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            +++   +++     ++  P +G    +  K++ + G  ++Q+I ES+  +G G L  A 
Sbjct: 55  KAQVRCAMFRNRNMFVKQRPRDGEAVTLRAKVSLYEGRGEFQLIAESMELAGEGELRRAF 114

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPV 179
           E+ K KL  EGLF +  K P+P +PK + VITSPTGA +RDIL  +  RFP + V++FPV
Sbjct: 115 EELKLKLSREGLFEESRKRPLPAMPKQVGVITSPTGAAVRDILTVLERRFPAIPVLLFPV 174

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
            VQG E    I  AI   N L         D++I+ RGGGS+EDLW FN+E + RAIA S
Sbjct: 175 PVQGKEAGPAIVAAIASANRLNC------CDVLIVGRGGGSLEDLWAFNEEPVARAIAAS 228

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
           +IP++SA+GHETD T+AD  ADLRAPTP+ AAE   P +   +   +  E RL+    RL
Sbjct: 229 AIPVVSAVGHETDITIADLVADLRAPTPSAAAEKVSPDQAEWKHRFLIYEQRLDAAAQRL 288

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
           ++ +   LN L   L +  + L  S  RLD L   L    + ++  +     H+ +R+ +
Sbjct: 289 LRQEGLRLNQLRGRLKHPGRRLQESAQRLDDLEVRLHRQAQNLLSVRRNQLTHLRDRLLA 348

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH 419
                +++     +      ++  V   LR                              
Sbjct: 349 SSPRQSLKNRYATVDALNHRLQTAVLSVLR------------------------------ 378

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
                                  +     +++ +   TL RGY  + D N   I  ++ +
Sbjct: 379 -----------------HKSQHFAKLCGHMEAVSPIATLARGYAIVSDENGQIIRSEKEV 421

Query: 480 ATKTRILINFFDGQANAIV 498
            T  ++     DG+ +  V
Sbjct: 422 RTGQKVKARLSDGEIHCEV 440


>gi|49474517|ref|YP_032559.1| exodeoxyribonuclease VII large subunit [Bartonella quintana str.
           Toulouse]
 gi|81827591|sp|Q6FZ30|EX7L_BARQU RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|49240021|emb|CAF26437.1| Exodeoxyribonuclease large subunit [Bartonella quintana str.
           Toulouse]
          Length = 475

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 212/530 (40%), Positives = 309/530 (58%), Gaps = 56/530 (10%)

Query: 1   MNPFSQKN-SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKD 59
           MN F +K  + +  E+SVSE++  LK +VE    +V VRGEISGYRG H+SGH YFSLKD
Sbjct: 1   MNLFFEKTEATNVAEFSVSEIAGALKRVVEERFGYVRVRGEISGYRGAHASGHVYFSLKD 60

Query: 60  NHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTA 119
           + +R++A+IW+G + K++F PEEG+E + +GK+TT+PGSSKYQI+IE+L P+G G L+T 
Sbjct: 61  DKARLEAVIWRGIMEKLKFPPEEGMEVIAVGKLTTYPGSSKYQIVIEALEPTGVGALMTL 120

Query: 120 LEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPV 179
           LE RKKKL +EGLF +  K P+P++P+II V+TSPTGAVIRDI+ RIS RFPL ++++PV
Sbjct: 121 LENRKKKLADEGLFDEAKKKPLPYMPRIIGVVTSPTGAVIRDIIHRISDRFPLHILVWPV 180

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
           +VQGD   +E+A+A+   N L  G   P+PD+II+ARGGGS+EDLW FNDE +VRA+  S
Sbjct: 181 RVQGDTSGREVADALKGFNALPFGGLVPKPDLIIVARGGGSLEDLWGFNDEAVVRAVYES 240

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
           ++P+ISA+GHETDWTL DY AD RAPTPTGAAE AVPVK  L+  + +L ARL   + R 
Sbjct: 241 ALPVISAVGHETDWTLIDYVADWRAPTPTGAAERAVPVKLDLEVQVASLGARLRMGLARY 300

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
             +    L +L++ LP  DQ  +  R   D +   L+  L +   +K  +F+ +  R+  
Sbjct: 301 FDFHQQKLRALVRGLPTVDQLFALPRRGFDEISSRLQRALCVSCDKKRFYFHGLNLRLSP 360

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH 419
             L  N +K  ++  E    + +                                     
Sbjct: 361 RLL--NTEKELRNTKEYTARLHR------------------------------------- 381

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
                          ++     + + +R+L+S +Y+N L+RG+      +N  I +    
Sbjct: 382 ----------AFVRNVEKQRAQLEVASRLLKSTSYQNILERGFVLALGPDNKLIKRLVQF 431

Query: 480 ATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
               +I + FFDG+ +         ++    +       + KQ  QG LF
Sbjct: 432 PETGQINLRFFDGEMSV------SARDHGLNRSSKSKRIKSKQDDQGTLF 475


>gi|145638692|ref|ZP_01794301.1| exodeoxyribonuclease VII large subunit [Haemophilus influenzae
           PittII]
 gi|145272287|gb|EDK12195.1| exodeoxyribonuclease VII large subunit [Haemophilus influenzae
           PittII]
 gi|309750185|gb|ADO80169.1| Exodeoxyribonuclease VII, large subunit [Haemophilus influenzae
           R2866]
          Length = 439

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 141/492 (28%), Positives = 235/492 (47%), Gaps = 57/492 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIW 69
           +    YSVS+L+   + ++E + S + + GEIS +     SGH Y +LKD ++++   ++
Sbjct: 1   MSDNIYSVSQLNSAARQMLEGHFSQIWLTGEISNFT-QPVSGHWYLTLKDENAQVRCAMF 59

Query: 70  KGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLE 129
           +    ++ F P+ G++ LV   ++ +     YQ+II+S+ P+G G L    E  K KL  
Sbjct: 60  RMKNLRVAFRPQNGMQVLVRANVSLYEPRGDYQLIIDSMHPAGEGLLQQQFEALKMKLAA 119

Query: 130 EGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPK 188
           EGLF+   K  +P   K + +ITS TGA ++DIL  ++ R P L+V+I+P  VQG E   
Sbjct: 120 EGLFAQNLKKNLPHFSKAVGIITSSTGAALQDILHILARRDPSLKVVIYPTAVQGKEATA 179

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           EI   I   N  +E       D++I+ RGGGS+EDLW FN+E + RAI  S++PIISA+G
Sbjct: 180 EIVQMIELANVRQE------VDVLIVGRGGGSLEDLWCFNEEEVARAIFRSTLPIISAVG 233

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HETD T+AD+ ADLRAPTP+ AAE+    ++ L   L + + RL+    RL   K   L 
Sbjct: 234 HETDVTIADFVADLRAPTPSAAAELVSRNQDELLQQLRHQQQRLDMAFDRLFTRKSQRLK 293

Query: 309 SLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNI 366
            L   L   +    L   + + ++L   L+  +        + F  +  R+K + L + +
Sbjct: 294 QLALRLHNQHPQNQLRAQQAKNEQLTHRLQLAILRQFENTQQKFTALSVRLKQNPLPYQV 353

Query: 367 QKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITR 426
           Q+++QH+ + Q                                                 
Sbjct: 354 QRHQQHLEQLQVR----------------------------------------------- 366

Query: 427 IEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRIL 486
           + F ++ ++      ++     L   +    L RGY+  ++     I   +++     I 
Sbjct: 367 LNFCVNRQVAERQNKLATLCGKLDGLSPLKVLARGYSIAENPQGKAIVSVKDVNQGDFIT 426

Query: 487 INFFDGQANAIV 498
               DG+  + V
Sbjct: 427 TQVADGKIVSKV 438


>gi|329114737|ref|ZP_08243494.1| Exodeoxyribonuclease 7 large subunit [Acetobacter pomorum DM001]
 gi|326695868|gb|EGE47552.1| Exodeoxyribonuclease 7 large subunit [Acetobacter pomorum DM001]
          Length = 484

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 165/502 (32%), Positives = 259/502 (51%), Gaps = 30/502 (5%)

Query: 6   QKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRID 65
              S + PE++VSE+S  ++  +E   S V VRGEI+  +    SGH YFSLKD   +I 
Sbjct: 8   PSASNNVPEFTVSEISGAIRRTLEGTFSRVRVRGEITELKRYP-SGHVYFSLKDERGKIS 66

Query: 66  AIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKK 125
            ++W+G+++++  +PE G+E +  GKI+ +   S YQ+++E +  +G G LL  +E+ + 
Sbjct: 67  GVVWRGSVSRLGLVPENGVEIIATGKISAYGERSSYQLVVERMEYAGEGALLARIERLRL 126

Query: 126 KLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDE 185
           KL EEGLF    K  IP +P++I V+TSP GAV+ DI   +  RFP  VI++PV VQG+ 
Sbjct: 127 KLAEEGLFDTARKKAIPLLPRVIGVVTSPQGAVLHDICTTLQRRFPRPVIVWPVPVQGEG 186

Query: 186 CPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIIS 245
               IA AI   + L      PRPD++I+ARGGGS+EDL  FNDE +VRA A   IP+IS
Sbjct: 187 AAARIAAAIDGFSQLDGLGAVPRPDVLIVARGGGSLEDLMAFNDEAVVRATAACLIPLIS 246

Query: 246 AIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKIN 305
           A+GHETD TL D+A+D RAPTPT AAEMAVPV+  L + + +  AR    + RL++    
Sbjct: 247 AVGHETDTTLIDFASDRRAPTPTAAAEMAVPVRTELLADIEHRNARAVGALSRLLQTARL 306

Query: 306 TLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHN 365
            L+    A+P+    L  +R +LD   R L+  L  ++ R+      +   + +      
Sbjct: 307 RLDRASSAMPDLPSLLQTARMQLDDRGRRLDVALPALVQRRKADLVAVERHMPAV----- 361

Query: 366 IQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLIT 425
                  +  ++  +  +       +    + + A L  LR                   
Sbjct: 362 ----ETLLAGRRTRLAVLANMLQASMAHTFQRQDARLGRLRISPAP-------------- 403

Query: 426 RIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRI 485
                L   ++   T+++     L++ + +  L RGY  +       +T    L    R+
Sbjct: 404 -----LQALVRERRTALAGIAGQLEAISPRAVLARGYALVT-AEGRPVTSAEQLNDGERV 457

Query: 486 LINFFDGQANAIVINKAPPKEQ 507
            + F DG   A++ +     +Q
Sbjct: 458 ELTFGDGARPAVIGDGTHRPKQ 479


>gi|218708649|ref|YP_002416270.1| exodeoxyribonuclease VII large subunit [Vibrio splendidus LGP32]
 gi|218321668|emb|CAV17622.1| Exodeoxyribonuclease VII, large subunit [Vibrio splendidus LGP32]
          Length = 492

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 137/505 (27%), Positives = 238/505 (47%), Gaps = 58/505 (11%)

Query: 6   QKNSLDHP-EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRI 64
              S+ +P  ++VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++
Sbjct: 41  DSASMTNPNIFTVSRLNSEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSRAQV 99

Query: 65  DAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRK 124
              +++G   ++ F P+ G + LV  +++ +     YQ+IIES+ P G G L    EK K
Sbjct: 100 KCAMFRGNNRRVTFKPQNGNQVLVKARLSLYEPRGDYQLIIESMQPEGDGKLQQEFEKLK 159

Query: 125 KKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQG 183
             L  EGLF+   K  +P  PK + VITS TGA + DIL  +  R P L VI++P  VQG
Sbjct: 160 MNLAAEGLFAQSSKQILPEHPKCVGVITSKTGAALFDILDVLKRRDPSLPVIVYPTMVQG 219

Query: 184 DECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPI 243
           +    +IA AI + N   E       D++I+ RGGGS+EDLW FN+E++ R IA S IPI
Sbjct: 220 EGASIQIAQAIGRANERNE------CDVLIVGRGGGSLEDLWCFNNEIVARTIAASQIPI 273

Query: 244 ISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYK 303
           ISA+GHE D T+AD+ AD+RAPTP+ AAE+      H + +  +  +RL + I  ++  +
Sbjct: 274 ISAVGHEVDVTIADFVADMRAPTPSAAAELVSRDNSHKEQAYASKRSRLVSAIRHVLIKQ 333

Query: 304 INTLNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
             +  +L   L   +    L     +LD L   L   +   + +  +      ++++ + 
Sbjct: 334 AQSTQTLKYRLEKQHPSYQLQKQSQQLDDLDMRLRRGMTQYLKQHAQRVERKQHQLQLNS 393

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIK 421
            +  + + + H+   +Q                                           
Sbjct: 394 PVKRLGEQKLHLQRSEQ------------------------------------------- 410

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLAT 481
               ++   +   + +    +++    L++ +   TLKRGY+     ++  ++   ++  
Sbjct: 411 ----KLLDAMDKTLLTTRHQLAMAAEKLETVSPLATLKRGYSITHSASSKTVSSINDVEI 466

Query: 482 KTRILINFFDGQANAIVINKAPPKE 506
              I     DG   + V  +    E
Sbjct: 467 GEVITTQVEDGVIESQVTTRVAKSE 491


>gi|333001706|gb|EGK21272.1| exodeoxyribonuclease VII, large subunit [Shigella flexneri K-218]
          Length = 447

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 144/498 (28%), Positives = 232/498 (46%), Gaps = 57/498 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQYKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTSVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANQRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSARQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRAGQQQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +I                                         
Sbjct: 356 KIHRTQTRIQQLEYRLAEI----------------------------------------- 374

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +           L++ +  +TL RGY+    T+ N + + + + T   
Sbjct: 375 ------LRAQLSATRERFGNAVTHLEAVSPLSTLARGYSVTTATDGNVLKKVKQVKTGEM 428

Query: 485 ILINFFDGQANAIVINKA 502
           +     DG   + V   +
Sbjct: 429 LTTRLEDGWIESEVKTSS 446


>gi|331658650|ref|ZP_08359594.1| exodeoxyribonuclease VII, large subunit [Escherichia coli TA206]
 gi|331054315|gb|EGI26342.1| exodeoxyribonuclease VII, large subunit [Escherichia coli TA206]
          Length = 458

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 139/510 (27%), Positives = 227/510 (44%), Gaps = 57/510 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+K  +P     + VITS T A + DIL  +  R P L VII+   VQGD+ 
Sbjct: 122 QTEGLFDLQYKKSLPSPAHCVGVITSKTSAALHDILHVLKRRDPSLPVIIYSTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IPI+SA
Sbjct: 182 PGQIVRAIELANKRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPIVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSTRQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  ++       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRAGQQQQRLTRQLVQQNPQS 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +                                          
Sbjct: 356 RIHRAQTRIQQLEYRLAE------------------------------------------ 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +           L++ +  +TL RGY+     +   + Q + +     
Sbjct: 374 -----TLRAQLSATRERFGNAVTHLEAVSPLSTLARGYSVTSAADGAVLKQVKQVKVGET 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTKKCQL 514
           +     DG   + V      ++   K    
Sbjct: 429 LTTRLGDGVVISEVSAVTKTRKSRKKTSNP 458


>gi|333002304|gb|EGK21868.1| exodeoxyribonuclease VII, large subunit [Shigella flexneri K-272]
          Length = 447

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 143/498 (28%), Positives = 231/498 (46%), Gaps = 57/498 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQYKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTSVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELSNQRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSARQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRAGQQQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +I                                         
Sbjct: 356 KIHRTQTRIQQLEYRLAEI----------------------------------------- 374

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +           L++ +  +TL RGY+    T+ N + + + +     
Sbjct: 375 ------LRAQLSATRERFGNAVTHLEAVSPLSTLARGYSVTTATDGNVLKKVKQVKAGEM 428

Query: 485 ILINFFDGQANAIVINKA 502
           +     DG   + V   +
Sbjct: 429 LTTRLEDGWIESEVKTSS 446


>gi|329122272|ref|ZP_08250860.1| exodeoxyribonuclease VII large subunit [Haemophilus aegyptius ATCC
           11116]
 gi|327473833|gb|EGF19250.1| exodeoxyribonuclease VII large subunit [Haemophilus aegyptius ATCC
           11116]
          Length = 439

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 141/492 (28%), Positives = 235/492 (47%), Gaps = 57/492 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIW 69
           +    YSVS+L+   + ++E + S + + GEIS +     SGH Y +LKD ++++   ++
Sbjct: 1   MSDNIYSVSQLNSAARQMLEGHFSQIWLTGEISNFT-QPVSGHWYLTLKDENAQMRCAMF 59

Query: 70  KGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLE 129
           +    ++ F P+ G++ LV   ++ +     YQ+II+S+ P+G G L    E  K KL  
Sbjct: 60  RMKNLRVAFRPQNGMQVLVRANVSLYEPRGDYQLIIDSMHPAGEGLLQQQFEALKMKLAA 119

Query: 130 EGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPK 188
           EGLF+   K  +P   K + +ITS TGA ++DIL  ++ R P L+V+I+P  VQG E   
Sbjct: 120 EGLFAQNLKKNLPHFSKAVGIITSSTGAALQDILHILARRDPSLKVVIYPTAVQGKEATA 179

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           EI   I   N  +E       D++I+ RGGGS+EDLW FN+E + RAI  S++PIISA+G
Sbjct: 180 EIVQMIELANVRQE------VDVLIVGRGGGSLEDLWCFNEEEVARAIFRSTLPIISAVG 233

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HETD T+AD+ ADLRAPTP+ AAE+    ++ L   L + + RL+    RL   K   L 
Sbjct: 234 HETDVTIADFVADLRAPTPSAAAELVSRNQDELLQQLRHQQQRLDMAFDRLFTRKSQRLK 293

Query: 309 SLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNI 366
            L   L   +    L   + + ++L   L+  +        + F  +  R+K + L + +
Sbjct: 294 QLALRLQNQHPQNQLRAQQAKNEQLTHRLQLAILRQFENTQQKFTALSVRLKQNPLPYQV 353

Query: 367 QKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITR 426
           Q+++QH+ + Q                                                 
Sbjct: 354 QRHQQHLEQLQVR----------------------------------------------- 366

Query: 427 IEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRIL 486
           + F ++ ++      ++     L   +    L RGY+  ++     I   +++     I 
Sbjct: 367 LNFSINRQVTERQNKLATLCGKLDGLSPLKVLARGYSIAENPQGKAIVSVKDVNQGDFIT 426

Query: 487 INFFDGQANAIV 498
               DG+  + V
Sbjct: 427 TQVADGKIVSKV 438


>gi|16272346|ref|NP_438559.1| exodeoxyribonuclease VII large subunit [Haemophilus influenzae Rd
           KW20]
 gi|260580540|ref|ZP_05848368.1| exodeoxyribonuclease VII, large subunit [Haemophilus influenzae
           RdAW]
 gi|1169574|sp|P43913|EX7L_HAEIN RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|1573368|gb|AAC22056.1| exodeoxyribonuclease VII, large subunit (xseA) [Haemophilus
           influenzae Rd KW20]
 gi|260092882|gb|EEW76817.1| exodeoxyribonuclease VII, large subunit [Haemophilus influenzae
           RdAW]
          Length = 439

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 140/492 (28%), Positives = 232/492 (47%), Gaps = 57/492 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIW 69
           +    YSVS+L+   + ++E N   + + GEIS +     SGH Y +LKD ++++   ++
Sbjct: 1   MSDNIYSVSQLNSAARQMLEGNFCQIWLTGEISNFT-QPVSGHWYLTLKDENAQVRCAMF 59

Query: 70  KGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLE 129
           +    ++ F P+ G++ LV   ++ +     YQ+II+S+ P+G G L    E  K KL  
Sbjct: 60  RMKNLRVAFRPQNGMQVLVRANVSLYEPRGDYQLIIDSMHPAGEGLLQQQFEALKMKLAA 119

Query: 130 EGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPK 188
           EGLF+   K  +P   K + +ITS TGA ++DIL  ++ R P L+V+I+P  VQG E   
Sbjct: 120 EGLFAQNLKKTLPHFSKAVGIITSSTGAALQDILHILARRDPSLKVVIYPTAVQGKEATA 179

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           EI   I   N  +E       D++I+ RGGGS+EDLW FN+E + RAI  S++PIISA+G
Sbjct: 180 EIVQMIELANARQE------VDVLIVGRGGGSLEDLWCFNEEEVARAIFRSTLPIISAVG 233

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HETD T+AD+ ADLRAPTP+ AAE+    ++ L   L + + RL+    RL   K   L 
Sbjct: 234 HETDVTIADFVADLRAPTPSAAAELVSRNQDELLQQLRHQQQRLDMAFDRLFTRKSQRLK 293

Query: 309 SLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNI 366
            L   L   +    L   + + ++L   L+  +        + F  +  R+K + L + I
Sbjct: 294 QLALRLQNQHPQNQLRAQQAKNEQLTHRLQLAILRQFENTQQKFTALSVRLKQNPLPYRI 353

Query: 367 QKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITR 426
           Q+ +Q + + +                                                 
Sbjct: 354 QRYQQGLEQLKVR----------------------------------------------- 366

Query: 427 IEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRIL 486
           + F ++ ++      ++     L   +    L RGY+  ++     I   +++     I 
Sbjct: 367 LNFCVNRQVTERQNKLATLCGKLDGLSPLKVLARGYSIAENPQGKAIVSVKDVNQGDFIT 426

Query: 487 INFFDGQANAIV 498
               DG+  + V
Sbjct: 427 TQVADGKIVSKV 438


>gi|261212134|ref|ZP_05926420.1| exodeoxyribonuclease VII large subunit [Vibrio sp. RC341]
 gi|260838742|gb|EEX65393.1| exodeoxyribonuclease VII large subunit [Vibrio sp. RC341]
          Length = 446

 Score =  376 bits (964), Expect = e-102,   Method: Composition-based stats.
 Identities = 140/496 (28%), Positives = 241/496 (48%), Gaps = 57/496 (11%)

Query: 6   QKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRID 65
             +  +   Y+VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++ 
Sbjct: 2   SSSLANRNIYTVSRLNSEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSQAQVK 60

Query: 66  AIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKK 125
             ++KG    + F P+ G + LV  +++ +     YQII+ES+ P G G L    E+ K 
Sbjct: 61  CAMFKGNNRLVNFKPQNGQQVLVKARLSLYEPRGDYQIILESMQPEGDGRLQQQFEQLKM 120

Query: 126 KLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGD 184
           +L  EGLF+   K  +P  P+ + +ITS TGA + DIL  +  R P L V+I+P  VQG+
Sbjct: 121 QLAAEGLFAQTRKKALPENPRCVGIITSRTGAALHDILHVLKRRDPNLPVVIYPTLVQGE 180

Query: 185 ECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPII 244
           +   +IA AI + N   E       D++I+ RGGGS+EDLW FN E++ R IA S IPII
Sbjct: 181 DAAIQIAQAIGRANARAE------CDVLIVGRGGGSLEDLWCFNHEIVARTIAASEIPII 234

Query: 245 SAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKI 304
           SA+GHE D T+AD+ AD+RAPTP+ AAE+      H Q +L   +A+L + +   +  + 
Sbjct: 235 SAVGHEIDVTIADFVADVRAPTPSAAAELVSRDHRHKQQALHQWQAKLASAMRHYLAQQD 294

Query: 305 NTLNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFL 362
                L   L   +    L   + +LD L   LE  ++  +  + +  + + ++I+ +  
Sbjct: 295 TQFARLQHKLDKQHPQARLERQQQQLDELSLRLEQKMQQRLATQQQRSDRLSHKIQLNSP 354

Query: 363 IHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKK 422
           IH I++ R +++ ++QH+ Q ++ H                                   
Sbjct: 355 IHQIRQQRFNLIRQEQHMNQSIQHH----------------------------------- 379

Query: 423 LITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATK 482
                       +      +++ +  L + +   TL RGY+  +      +     +   
Sbjct: 380 ------------LIHARHRLALLSEKLDAVSPLATLARGYSVTRTAQGELVRYGNQVKAG 427

Query: 483 TRILINFFDGQANAIV 498
             ++    DG+  + V
Sbjct: 428 DTLVTQLIDGEIVSTV 443


>gi|145630430|ref|ZP_01786211.1| exodeoxyribonuclease VII large subunit [Haemophilus influenzae
           R3021]
 gi|144984165|gb|EDJ91602.1| exodeoxyribonuclease VII large subunit [Haemophilus influenzae
           R3021]
          Length = 439

 Score =  376 bits (964), Expect = e-102,   Method: Composition-based stats.
 Identities = 143/492 (29%), Positives = 236/492 (47%), Gaps = 57/492 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIW 69
           +    YSVS+L+   + I+E + S + + GEIS +     SGH Y +LKD ++++   ++
Sbjct: 1   MSDNIYSVSQLNSAARQILEGHFSQIWLTGEISNFT-QPVSGHWYLTLKDENAQVRCAMF 59

Query: 70  KGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLE 129
           +    ++ F P+ G++ LV   ++ +     YQ+II+S+ P+G G L    E  K KL  
Sbjct: 60  RMKNLRVAFRPQNGMQVLVRANVSLYEPRGDYQLIIDSMHPAGEGLLQQQFEALKMKLAT 119

Query: 130 EGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPK 188
           EGLF+   K  +P   K + +ITS TGA ++DIL  ++ R P L+V+I+P  VQG E   
Sbjct: 120 EGLFAQNLKKNLPHFSKAVGIITSSTGAALQDILHILARRDPSLKVVIYPTAVQGKEATA 179

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           EI   I   N  +E       D++I+ RGGGS+EDLW FN+E + RAI  S++PIISA+G
Sbjct: 180 EIVQMIELANLRQE------VDVLIVGRGGGSLEDLWCFNEEEVARAIFRSTLPIISAVG 233

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HETD T+AD+ ADLRAPTP+ AAE+    ++ L   L + + RL+    RL   K   L 
Sbjct: 234 HETDVTIADFVADLRAPTPSAAAELVSRNQDELLQQLRHQQQRLDMAFDRLFTRKSQRLK 293

Query: 309 SLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNI 366
            L+  L   +    L   + + ++L   L+  +        + F  +  R+K + L + I
Sbjct: 294 QLILRLQNQHPQNQLRAQQAKNEQLAHRLQLAMLRQFENTQQKFTALSVRLKQNPLPYRI 353

Query: 367 QKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITR 426
           Q+++QH+ + Q                                                 
Sbjct: 354 QRHQQHLEQLQVR----------------------------------------------- 366

Query: 427 IEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRIL 486
           + F ++ ++      ++     L   +    L RGY+  ++     I   +++     I 
Sbjct: 367 LNFCVNRQVTERQNKLATLCGKLDGLSPLKVLARGYSIAENLQGKAIVSVKDVNQGDLIT 426

Query: 487 INFFDGQANAIV 498
               DG+  + V
Sbjct: 427 TQVADGKIVSKV 438


>gi|325578755|ref|ZP_08148802.1| exodeoxyribonuclease VII large subunit [Haemophilus parainfluenzae
           ATCC 33392]
 gi|325159579|gb|EGC71711.1| exodeoxyribonuclease VII large subunit [Haemophilus parainfluenzae
           ATCC 33392]
          Length = 439

 Score =  376 bits (964), Expect = e-102,   Method: Composition-based stats.
 Identities = 140/492 (28%), Positives = 233/492 (47%), Gaps = 57/492 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIW 69
           +    YSVS+L+   + ++E + S + + GEIS +     SGH Y +LKD ++++   ++
Sbjct: 1   MSENIYSVSQLNSAARQMLEGHFSQIWLTGEISNFT-QPVSGHWYLTLKDENAQVRGAMF 59

Query: 70  KGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLE 129
           +    ++ F P+ G++ LV   ++ +     YQ+IIES+ P+G G L    E  K KL  
Sbjct: 60  RMKNLRVGFRPQNGMQVLVRANVSLYEPRGDYQLIIESMHPAGEGLLQQQFEALKMKLAA 119

Query: 130 EGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPK 188
           EGLF+   K  +P   K + ++TS TGA ++DIL  ++ R P L+V+I+P  VQG E   
Sbjct: 120 EGLFAQNLKKSLPDFAKAVGIVTSSTGAALQDILHILARRDPSLKVVIYPTAVQGKEATA 179

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           EI   I   N  +E       D++I+ RGGGS+EDLW FN+E + RAI  S++PIISA+G
Sbjct: 180 EIVQMIELANARQE------VDVLIVGRGGGSLEDLWCFNEEEVARAIFRSNLPIISAVG 233

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HETD T+AD+ ADLRAPTP+ AAE+    ++ L   L   + RL   + R+  ++   L 
Sbjct: 234 HETDVTIADFVADLRAPTPSAAAELVSRNQQELLQQLAYKQQRLEMALDRIFSHQQQRLQ 293

Query: 309 SLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNI 366
            L   L   +    L   + R ++L   L   ++  + +  +    +  R+K + L + +
Sbjct: 294 QLRLRLQNQHPQNQLLMQKARTEQLHHRLVLAMQRQMDKTQQKLTALSARLKQNPLPYRL 353

Query: 367 QKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITR 426
           QK  Q++ + Q                                                 
Sbjct: 354 QKQSQYLAQLQVR----------------------------------------------- 366

Query: 427 IEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRIL 486
           +    + ++      ++     L   +    L RGY+  +D   + I   + + T   I 
Sbjct: 367 LNLGANRQVTERQNKLATLCGKLDGLSPLKVLARGYSIAEDVKGHAIVSVKQVKTGDTIK 426

Query: 487 INFFDGQANAIV 498
               DG+  + V
Sbjct: 427 TKVADGEITSRV 438


>gi|26248870|ref|NP_754910.1| exodeoxyribonuclease VII large subunit [Escherichia coli CFT073]
 gi|227887541|ref|ZP_04005346.1| exodeoxyribonuclease VII large subunit [Escherichia coli 83972]
 gi|300981968|ref|ZP_07175814.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 45-1]
 gi|301047138|ref|ZP_07194234.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 185-1]
 gi|31563152|sp|Q8FF64|EX7L_ECOL6 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|26109276|gb|AAN81478.1|AE016764_160 Exodeoxyribonuclease VII large subunit [Escherichia coli CFT073]
 gi|227835891|gb|EEJ46357.1| exodeoxyribonuclease VII large subunit [Escherichia coli 83972]
 gi|300300940|gb|EFJ57325.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 185-1]
 gi|300408863|gb|EFJ92401.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 45-1]
 gi|307554529|gb|ADN47304.1| exonuclease VII, large subunit [Escherichia coli ABU 83972]
 gi|315292454|gb|EFU51806.1| exodeoxyribonuclease VII, large subunit [Escherichia coli MS 153-1]
          Length = 458

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 140/510 (27%), Positives = 228/510 (44%), Gaps = 57/510 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+K  +P     + VITS TGA + DIL  +  R P L VII+   VQGD+ 
Sbjct: 122 QAEGLFELQYKKSLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYSTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IPI+SA
Sbjct: 182 PGQIVRAIELANKRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPIVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSTRQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  ++       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRAGQQQQRLTRQLVQQNPQS 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +                                          
Sbjct: 356 RIHRAQTRIQQLEYRLAE------------------------------------------ 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +           L++ +  +TL RGY+     +   + Q + +     
Sbjct: 374 -----TLRAQLSATRERFGNAVTHLEAVSPLSTLARGYSVTSAADGAVLKQVKQVKVGET 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTKKCQL 514
           +     DG   + V      ++   K    
Sbjct: 429 LTTRLGDGVVISEVSAVTKTRKSRKKTSNP 458


>gi|218690624|ref|YP_002398836.1| exodeoxyribonuclease VII large subunit [Escherichia coli ED1a]
 gi|254783701|sp|B7MYD7|EX7L_ECO81 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|218428188|emb|CAR09103.2| exonuclease VII, large subunit [Escherichia coli ED1a]
          Length = 458

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 140/510 (27%), Positives = 229/510 (44%), Gaps = 57/510 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+K  +P     + VITS TGA + DIL  +  R P L VII+   VQGD+ 
Sbjct: 122 QTEGLFDLQYKKSLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYSTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IPI+SA
Sbjct: 182 PGQIVRAIELANKRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPIVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSTRQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  ++       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRAGQQQQRLTRQLVQQNPQS 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +                                          
Sbjct: 356 RIHRAQTRIQQLEYRLAE------------------------------------------ 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +           L++ +  +TL RGY+     +   + Q + +     
Sbjct: 374 -----TLRAQLSATRERFGNAVTHLEAVSPLSTLARGYSVTSAADGAVLKQVKQVKVGET 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTKKCQL 514
           ++    DG   + V      ++   K    
Sbjct: 429 LITRLGDGVVISEVSAVTKTRKSRKKTSNP 458


>gi|319406793|emb|CBI80426.1| exodeoxyribonuclease VII large subunit [Bartonella sp. 1-1C]
          Length = 477

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 210/530 (39%), Positives = 308/530 (58%), Gaps = 54/530 (10%)

Query: 1   MNPFSQKN-SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKD 59
           M+ F +K+ + +  E+SVSE++  LK IVE    +V VRGEISGYRG+H+SGHAYF+LKD
Sbjct: 1   MDLFLEKSVATNVAEFSVSEIAGALKRIVEEKFGYVRVRGEISGYRGVHASGHAYFALKD 60

Query: 60  NHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTA 119
           + +R++A+IW+G + K++F PEEG+E + +GK+TT+ GSSKYQIII+SL P+G G L+T 
Sbjct: 61  DKARLEAVIWRGVVEKLQFPPEEGMEVVAVGKLTTYQGSSKYQIIIDSLEPTGVGALMTL 120

Query: 120 LEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPV 179
           LE RKKK  +EGLF +  K  +P++P++I V+TSPTGAVIRDI+ RIS RFPL ++++PV
Sbjct: 121 LENRKKKFADEGLFDEAKKKKLPYMPRVIGVVTSPTGAVIRDIIHRISDRFPLHILVWPV 180

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
           +VQG+   +E+A AI   N L       +PD+II+ARGGGS+EDLW FNDE +VRA++ S
Sbjct: 181 RVQGETSGQEVAAAIAGFNALPLENAISKPDLIIVARGGGSLEDLWGFNDEAVVRAVSVS 240

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
           +IPIISA+GHETDWTL DY AD RAPTPTGAAE AVPVK  L++ L +L  R      R 
Sbjct: 241 AIPIISAVGHETDWTLIDYVADWRAPTPTGAAEKAVPVKFDLETHLASLSLRFRVGAARY 300

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
             +    L+++++ LP +DQ  +  R   D +   L+  L +   +K  +F  ++ R+  
Sbjct: 301 FSFYKQKLSAVVRGLPTADQLFALPRRSFDEISSRLQRALCVNYDKKRFYFYTLVIRLSP 360

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH 419
             L  N +K +Q+  E    +     ++                                
Sbjct: 361 RLL--NTKKAQQNTKEYTVRLHHAFLRN-------------------------------- 386

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
                          ++   T + +T R+L+S +Y++ L+RG+    +  N  I +    
Sbjct: 387 ---------------VEKKRTQIKMTFRLLKSTSYQSILERGFVLALEQENKPIKRLAQF 431

Query: 480 ATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
               +I + FFDG+ N    N                 K+ +   QG LF
Sbjct: 432 PKTGQISLRFFDGKINVSTCN----SVSKNVPKPKKRLKQWQDDDQGTLF 477


>gi|149190082|ref|ZP_01868359.1| exodeoxyribonuclease VII large subunit [Vibrio shilonii AK1]
 gi|148836112|gb|EDL53072.1| exodeoxyribonuclease VII large subunit [Vibrio shilonii AK1]
          Length = 437

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 150/489 (30%), Positives = 236/489 (48%), Gaps = 57/489 (11%)

Query: 18  SELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNKIE 77
           S L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++   +++G   ++ 
Sbjct: 2   SRLNSEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSRAQVKCAMFRGNNRRVT 60

Query: 78  FLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSDQH 137
           F P  G + LV  +++ +     YQ+IIES+ P G G L    EK K  L  EGLF+   
Sbjct: 61  FKPANGNQVLVKARLSLYEPRGDYQLIIESMQPEGDGRLQQEFEKLKMSLAAEGLFAQTL 120

Query: 138 KNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANAILQ 196
           K P+P  PK + +ITS TGA + DIL  +  R P L V+I+P  VQGD    EIA AI +
Sbjct: 121 KQPLPSHPKRVGIITSKTGAALFDILDVLKRRDPSLPVVIYPTTVQGDNAAIEIAQAIGR 180

Query: 197 LNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWTLA 256
            N+  E       D++I+ RGGGS+EDLW FN E++ R IA S IPIISA+GHE D T+A
Sbjct: 181 ANSRNE------CDVLIVGRGGGSLEDLWCFNHEIVARTIAASQIPIISAVGHEIDVTIA 234

Query: 257 DYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKAL-- 314
           DY AD+RAPTP+ AAE+      H + SLI  E RL NII   +  +   L+SL++ L  
Sbjct: 235 DYVADVRAPTPSAAAELVSNDTSHKRESLITREQRLRNIIRLYLSEQKQRLSSLMQDLSN 294

Query: 315 PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHIL 374
            +    L     RLD     L   ++  + ++     + ++R+K    +  + +    + 
Sbjct: 295 QHPKHHLQRQSQRLDEFEYRLNAAMKQRLSQETLRLTNKLHRLKLQSPVTRLAQQSHRLT 354

Query: 375 EKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSHK 434
           + +  +EQ                                                +  +
Sbjct: 355 QFESRLEQ-----------------------------------------------AMQRQ 367

Query: 435 IKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDGQA 494
           + S     ++T   L + +   TLKRGY+  QD +   I+   ++   + +      G  
Sbjct: 368 LSSTKHKFALTVGKLDTVSPLATLKRGYSITQDEDGKVISHVDSVEIGSTMTTQVEHGTL 427

Query: 495 NAIVINKAP 503
            + V +  P
Sbjct: 428 VSTVTDIKP 436


>gi|262165077|ref|ZP_06032814.1| exodeoxyribonuclease VII large subunit [Vibrio mimicus VM223]
 gi|262024793|gb|EEY43461.1| exodeoxyribonuclease VII large subunit [Vibrio mimicus VM223]
          Length = 446

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 140/496 (28%), Positives = 242/496 (48%), Gaps = 57/496 (11%)

Query: 6   QKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRID 65
             +  +   Y+VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++ 
Sbjct: 2   SSSLANRNIYTVSRLNAEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSQAQVK 60

Query: 66  AIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKK 125
             ++KG    + F P+ G + LV  +++ +     YQII+ES+ P G G L    E+ K 
Sbjct: 61  CAMFKGNNRLVNFKPQNGQQVLVKARLSLYEPRGDYQIILESMQPEGDGRLQQQFEQLKM 120

Query: 126 KLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGD 184
           +L  EGLF+   K P+P  P+ + +ITS TGA + DIL  +  R P L V+I+P  VQG+
Sbjct: 121 QLAAEGLFAQTRKKPLPENPRSVGIITSRTGAALHDILHVLKRRDPNLPVVIYPTLVQGE 180

Query: 185 ECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPII 244
           +   +IA AI + N+  E       D++I+ RGGGS+EDLW FN E++ R IA S+IPII
Sbjct: 181 DAAIQIAQAIGRANSRAE------CDVLIVGRGGGSLEDLWCFNHEIVARTIAASNIPII 234

Query: 245 SAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKI 304
           SA+GHE D T+AD+ AD+RAPTP+ AAE+      H Q +L   +A+L + +   +  + 
Sbjct: 235 SAVGHEIDVTIADFVADVRAPTPSAAAELVSRDNRHKQQALHQWQAKLASGMRHYLAQRH 294

Query: 305 NTLNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFL 362
                L   L   +    L   + +LD L   LE  +   +  + +  + + ++I+ +  
Sbjct: 295 TQFARLQHKLDKQHPQARLERQQQQLDELSLRLEQKMHQRLTVQQQRSDRLSHKIQLNSP 354

Query: 363 IHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKK 422
            H I++ R ++L+++Q + Q                                        
Sbjct: 355 THLIRQQRFNLLQQEQRLTQ---------------------------------------- 374

Query: 423 LITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATK 482
                   + H +      +++ +  + + +   TL RGY+  +      + Q   +   
Sbjct: 375 -------SIQHHLIQSRHQLALLSEKMDAVSPLATLARGYSVTRTVQGELVRQSAQVKPG 427

Query: 483 TRILINFFDGQANAIV 498
             ++    DG+  + V
Sbjct: 428 DTLVTQLMDGEILSTV 443


>gi|333016515|gb|EGK35846.1| exodeoxyribonuclease VII, large subunit [Shigella flexneri K-304]
          Length = 447

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 143/498 (28%), Positives = 231/498 (46%), Gaps = 57/498 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             E LF  Q+K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAECLFDQQYKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTSVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANQRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSARQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRAGQQQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +I                                         
Sbjct: 356 KIHRTQTRIQQLEYRLAEI----------------------------------------- 374

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +           L++ +  +TL RGY+    T+ N + + + + T   
Sbjct: 375 ------LRAQLSATRERFGNAVTHLEAVSPLSTLARGYSVTTATDGNVLKKVKQVKTGEM 428

Query: 485 ILINFFDGQANAIVINKA 502
           +     DG   + V   +
Sbjct: 429 LTTRLEDGWIESEVKTSS 446


>gi|319775674|ref|YP_004138162.1| exodeoxyribonuclease VII large subunit [Haemophilus influenzae
           F3047]
 gi|319898081|ref|YP_004136278.1| exodeoxyribonuclease vii large subunit [Haemophilus influenzae
           F3031]
 gi|317433587|emb|CBY81971.1| exodeoxyribonuclease VII large subunit [Haemophilus influenzae
           F3031]
 gi|317450265|emb|CBY86481.1| exodeoxyribonuclease VII large subunit [Haemophilus influenzae
           F3047]
          Length = 439

 Score =  375 bits (963), Expect = e-101,   Method: Composition-based stats.
 Identities = 141/492 (28%), Positives = 235/492 (47%), Gaps = 57/492 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIW 69
           +    YSVS+L+   + ++E N   + + GEIS +     SGH Y +LKD ++++   ++
Sbjct: 1   MSDNIYSVSQLNSAARQMLEGNFCQIWLTGEISNFT-QPVSGHWYLTLKDENAQVRCAMF 59

Query: 70  KGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLE 129
           +    ++ F P+ G++ LV   ++ +     YQ+II+S+ P+G G L    E  K KL  
Sbjct: 60  RMKNLRVAFRPQNGMQVLVRANVSLYEPRGDYQLIIDSMHPAGEGLLQQQFEALKMKLAA 119

Query: 130 EGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPK 188
           EGLF+   K  +P   K + +ITS TGA ++DIL  ++ R P L+V+I+P  VQG E   
Sbjct: 120 EGLFAQNLKKNLPHFSKAVGIITSSTGAALQDILHILARRDPSLKVVIYPTAVQGKEATA 179

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           EI   I   N  +E       D++I+ RGGGS+EDLW FN+E + RAI  S++PIISA+G
Sbjct: 180 EIVQMIELANVRQE------VDVLIVGRGGGSLEDLWCFNEEEVARAIFRSTLPIISAVG 233

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HETD T+AD+ ADLRAPTP+ AAE+    ++ L   L + + RL+    RL   K  +L 
Sbjct: 234 HETDVTIADFVADLRAPTPSAAAELVSRNQDELLQQLRHQQQRLDMAFDRLFTRKSQSLK 293

Query: 309 SLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNI 366
            L   L   +    L   + + ++L   L+  +        + F  +  R+K + L + +
Sbjct: 294 QLTLRLQNQHPQNQLRAQQAKNEQLTHRLQLAILRQFENTQQKFTALSVRLKQNPLPYQV 353

Query: 367 QKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITR 426
           Q+++QH+ + Q                                                 
Sbjct: 354 QRHQQHLEQLQVR----------------------------------------------- 366

Query: 427 IEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRIL 486
           + F ++ ++      ++     L   +    L RGY+  ++     I   +++     I 
Sbjct: 367 LNFSINRQVTERQNKLATLCGKLDGLSPLKVLARGYSIAENPQGKAIVSVKDVNQGDFIT 426

Query: 487 INFFDGQANAIV 498
               DG+  + V
Sbjct: 427 TQVADGKIVSKV 438


>gi|152979434|ref|YP_001345063.1| exodeoxyribonuclease VII large subunit [Actinobacillus succinogenes
           130Z]
 gi|150841157|gb|ABR75128.1| exodeoxyribonuclease VII, large subunit [Actinobacillus
           succinogenes 130Z]
          Length = 448

 Score =  375 bits (963), Expect = e-101,   Method: Composition-based stats.
 Identities = 143/500 (28%), Positives = 233/500 (46%), Gaps = 57/500 (11%)

Query: 11  DHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           +   YSVS+L++  K ++E  L  V + GEIS +     SGH Y +LKD +S++ A +++
Sbjct: 3   NANIYSVSQLNHAAKMLLEGQLGLVWLTGEISNF-SQPVSGHWYLTLKDENSQVRAAMFR 61

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
               ++ F P+ GI+ LV   ++ +     YQ+IIES+ P+G G L    E+ K KL  E
Sbjct: 62  MKNMRVGFRPQNGIQVLVRAAVSLYEPRGDYQLIIESMHPAGEGLLQQQFEQLKMKLAAE 121

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKE 189
           GLF+   K  +P   K + VITSPTGA ++DIL  +  R P L+V+I+P  VQG E   E
Sbjct: 122 GLFAQNLKKNLPHFCKTVGVITSPTGAALQDILHILKRRDPNLKVVIYPCAVQGKEAAGE 181

Query: 190 IANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGH 249
           I   I   N  +E       D++I+ RGGGS+EDLW FN+E + RAI +S++P+ISA+GH
Sbjct: 182 IVEMIELANVRRE------VDVLIVGRGGGSLEDLWCFNEEAVARAIFDSTLPVISAVGH 235

Query: 250 ETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNS 309
           ETD T+AD+ AD+RAPTP+ AAE+    ++ L+  L     RL+  + R+I  +   L  
Sbjct: 236 ETDVTIADFVADVRAPTPSAAAELVSRNQDELRQQLNYKRQRLDMALDRIISLQHQRLQR 295

Query: 310 LLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQ 367
           L+  L   +    L+    R   L + L   +  ++ +       +  R++ + L + +Q
Sbjct: 296 LILRLQNQHPQNQLNIQSQRTALLTQRLTAAITRLMEKNRNKLTALATRLRQNPLPYRVQ 355

Query: 368 KNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRI 427
           K  Q++ +                                                   +
Sbjct: 356 KQCQYMEQLHAR-----------------------------------------------L 368

Query: 428 EFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILI 487
            F + + +      ++     L   +    L RGY+  Q+     +T    +     +  
Sbjct: 369 NFAVENNLSVRRHKLANLCGKLDGLSPLKVLARGYSIAQNEQGIAVTSIAQIRPDETLRT 428

Query: 488 NFFDGQANAIVINKAPPKEQ 507
              DG   + +         
Sbjct: 429 QVADGIIESRISKIKKKARS 448


>gi|332087956|gb|EGI93081.1| exodeoxyribonuclease VII, large subunit [Shigella boydii 5216-82]
          Length = 456

 Score =  375 bits (962), Expect = e-101,   Method: Composition-based stats.
 Identities = 144/506 (28%), Positives = 233/506 (46%), Gaps = 57/506 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+K P+P     + +ITS TGA + DIL  +  R P L  II+P  VQGD+ 
Sbjct: 122 QAEGLFDQQYKKPLPSPAHCVGMITSKTGAALHDILHVLKRRDPSLPAIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANQRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSARQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRAGQQQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +I                                         
Sbjct: 356 KIHRAQTRIQQLEYRLAEI----------------------------------------- 374

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +           L++ +  +TL RGY+    T+   + + + +     
Sbjct: 375 ------LRAQLSATRERFGNAVTHLEAVSPLSTLARGYSVTTATDRIVLKKVKQVKAGEM 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTK 510
           +     DG   + V N  P K+   K
Sbjct: 429 LTTRLEDGWIESEVKNIQPVKKSRKK 454


>gi|114797378|ref|YP_759647.1| exodeoxyribonuclease VII large subunit [Hyphomonas neptunium ATCC
           15444]
 gi|114737552|gb|ABI75677.1| exodeoxyribonuclease VII, large subunit [Hyphomonas neptunium ATCC
           15444]
          Length = 475

 Score =  375 bits (962), Expect = e-101,   Method: Composition-based stats.
 Identities = 183/528 (34%), Positives = 266/528 (50%), Gaps = 60/528 (11%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
            P     + +HPE +VSEL+  LK  +E+N   V VRGE+ G   I  SGH Y  LKD+ 
Sbjct: 8   QPMPDSPTTNHPELTVSELAASLKRTIETNYDQVTVRGEL-GRVTIAKSGHMYADLKDDK 66

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           + ++ I+W+G ++++ F PEEG+E +  G+++T+ G S YQ+I  ++ P+G+G L+  LE
Sbjct: 67  AVLNTIMWRGQVDRLTFRPEEGLEVVATGRLSTYEGRSAYQMIASTMRPAGAGALMQLLE 126

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKV 181
           +RKKKL  EGLF   HK PIP++P+ I VITSPTGAVIRDIL RI  RFP+RVI++P  V
Sbjct: 127 ERKKKLAAEGLFDQAHKKPIPYMPRTIGVITSPTGAVIRDILHRIRERFPVRVIVWPALV 186

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QG++   ++   I   N +       RPD++I+ARGGGSIEDLW FN+E++VRA   S I
Sbjct: 187 QGEQAASQVTAGIRGFNAMTGAD---RPDVLIVARGGGSIEDLWPFNEEVVVRAAFESEI 243

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P+ISA+GHETD TL DY +D RAPTPTGAAE+AVPV+  L   +     RL   + R + 
Sbjct: 244 PLISAVGHETDTTLIDYVSDRRAPTPTGAAEIAVPVRTELMLGIEESGQRLKRALTRALS 303

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
              +        LP  +  L   R RLD     L      +  R     + +   +    
Sbjct: 304 --RSRDKLAAARLPRPESLLQSKRQRLDFASASLPRAALALTQRARLKLSRLQ--LSPAT 359

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIK 421
           L   I+  RQ + +        +                                     
Sbjct: 360 LKAEIRGQRQRLRDTAVRARPALM------------------------------------ 383

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLAT 481
                        I     +++   ++L++ +Y+ TLKRGY  ++DT    +       T
Sbjct: 384 -----------RLIDQKKAALTSEGKLLETLSYQATLKRGYVIVRDTGGQLVRNAAQAQT 432

Query: 482 KTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
              + + F DG   A     AP + +             ++G QG LF
Sbjct: 433 LDTLRVTFADGDITA-----APFEGETPPPAPKPKPAPRRKGEQGNLF 475


>gi|37678958|ref|NP_933567.1| exodeoxyribonuclease VII large subunit [Vibrio vulnificus YJ016]
 gi|37197700|dbj|BAC93538.1| exonuclease VII, large subunit [Vibrio vulnificus YJ016]
          Length = 461

 Score =  375 bits (962), Expect = e-101,   Method: Composition-based stats.
 Identities = 145/495 (29%), Positives = 238/495 (48%), Gaps = 57/495 (11%)

Query: 7   KNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDA 66
            +  +   ++VS L+  ++ ++E+ L  V + GEIS +     SGH YF+LKD+ +++  
Sbjct: 20  SSLTNPNIFTVSRLNSEVRLLLENQLGIVWLVGEISNFSA-PVSGHWYFTLKDSMAQVKC 78

Query: 67  IIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKK 126
            +++G    + F P  G + LV  +++ +     YQ+IIES+ P G G L    +  K K
Sbjct: 79  AMFRGNNRLVSFKPTNGNQVLVKARLSLYEPRGDYQLIIESMQPEGDGRLQQQFDALKMK 138

Query: 127 LLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDE 185
           L  EGLF+   K  IP  PK + +ITS TGA + DIL  +  R P L V+I+P  VQG+E
Sbjct: 139 LASEGLFAQSSKQAIPEHPKCVGIITSKTGAALYDILDVLKRRDPSLPVVIYPTLVQGEE 198

Query: 186 CPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIIS 245
              +IA AI + N+  E       D++I+ RGGGS+EDLW FN+E++ R IA S IPIIS
Sbjct: 199 AAIQIAQAIGRANSRNE------CDVLIVGRGGGSLEDLWCFNNEIVARTIAASQIPIIS 252

Query: 246 AIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKIN 305
           A+GHE D T+AD+ ADLRAPTP+ AAE+      H   +LI+ E +L       +  +  
Sbjct: 253 AVGHEIDVTIADFVADLRAPTPSAAAELVSRDNSHKDQALISREQKLRAAWRHYLTEQNR 312

Query: 306 TLNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLI 363
           T+ SL   L   +    L     + D L   L+  +E  + ++ +  + + ++++    +
Sbjct: 313 TIVSLSHRLEKQHPRYRLMRQTQQADELQIRLQRAMEKYLAQREQKVSRVQHKLQLLSPV 372

Query: 364 HNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKL 423
             I + +  +   +Q +   +                                       
Sbjct: 373 RQISEQKNALARVEQKMMDAM--------------------------------------- 393

Query: 424 ITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKT 483
                     K+      ++I    L + +   TLKRGY+  Q  +   IT++  + T  
Sbjct: 394 --------DRKLLRLRHQIAIAAEKLDTVSPLATLKRGYSITQSESGEVITRQSQIKTGD 445

Query: 484 RILINFFDGQANAIV 498
            ++    DG+  + V
Sbjct: 446 TLVTRLSDGEIRSTV 460


>gi|163853273|ref|YP_001641316.1| exodeoxyribonuclease VII, large subunit [Methylobacterium
           extorquens PA1]
 gi|163664878|gb|ABY32245.1| exodeoxyribonuclease VII, large subunit [Methylobacterium
           extorquens PA1]
          Length = 522

 Score =  375 bits (962), Expect = e-101,   Method: Composition-based stats.
 Identities = 202/549 (36%), Positives = 284/549 (51%), Gaps = 68/549 (12%)

Query: 2   NPFSQKN-SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
            P        + PE+SV +L+  LK  +E    HV +RGEI+GYRG H SGHAYFSLKD 
Sbjct: 21  EPAPSAVLQANTPEWSVGDLAAALKRTLEDAFGHVRLRGEITGYRGPHGSGHAYFSLKDG 80

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            ++IDA++WKG L ++   P+EG+E +  GKITTF G S YQI+I+S+ P+G G  +  L
Sbjct: 81  SAKIDAVVWKGVLGRLRQKPKEGLEVVATGKITTFAGKSSYQIVIDSMEPAGIGAWMALL 140

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           E+RK++L  EGLF    K PIPF+P++I V+TSPTGAVIRDIL R+  RFP  V+++PV+
Sbjct: 141 EERKRQLAAEGLFETDRKRPIPFLPRVIGVVTSPTGAVIRDILHRLEDRFPRPVLVWPVR 200

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQG+   +EIA AI   N L      PRPD++I+ARGGGSIEDLW FN+E +VRA A S 
Sbjct: 201 VQGEGAAEEIAAAIRGFNALSPDGPIPRPDVLIVARGGGSIEDLWAFNEEAVVRAAAESE 260

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP+ISA+GHETD TL D+A+D RAPTPTGAAEMAVPV+  L + +  L AR    ++R I
Sbjct: 261 IPLISAVGHETDTTLIDFASDRRAPTPTGAAEMAVPVRTELSAQIHELGARQAGTMLRRI 320

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           + +     +L++A+P +D  L+  R RLD                       + +     
Sbjct: 321 ERERADFRALVRAIPGADAFLAVKRQRLD-----------------------LADARLRP 357

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420
            L  N + +R+ +      + +      R   +   E  A L  +  + +  +  +    
Sbjct: 358 ALAANARDSRERLNRVADRLTR------RSPAIALAEARARLAAIDHRPRTAMSRIVER- 410

Query: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480
                                +   T +L + +YK  L RGY  ++D +   +      A
Sbjct: 411 -----------------RRDRLDALTSLLGALSYKAVLARGYALVRDADGLPVRSAAAAA 453

Query: 481 TKTRILINFFDGQANAIVIN-----KAPPKEQPTKKCQLHNNKRE--------------- 520
              R  + F DG   A          APP  +     +     R                
Sbjct: 454 RAARFQLQFADGAIFARPEEAPDDPVAPPLAEAPPSPRPKRAPRRAAPEPAPKPEKAAAE 513

Query: 521 KQGTQGELF 529
               QG LF
Sbjct: 514 PAARQGSLF 522


>gi|89094125|ref|ZP_01167068.1| exodeoxyribonuclease VII large subunit [Oceanospirillum sp. MED92]
 gi|89081600|gb|EAR60829.1| exodeoxyribonuclease VII large subunit [Oceanospirillum sp. MED92]
          Length = 452

 Score =  374 bits (961), Expect = e-101,   Method: Composition-based stats.
 Identities = 142/493 (28%), Positives = 234/493 (47%), Gaps = 55/493 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIW 69
             +   SVSEL+   + ++E +   + V GEIS +    SSGH YF+LKD+ +++   ++
Sbjct: 11  TSNHALSVSELNRQARLLLERSFLTIEVTGEISNFV-KPSSGHWYFTLKDDKAQVRCAMF 69

Query: 70  KGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLE 129
           K     I F P++G + +V  K++ + G   YQ+I E +   G G+L  A E+ K KL +
Sbjct: 70  KNRNQLIRFSPKQGDQVVVRAKVSLYEGRGDYQLICEFMSQDGGGSLQAAYEELKLKLNQ 129

Query: 130 EGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPK 188
           EGLF ++HK P+P  P  I V+TSPTGA I DIL  +  RFP L V ++P  VQG++ P 
Sbjct: 130 EGLFGNEHKKPLPEHPARIGVVTSPTGAAIHDILTVLKRRFPGLPVTLYPTAVQGEDAPA 189

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           +I  AI+     +E       D++I+ RGGGS+EDLW FN E + R I +  IP+ISA+G
Sbjct: 190 QICKAIILAEAHQE------CDVLIVGRGGGSLEDLWPFNTEPVARTIFDCEIPVISAVG 243

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HE D  ++DY AD+RAPTP+ AAE+  P +  L+  L     RL   +  +I+   N + 
Sbjct: 244 HEVDTVISDYVADVRAPTPSAAAELISPDQHQLKLRLRQQSERLQRQLNSVIQDANNRIY 303

Query: 309 SLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQK 368
           +L   L +  Q L     RLD L   L+   ++ +  +     ++  R++++     + +
Sbjct: 304 NLKSRLRHPGQQLREKAQRLDHLEIRLQQAAQLSLSGRKCRIENLRTRLQANTPQQRLLQ 363

Query: 369 NRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIE 428
           + + I   +  + Q +                                   ++    ++ 
Sbjct: 364 HSERIKNFKSRLAQGILH--------------------------------KLEFNRQQLN 391

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
                               L + +   TL+RGY  +QD     +T   + +   +I   
Sbjct: 392 KA---------------AAQLNTVSPLATLERGYAIVQDQQGKVLTDTHDSSVGDQIEAR 436

Query: 489 FFDGQANAIVINK 501
              G+    +   
Sbjct: 437 LHQGRMKCTINEI 449


>gi|323971078|gb|EGB66326.1| exodeoxyribonuclease VII [Escherichia coli TA007]
          Length = 447

 Score =  374 bits (961), Expect = e-101,   Method: Composition-based stats.
 Identities = 142/498 (28%), Positives = 230/498 (46%), Gaps = 57/498 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQYKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPAAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANQRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFTSRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSTRQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRTGQQQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +                                          
Sbjct: 356 KIHRAQTRIQQLEYRLAE------------------------------------------ 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +           L++ +  +TL RGY+    T+ N + + + +     
Sbjct: 374 -----TLRAQLSATRERFGNAVTHLEAVSPLSTLARGYSVTTATDGNVLKKVKQVKAGEM 428

Query: 485 ILINFFDGQANAIVINKA 502
           +     DG   + V   +
Sbjct: 429 LTTRLEDGWIESEVKTSS 446


>gi|84387647|ref|ZP_00990664.1| exodeoxyribonuclease VII large subunit [Vibrio splendidus 12B01]
 gi|84377492|gb|EAP94358.1| exodeoxyribonuclease VII large subunit [Vibrio splendidus 12B01]
          Length = 448

 Score =  374 bits (961), Expect = e-101,   Method: Composition-based stats.
 Identities = 136/500 (27%), Positives = 234/500 (46%), Gaps = 57/500 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIW 69
            +   ++VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++   ++
Sbjct: 2   TNPNIFTVSRLNSEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSRAQVKCAMF 60

Query: 70  KGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLE 129
           +G   ++ F P+ G + LV  +++ +     YQ+IIES+ P G G L    EK K  L  
Sbjct: 61  RGNNRRVTFKPQNGNQVLVKARLSLYEPRGDYQLIIESMQPEGDGKLQQEFEKLKMNLAA 120

Query: 130 EGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPK 188
           EGLF+   K  +P  PK + VITS TGA + DIL  +  R P L VI++P  VQG+    
Sbjct: 121 EGLFAQSSKQILPEHPKCVGVITSKTGAALFDILDILKRRDPSLPVIVYPTMVQGEGASI 180

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           +IA AI + N   E       D++I+ RGGGS+EDLW FN+E++ R IA S IPIISA+G
Sbjct: 181 QIAQAIGRANERDE------CDVLIVGRGGGSLEDLWCFNNEIVARTIAASQIPIISAVG 234

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HE D T+AD+ AD+RAPTP+ AAE+      H + +  +  ARL + I  ++  +  +  
Sbjct: 235 HEIDVTIADFVADMRAPTPSAAAELVSRDNSHKEQAYASKRARLVSAIRHVLIKQAQSTQ 294

Query: 309 SLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNI 366
           +L   L   +    L     +LD L   L   +   + +  +      ++++ +  +  +
Sbjct: 295 TLKYRLEKQHPSYQLQKQSQQLDDLDMRLRRGMTQYLKQHAQRVERKQHQLQLNSPVKRL 354

Query: 367 QKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITR 426
            + + H+   +Q                                               +
Sbjct: 355 GEQKLHLQRSEQ-----------------------------------------------K 367

Query: 427 IEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRIL 486
           +   +   + +    +++    L++ +   TLKRGY+     ++  ++   ++     I 
Sbjct: 368 LLDAMDKTLLTTRHQLAMAAEKLETVSPLATLKRGYSITHSASSKTVSSINDVEVGEVIT 427

Query: 487 INFFDGQANAIVINKAPPKE 506
               DG   + V       E
Sbjct: 428 TQVEDGVIESQVTTSVAKSE 447


>gi|126668435|ref|ZP_01739392.1| exodeoxyribonuclease VII, large subunit [Marinobacter sp. ELB17]
 gi|126627144|gb|EAZ97784.1| exodeoxyribonuclease VII, large subunit [Marinobacter sp. ELB17]
          Length = 449

 Score =  374 bits (961), Expect = e-101,   Method: Composition-based stats.
 Identities = 153/499 (30%), Positives = 226/499 (45%), Gaps = 56/499 (11%)

Query: 4   FSQKNSLDHP-EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHS 62
            +       P   SVSEL++  +H++E++   V V GE+SG+    SSGH YFSLKD + 
Sbjct: 1   MNDAFQDTRPRALSVSELNHQARHLLETSFMQVWVEGELSGF-SRPSSGHWYFSLKDRNC 59

Query: 63  RIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEK 122
           +I   +++G   ++   P+EG    + GK+T +     +QII+E L P+G+G L  A E 
Sbjct: 60  QIRCAMFRGANQRVRPAPKEGELVRIRGKVTLYENRGDFQIIVEHLEPAGAGALQQAFEA 119

Query: 123 RKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKV 181
            K KL  EGLFS + K PIP +P+ I V+TSPTGA I DIL  ++ R P + V ++P  V
Sbjct: 120 LKLKLFNEGLFSTERKKPIPALPRHIGVVTSPTGAAIHDILTVLARRCPGIPVTLYPTAV 179

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QG     +I  AI +           R D++I+ RGGGS+EDLW FN+E + RAIA   I
Sbjct: 180 QGQAATADIVAAIGRAVA------HNRADVLIIGRGGGSLEDLWCFNEEAVARAIAACPI 233

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
             +SA+GHE D T+ADY ADLRAPTP+ AAE   P +      L  +  RL   + R   
Sbjct: 234 ATVSAVGHEVDTTIADYVADLRAPTPSAAAEKISPDQSIWLRQLQAISERLQAAMGRQHT 293

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
              N L  L   L +  ++L     RLD L   L   +  +  R +   +H+  R+    
Sbjct: 294 ALENRLLQLSTRLKDPRRSLQEKAQRLDGLDLRLSRAMAQLTQRLHMRTDHLQQRLAMQS 353

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIK 421
               +    + +L     +                                         
Sbjct: 354 PNRQLASAGERVLRATTGLNLA-------------------------------------- 375

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLAT 481
                I+  L  +       +  T + L   +   TL RGY  ++D     +     L  
Sbjct: 376 -----IQQALKSR----REQLDYTAQTLNLVSPLATLGRGYAIVKDDQGKIVRHAGQLEA 426

Query: 482 KTRILINFFDGQANAIVIN 500
              I     +G  +A V +
Sbjct: 427 GQAISARVANGTVHAQVTS 445


>gi|90579807|ref|ZP_01235615.1| exodeoxyribonuclease VII large subunit [Vibrio angustum S14]
 gi|90438692|gb|EAS63875.1| exodeoxyribonuclease VII large subunit [Vibrio angustum S14]
          Length = 449

 Score =  374 bits (961), Expect = e-101,   Method: Composition-based stats.
 Identities = 137/502 (27%), Positives = 238/502 (47%), Gaps = 57/502 (11%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M  FS ++  +   Y+VS L+  ++ ++E+ +  V + GE+S +  +  SGH YF+LKD+
Sbjct: 1   MTTFSPQSQTNSRIYTVSSLNAQVRLVLENEMGVVWLIGELSNF-SMPVSGHWYFTLKDS 59

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            +++   ++KG+   + F P  G + LV  +++ +     YQ+IIES+ P G G L    
Sbjct: 60  RAQVKCAMFKGSNRHVTFKPANGNQVLVKARLSLYEPRGDYQLIIESMQPEGDGRLQQQF 119

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPV 179
           E+ K  L  EGLF+   K  +P  PK + +ITS TGA + DILQ +  R P L ++I+P 
Sbjct: 120 EQLKMSLAAEGLFAQSLKQTLPEQPKRVGIITSKTGAALHDILQVLQRRDPSLPIVIYPT 179

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
            VQG+     IA AI + N  +E       D++I+ RGGGS+EDLW FN+E++ R IA S
Sbjct: 180 MVQGEGSAISIAQAIGRANARQE------CDVLIIGRGGGSLEDLWAFNEEIVARTIAAS 233

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
            IPI+SA+GHE D T+AD+ AD+RAPTP+ AAE+      H    L   + +L + I   
Sbjct: 234 QIPIVSAVGHEVDVTIADFVADVRAPTPSAAAELISRDMTHQTQLLDRKKQQLRHAIRSY 293

Query: 300 IKYKINTLNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRI 357
           +   +     L   L   +    L+  +  LD + + L   ++  I +  +H +    +I
Sbjct: 294 LSQSLRQATQLQHRLERQHPQLRLNQQQQHLDEISQRLIQAMQKKIQKHQQHIDSNNYKI 353

Query: 358 KSDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLH 417
                   +   ++++   ++                                       
Sbjct: 354 SLYSPATLVSNAQRNLERSERR-------------------------------------- 375

Query: 418 THIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKR 477
                    +   L  K+ +    +++    L++ +   TL RGY+  ++   + I    
Sbjct: 376 ---------LYDALDRKLLNAKHKLAVAAEKLETVSPLATLARGYSITRNEQGDVIRNTS 426

Query: 478 NLATKTRILINFFDGQANAIVI 499
            +    +++    DG  ++ +I
Sbjct: 427 QVKHGDKLITTVTDGDIHSCII 448


>gi|118580820|ref|YP_902070.1| exodeoxyribonuclease VII large subunit [Pelobacter propionicus DSM
           2379]
 gi|118503530|gb|ABL00013.1| Exodeoxyribonuclease VII large subunit [Pelobacter propionicus DSM
           2379]
          Length = 475

 Score =  374 bits (961), Expect = e-101,   Method: Composition-based stats.
 Identities = 161/527 (30%), Positives = 255/527 (48%), Gaps = 64/527 (12%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M+ FS+K        +VS L+  L+ ++E N   V V+GE+S +    SSGH YFSLKD+
Sbjct: 1   MDLFSEKI-----ILTVSRLTSLLRDVLEENFQQVWVQGEVSNFSS-PSSGHFYFSLKDS 54

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            +++  +++KG    ++F P +G+  +  G+I+ +     YQ+I E L P+G G L  A 
Sbjct: 55  GAQLRCVMFKGAARNLKFRPGDGMALIARGRISVYDQRGDYQLICEYLEPAGVGALQAAF 114

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRF-PLRVIIFPV 179
           ++ K++L  EGLF   HK  +PF P+ + VITS TGA I DIL  +  RF  L ++++PV
Sbjct: 115 QQLKERLAREGLFDQAHKRHLPFFPRRLGVITSATGAAIHDILNVLRRRFASLEILLYPV 174

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
           +VQG+    EIA A+ ++N L+        D++I+ RGGGS+EDLW FN+E++ RA+  S
Sbjct: 175 RVQGEGAGLEIARAVEEMNRLQMA------DVLIVGRGGGSLEDLWAFNEEVLARALYRS 228

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
           +IP+ISA+GHETDWT+AD+ ADLRAPTP+ AAE+ V   + L+  +  LE RL   +   
Sbjct: 229 AIPVISAVGHETDWTIADFVADLRAPTPSAAAELVVASADELRGRVEGLEHRLGLAMESR 288

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
           +    + + SL + L +   TL     R+D L   LE  L   + R    F+ +   +  
Sbjct: 289 LSTLESRVASLRRLLADPSATLGHLAQRVDDLTERLELGLHNGVMRLKERFDRLDRLLMQ 348

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH 419
              +  +++ RQ +L    H E                                      
Sbjct: 349 HSPLARVEQLRQRLLLLVSHGE-------------------------------------- 370

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSI-QDTNNNFITQKRN 478
                      +  +++    +       L+  +   TL RGY+   +  +   I+    
Sbjct: 371 ---------RSMLLRLEGDKQAFGAAAARLEVLSPLATLSRGYSITSRQQDGRVISDASQ 421

Query: 479 LATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQ 525
           L     + +    G A+  V     P E    K   H +  E    Q
Sbjct: 422 LKMGELLDVRLRHGAAHCRVEGVQLPTE---PKPLTHADDSEILSDQ 465


>gi|260582339|ref|ZP_05850132.1| exodeoxyribonuclease VII, large subunit [Haemophilus influenzae
           NT127]
 gi|260094707|gb|EEW78602.1| exodeoxyribonuclease VII, large subunit [Haemophilus influenzae
           NT127]
          Length = 443

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 142/495 (28%), Positives = 235/495 (47%), Gaps = 58/495 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           N++    YSVS+L+   + I+E + S + + GEIS +     SGH Y +LKD ++++   
Sbjct: 2   NNMSDNIYSVSQLNSAARQILEGHFSQIWLTGEISNFT-QPVSGHWYLTLKDENAQVRCA 60

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++     + F P+ G++ LV   ++ +     YQ+II+S+ P+G G L    E  K KL
Sbjct: 61  MFRMKNLHVAFRPQNGMQVLVRANVSLYEPRGDYQLIIDSMHPAGEGLLQQQFEALKMKL 120

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF+   K  +P   K + +ITS TGA ++DIL  ++ R P L+VII+P  VQG E 
Sbjct: 121 ATEGLFAQNLKKNLPHFSKAVGIITSSTGAALQDILHILARRDPSLKVIIYPTAVQGKEA 180

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFN-DEMIVRAIANSSIPIIS 245
             EI   I   N  +E       D++I+ RGGGS+EDLW FN +E + RAI  S++PIIS
Sbjct: 181 TAEIVQMIELANVRQE------VDVLIVGRGGGSLEDLWCFNEEEEVARAIFRSTLPIIS 234

Query: 246 AIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKIN 305
           A+GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   L + + RL+    RL   K  
Sbjct: 235 AVGHETDVTIADFVADLRAPTPSAAAELVSRNQDELLQQLRHQQQRLDMAFDRLFTRKSQ 294

Query: 306 TLNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLI 363
            L  L   L   +    L   + + ++L   L+  +        + F  + +R+K + L 
Sbjct: 295 RLKQLALRLHNQHPQNQLRAQQAKNEQLTHRLQLAMLRQFENTQQKFTALSSRLKQNPLP 354

Query: 364 HNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKL 423
           + +Q+++Q + + Q                                              
Sbjct: 355 YRVQRHQQRLEQLQVR-------------------------------------------- 370

Query: 424 ITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKT 483
              +   ++ ++      ++     L   +    L RGY+  ++     I   +++    
Sbjct: 371 ---LNICVNRQVTERQNKLATLCGKLDGLSPLKVLARGYSIAENPQGKAIVSVKDVNQGD 427

Query: 484 RILINFFDGQANAIV 498
            I     DG+  + V
Sbjct: 428 FITTQVADGKIVSKV 442


>gi|323156163|gb|EFZ42322.1| exodeoxyribonuclease VII, large subunit [Escherichia coli EPECa14]
          Length = 456

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 143/506 (28%), Positives = 233/506 (46%), Gaps = 57/506 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDLQYKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +   AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQTVRAIELANQRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSTRQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRTGQQQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + + ++                                       
Sbjct: 356 KIHRAQTRIQQLEYRLAETLRV-------------------------------------- 377

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                    ++ +           L++ +  +TL R Y+    T+ N + + + +     
Sbjct: 378 ---------QLSATRERFGNAVTHLEAVSPLSTLAREYSVTTATDGNVLKKVKQVKAGEM 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTK 510
           +     DG   + V N  P K+   K
Sbjct: 429 LTTRLEDGWIESEVKNIQPVKKSRKK 454


>gi|170767575|ref|ZP_02902028.1| exodeoxyribonuclease VII, large subunit [Escherichia albertii
           TW07627]
 gi|170123909|gb|EDS92840.1| exodeoxyribonuclease VII, large subunit [Escherichia albertii
           TW07627]
          Length = 457

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 142/504 (28%), Positives = 230/504 (45%), Gaps = 57/504 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    SSGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEQEMGQVWISGEISNF-SQPSSGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQFKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANIRGE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + + + RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSAQQRLEMAMDYYLANRARR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + +  +    +I R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTALERLQKRMSFALENQLKQANQQQQRLIQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
           +I + +  I + +                                               
Sbjct: 356 HIHRAQTRIQQLEYR--------------------------------------------- 370

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
             +   L  ++             L++ +  +TL RGY+     + + + Q + +     
Sbjct: 371 --LTETLRAQLGDTRERFGNAVTHLEAVSPLSTLARGYSVTSAADGSVLKQVKQVKAGDT 428

Query: 485 ILINFFDGQANAIVINKAPPKEQP 508
           +     DG   + V      ++  
Sbjct: 429 LTTRLGDGVVVSEVSAVKRSRKPR 452


>gi|296282929|ref|ZP_06860927.1| exodeoxyribonuclease VII large subunit [Citromicrobium
           bathyomarinum JL354]
          Length = 491

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 187/526 (35%), Positives = 262/526 (49%), Gaps = 49/526 (9%)

Query: 4   FSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSR 63
            + +   +    SVS+LS  LK +VE     V +RGE+SG +   +SGH Y SLKD+ S 
Sbjct: 15  ANSRPGDNSEPLSVSDLSRSLKRVVEDRFGFVRIRGELSGVK-RAASGHLYCSLKDDKSV 73

Query: 64  IDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKR 123
           ID ++WK    ++ F PE+G+E +  GK+TT+ G SKYQI+IE +  +G G LL  LEK 
Sbjct: 74  IDGVMWKSAAPRLAFRPEDGVEVIASGKVTTYAGRSKYQIVIERMELAGEGALLALLEKT 133

Query: 124 KKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQG 183
           K +L  EGLF+D  K P+PF+P+ I V+TSPTGAVIRDIL R+S RFP  VI++PV VQG
Sbjct: 134 KARLEAEGLFADARKKPLPFLPRTIGVVTSPTGAVIRDILHRLSDRFPSHVIVWPVVVQG 193

Query: 184 DECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPI 243
           +    +++ A+   N L+ G    RPD++I+ARGGGSIEDLW FN+E +VRAIA S IP+
Sbjct: 194 ETAKGQVSAAVRGFNALERGGAIARPDLLIVARGGGSIEDLWAFNEEEVVRAIAESEIPV 253

Query: 244 ISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYK 303
           ISA+GHETD TLAD+AAD RAPTPT AAE AVPV+  L + + +L AR      R +   
Sbjct: 254 ISAVGHETDTTLADFAADHRAPTPTAAAERAVPVRAELAAGIADLGARQMRCATRPVALG 313

Query: 304 INTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLI 363
              L +  + LP  D  L  +   LD         L   +            R+    L 
Sbjct: 314 RERLEACSQRLPRPDALLQAAAQALDDAIERHRRALVDRVAIGRATLGEAAARLSPATLN 373

Query: 364 HNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKL 423
             + + R+                                        R+ ++      L
Sbjct: 374 WRLGQARE----------------------------------------RLEHVRLMPATL 393

Query: 424 ITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKT 483
            TR               ++    +L+S      L+RGY  + D     +    +  T  
Sbjct: 394 TTRHARATER--------LAANVAMLRSLDPDAPLQRGYAMVFDGQGALVRSAGDARTAG 445

Query: 484 RILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
            + + F DG+  A   +  PP   P    +           QG+LF
Sbjct: 446 TLSLKFADGRVAASTGDAPPPPATPAPAPKPRRKSPPPPSGQGDLF 491


>gi|152976584|ref|YP_001376101.1| exodeoxyribonuclease VII large subunit [Bacillus cereus subsp.
           cytotoxis NVH 391-98]
 gi|189037856|sp|A7GSJ8|EX7L_BACCN RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|152025336|gb|ABS23106.1| exodeoxyribonuclease VII, large subunit [Bacillus cytotoxicus NVH
           391-98]
          Length = 451

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 155/498 (31%), Positives = 243/498 (48%), Gaps = 59/498 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVE--SNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           ++    +V+ L+ ++K  +E   +L  V ++GEIS ++  HS GH YF+LKD ++RI A+
Sbjct: 1   MEKQYLTVTALTRYIKTKIEYDPHLQSVWLKGEISNFK-YHSRGHMYFTLKDENARIAAV 59

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           ++ G    I+F PE+G++ LV GKI+ +  S  YQI +  + P G G L  A E+ K +L
Sbjct: 60  MFAGHNRNIKFRPEDGMKVLVKGKISVYEASGSYQIYVHDMQPDGVGNLHLAYEQLKVRL 119

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDEC 186
            EEGLFS  +K PIP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+  
Sbjct: 120 EEEGLFSRVYKQPIPAYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGEFA 179

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
              I  AI   N           D++I+ RGGGSIE+LW FN+E++ RAI  S IPIISA
Sbjct: 180 APSIVQAIQTAN------EMNDIDVLIVGRGGGSIEELWAFNEEIVARAIFASKIPIISA 233

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD+T+AD+ ADLRAPTPT AAE+AVP    +Q  ++    RL   +  ++  +   
Sbjct: 234 VGHETDFTIADFVADLRAPTPTAAAELAVPNILEMQEKVLQRTLRLQRAMREIVHKRQER 293

Query: 307 LNSLLKA--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
           L +L K+       Q       +LDR   +L    E  + +K      +   ++      
Sbjct: 294 LQTLQKSYAFRYPRQIYEQKEEQLDRALEQLVLAKERYMEKKVNQLKQLSFYLEKHHPAQ 353

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I   Q+ + +                                          
Sbjct: 354 RISQTKIAIETLQKQLRRE----------------------------------------- 372

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 +   +++   +     + L++ +    + RGY  +    N  +   ++++    
Sbjct: 373 ------MQTVLQTKEFAFVRIAKQLEALSPLKVMMRGYGLVYSEKNQVLKSVKDVSAGDV 426

Query: 485 ILINFFDGQANAIVINKA 502
           + +   DG  +  V +  
Sbjct: 427 VSVQLQDGILDCNVSSVK 444


>gi|319408943|emb|CBI82600.1| exodeoxyribonuclease VII large subunit [Bartonella schoenbuchensis
           R1]
          Length = 471

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 212/530 (40%), Positives = 309/530 (58%), Gaps = 60/530 (11%)

Query: 1   MNPFSQKN-SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKD 59
           M+ FS +  + +  E+SVSE+S  LK I+E   +++ VRGEISGYRG+H+SGHAYF+LKD
Sbjct: 1   MDLFSPRPVATNVAEFSVSEVSSALKRIIEDKFAYIRVRGEISGYRGVHASGHAYFALKD 60

Query: 60  NHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTA 119
           + +R++A+IW+  + K++F PEEG+E + +GK+TT+PGSSKYQI+I++L P+G G L+T 
Sbjct: 61  DKARLEAVIWRSLMEKLKFPPEEGMEVIAVGKLTTYPGSSKYQIVIDALEPTGVGALMTL 120

Query: 120 LEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPV 179
           LE RKKKL +EGLF +  K P+P++P+II V+TSPTGAVI DI+ RIS RFPL ++++PV
Sbjct: 121 LENRKKKLADEGLFDEAKKRPLPYMPQIIGVVTSPTGAVIHDIIHRISDRFPLHILVWPV 180

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
           +VQG+   +E+A AI   N L  G    +PD+II+ARGGGS+EDLW FNDE +VRA+  S
Sbjct: 181 RVQGETSGREVACAIEGFNALPLGGVLLKPDLIIVARGGGSLEDLWGFNDEAVVRAVHAS 240

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
           +IP+ISA+GHETDWTL DYAAD RAPTPTGAAE AVPVK  L+  L +L ARL   + R 
Sbjct: 241 TIPVISAVGHETDWTLIDYAADWRAPTPTGAAERAVPVKIDLEVQLASLGARLRAGLTRY 300

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
             +    L ++ + L  +DQ L+  R   D +   L+  L I   +K  +F  +  R   
Sbjct: 301 FSFHQQKLRAISRGLLTADQLLALPRRGFDEISSRLQRALCISYEKKLFYFRALSVRFSP 360

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH 419
             L  N +K R ++     H+ +                                     
Sbjct: 361 RLL--NSEKARYNVKGYTIHLRRAFL---------------------------------- 384

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
                          ++       +  R+L+S +Y+N L+RG+      +N  + +   L
Sbjct: 385 -------------RNVEKQRAQAEMAFRLLKSTSYQNILERGFVLALGQDNKPVKRLVQL 431

Query: 480 ATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
               R+ + FFDG+ N   +N A            +   ++++  QG LF
Sbjct: 432 PKTGRMSLRFFDGEINVSTLNCA----------SKNKRIKQQKDDQGTLF 471


>gi|86145602|ref|ZP_01063932.1| exodeoxyribonuclease VII large subunit [Vibrio sp. MED222]
 gi|85836573|gb|EAQ54699.1| exodeoxyribonuclease VII large subunit [Vibrio sp. MED222]
          Length = 448

 Score =  373 bits (958), Expect = e-101,   Method: Composition-based stats.
 Identities = 136/500 (27%), Positives = 235/500 (47%), Gaps = 57/500 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIW 69
            +   ++VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++   ++
Sbjct: 2   TNPNIFTVSRLNSEVRLLLENEMGIVWLVGEISNFSA-PVSGHWYLTLKDSRAQVKCAMF 60

Query: 70  KGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLE 129
           +G   ++ F P+ G + LV  +++ +     YQ+IIES+ P G G L    EK K  L  
Sbjct: 61  RGNNRRVTFKPQNGNQVLVKARLSLYEPRGDYQLIIESMQPEGDGKLQQEFEKLKMNLAA 120

Query: 130 EGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPK 188
           EGLF+   K  +P  PK + VITS TGA + DIL  +  R P L VI++P  VQG+    
Sbjct: 121 EGLFAQSSKQILPEHPKCVGVITSKTGAALFDILDVLKRRDPSLPVIVYPTMVQGEGASI 180

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           +IA AI + N   E       D++I+ RGGGS+EDLW FN+E++ R IA S IPIISA+G
Sbjct: 181 QIAQAIGRANERNE------CDVLIVGRGGGSLEDLWCFNNEIVARTIAASQIPIISAVG 234

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HE D T+AD+ AD+RAPTP+ AAE+      H + +  +  ARL + I  ++  +  +  
Sbjct: 235 HEVDVTIADFVADMRAPTPSAAAELVSRDNSHKEQAYASKRARLVSAIRHVLIKQAQSTQ 294

Query: 309 SLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNI 366
           +L   L   +    L     +LD L   L   +   + +  +      ++++ +  +  +
Sbjct: 295 TLKYRLEKQHPSYQLQKQSQQLDDLDMRLRRGMTQYLKQHAQRVERKQHQLQLNSPVKRL 354

Query: 367 QKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITR 426
            + + H+   +Q                                               +
Sbjct: 355 GEQKLHLQRSEQ-----------------------------------------------K 367

Query: 427 IEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRIL 486
           +   +   + +    +++    L++ +   TLKRGY+     ++  ++   ++     I 
Sbjct: 368 LLDAMDKTLLTTRHQLAMAAEKLETVSPLATLKRGYSITHSASSKTVSSINDVEIGEVIT 427

Query: 487 INFFDGQANAIVINKAPPKE 506
               DG   + V  +    E
Sbjct: 428 TQVEDGVIESQVTTRVAKSE 447


>gi|89073114|ref|ZP_01159653.1| exodeoxyribonuclease VII large subunit [Photobacterium sp. SKA34]
 gi|89051067|gb|EAR56524.1| exodeoxyribonuclease VII large subunit [Photobacterium sp. SKA34]
          Length = 449

 Score =  373 bits (958), Expect = e-101,   Method: Composition-based stats.
 Identities = 139/502 (27%), Positives = 238/502 (47%), Gaps = 57/502 (11%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M  FS ++  +   Y+VS L+  ++ ++E+ +  V + GE+S +  +  SGH YF+LKD+
Sbjct: 1   MTTFSPQSQKNSRIYTVSSLNAQVRLVLENEMGVVWLIGELSNF-SMPVSGHWYFTLKDS 59

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            +++   ++KG+   + F P  G + LV  +++ +     YQ+IIES+ P G G L    
Sbjct: 60  RAQVKCAMFKGSNRHVTFKPANGNQVLVKARLSLYEPRGDYQLIIESMQPEGDGRLQQQF 119

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPV 179
           E+ K  L  EGLF+   K  +P  PK + +ITS TGA + DILQ +  R P L ++I+P 
Sbjct: 120 EQLKMSLAAEGLFAQSLKQTLPEQPKRVGIITSKTGAALHDILQVLQRRDPSLPIVIYPT 179

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
            VQG+     IA AI + N  +E       D++I+ RGGGS+EDLW FN+E++ R IA S
Sbjct: 180 MVQGEGSAISIAQAIGRANARQE------CDVLIVGRGGGSLEDLWAFNEEIVARTIAAS 233

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
            IPI+SA+GHE D T+AD+ AD+RAPTP+ AAE+      H    L   + +L + I   
Sbjct: 234 QIPIVSAVGHEVDVTIADFVADVRAPTPSAAAELISRDMTHQTQLLARKKQQLRHAIRSY 293

Query: 300 IKYKINTLNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRI 357
           +   +     L   L   +    L+  +  LD + + L   ++  I +  +H +    +I
Sbjct: 294 LSQSLRQATQLQHRLERQHPQLRLNQQQQHLDEISQRLVQAMQKKIQKHQQHIDSNNYKI 353

Query: 358 KSDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLH 417
                   I   ++++   ++                                       
Sbjct: 354 SLYSPATLISNAQRNLERSERR-------------------------------------- 375

Query: 418 THIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKR 477
                    +   L  K+ +    +++    L++ +   TL RGY+  ++   + I    
Sbjct: 376 ---------LYDALDRKLLNAKHKLAVIAEKLETVSPLATLARGYSITRNEQGDVIRNTS 426

Query: 478 NLATKTRILINFFDGQANAIVI 499
            +    +++    DG  ++ VI
Sbjct: 427 QVKHGDKLITTVTDGDIHSSVI 448


>gi|312173193|emb|CBX81448.1| exodeoxyribonuclease VII large subunit [Erwinia amylovora ATCC
           BAA-2158]
          Length = 457

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 142/513 (27%), Positives = 234/513 (45%), Gaps = 59/513 (11%)

Query: 4   FSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSR 63
            SQ    +   ++VS L+  ++ ++E  +  V +  EIS +    SSGH YF+LKD+ ++
Sbjct: 1   MSQAPGSN--IFTVSRLNSTVRKLLELEMGQVWLSAEISNF-SQPSSGHWYFTLKDDSAQ 57

Query: 64  IDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKR 123
           +   +++    ++ F P+ G + LV   IT +     YQ+I ES++P+G G L    E+ 
Sbjct: 58  VRCAMFRNGNRRVTFRPQNGQQVLVRATITLYEPRGDYQLIAESMLPAGDGLLQQQFEQL 117

Query: 124 KKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQ 182
           K++L+ EGLF  +HK P+P   + + VITS +GA + D+L+ +  R P L V+I+P  VQ
Sbjct: 118 KQRLMAEGLFEQRHKQPLPDPARQVGVITSASGAALHDVLRVLQRRDPSLPVVIYPTPVQ 177

Query: 183 GDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIP 242
           G E P  I  AI   N   E       D++I+ RGGGS+EDL  FNDE + RAI  S IP
Sbjct: 178 GAEAPPGIVRAIELANARNE------CDVLIVGRGGGSLEDLCSFNDERVARAIFASRIP 231

Query: 243 IISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKY 302
           I+SA+GHETD T+AD+ ADLRAPTP+ AAE+    +      L + + R+   +   +  
Sbjct: 232 IVSAVGHETDVTIADFVADLRAPTPSAAAELVSRNQTERLRQLQSQQQRMEMAMDYYLAR 291

Query: 303 KINTLNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           +  T   L   L      L  +R +    +L R L   L+  + +  R   H+  R+ + 
Sbjct: 292 QQRTFTRLQHRLQQQHPQLRLARQQTALMQLQRRLGDALQQHLRQATRRQQHLGQRLNAF 351

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420
                I++  Q + + Q  + Q ++                                   
Sbjct: 352 RPELRIERASQQLQQWQYRLRQAMQ----------------------------------- 376

Query: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480
                        ++ +           L+  +   TL RG++     +   + + R L 
Sbjct: 377 ------------QQLGANKQRFGQLAARLEGVSPLATLARGFSVTSTADGQLVKKTRQLH 424

Query: 481 TKTRILINFFDGQANAIVINKAPPKEQPTKKCQ 513
               +     DG   + V    P K+   +  +
Sbjct: 425 QGDTLKTRLDDGWVESEVTVITPLKKTRGRSVK 457


>gi|218532089|ref|YP_002422905.1| exodeoxyribonuclease VII large subunit [Methylobacterium
           chloromethanicum CM4]
 gi|218524392|gb|ACK84977.1| exodeoxyribonuclease VII, large subunit [Methylobacterium
           chloromethanicum CM4]
          Length = 523

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 201/550 (36%), Positives = 285/550 (51%), Gaps = 69/550 (12%)

Query: 2   NPFSQKN-SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
            P        + PE+SV +L+  LK  +E    HV +RGEI+GYRG H SGHAYFSLKD 
Sbjct: 21  EPAPSALLQANTPEWSVGDLAAALKRTLEDAFGHVRLRGEITGYRGPHGSGHAYFSLKDG 80

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            ++IDA++WKG L ++   P+EG+E +  GKITTF G S YQI+I+S+ P+G G  +  L
Sbjct: 81  SAKIDAVVWKGVLGRLRQKPKEGLEVVATGKITTFAGKSSYQIVIDSMEPAGIGAWMALL 140

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           E+RK++L  EGLF  + K PIPF+P++I V+TSPTGAVIRDIL R+  RFP  V+++PV+
Sbjct: 141 EERKRQLAAEGLFEAERKRPIPFLPRVIGVVTSPTGAVIRDILHRLEDRFPRPVLVWPVR 200

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQG+   +EIA AI   N L      PRPD++I+ARGGGSIEDLW FN+E +VRA A S 
Sbjct: 201 VQGEGAAEEIAAAIRGFNALSPDGPIPRPDVLIVARGGGSIEDLWAFNEEAVVRAAAESE 260

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP+ISA+GHETD TL D+A+D RAPTPTGAAEMAVPV+  L + +  L AR    ++R I
Sbjct: 261 IPLISAVGHETDTTLIDFASDRRAPTPTGAAEMAVPVRAELAAQVHELGARQAGTMLRRI 320

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           + +     +L++A+P +D  L+  R RLD                       + +     
Sbjct: 321 ERERADFRALVRAIPGADAFLAVKRQRLD-----------------------LADARLRP 357

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420
            L  N + +R+ +      + +      R   +   E  A L  +  + +  +  +    
Sbjct: 358 ALAANARDSRERLNRVADRLTR------RSPAIALAEARARLAAIDHRPRTAMSRIVER- 410

Query: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480
                                +   T +L + +YK  L RGY  ++D +   +      A
Sbjct: 411 -----------------RRDRLDALTSLLGALSYKAVLARGYALVRDADGLPVRSAAAAA 453

Query: 481 TKTRILINFFDGQANAIVIN-----KAPPKEQPTKKCQLHNNKREK-------------- 521
              R  + F DG   A          APP  +  +          +              
Sbjct: 454 RAARFQLQFADGAIFARPEEAPDDPVAPPLAEAPRSAPRPKRAPRRAAPEPAPKPEKAAA 513

Query: 522 --QGTQGELF 529
                QG LF
Sbjct: 514 EPAARQGSLF 523


>gi|308187761|ref|YP_003931892.1| Exonuclease VII, large subunit [Pantoea vagans C9-1]
 gi|308058271|gb|ADO10443.1| Exonuclease VII, large subunit [Pantoea vagans C9-1]
          Length = 457

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 140/508 (27%), Positives = 230/508 (45%), Gaps = 57/508 (11%)

Query: 9   SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAII 68
                 ++VS L+  ++ ++E  +  V +  EIS +    +SGH YF+LKD+ +++   +
Sbjct: 4   PSTANIFTVSRLNTTVRQLLEKEMGLVWISAEISNFT-QPASGHWYFTLKDDGAQVRCAM 62

Query: 69  WKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLL 128
           ++ +  ++ F P+ G + LV   IT +     YQ+I ES+ P+G G L    E  K KL 
Sbjct: 63  FRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQLIAESMHPAGEGLLQQQFELLKAKLA 122

Query: 129 EEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECP 187
            EGLF  QHK P+P   + + VITS TGA + D+L+ +  R P L V+I+P  VQG + P
Sbjct: 123 SEGLFEPQHKQPLPEPARQVGVITSSTGAALHDVLRVMHRRDPSLPVVIYPTVVQGADAP 182

Query: 188 KEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAI 247
             I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA+
Sbjct: 183 AAIVRAIEIANLRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSAV 236

Query: 248 GHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTL 307
           GHETD T+AD+ ADLRAPTP+ AAE+    +  L   L + + RL   +   +  +    
Sbjct: 237 GHETDVTIADFVADLRAPTPSAAAEIVSRNQLELLRQLQSQQQRLEMAMDYYLARQQRLY 296

Query: 308 NSLLKALPNSDQTLSCSRYRLD--RLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHN 365
             L   L      L  +R +    RL + L   +E  + +  R  + + +R+ +      
Sbjct: 297 TRLEHRLQQQHPQLRLARQQTALFRLQQRLGEAMETRLRQATRQQDRLAHRLNAQQPQQR 356

Query: 366 IQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLIT 425
           + + ++ +      ++Q                                           
Sbjct: 357 LFQAQKQLQSWHYRLQQS------------------------------------------ 374

Query: 426 RIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRI 485
                ++ ++ +           L+  +   TL RG++   DT    + +   L +   +
Sbjct: 375 -----MATQLSNNKQQFGQLVAQLEGVSPLATLARGFSVTTDTAGQVVKKTAQLQSGDLL 429

Query: 486 LINFFDGQANAIVINKAPPKEQPTKKCQ 513
                DG   + V    P K++  K   
Sbjct: 430 RTRLDDGWVESQVTQLLPEKKRRRKTAS 457


>gi|301155949|emb|CBW15419.1| exonuclease VII, large subunit [Haemophilus parainfluenzae T3T1]
          Length = 439

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 140/492 (28%), Positives = 233/492 (47%), Gaps = 57/492 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIW 69
           +    YSVS+L+   + ++E + S + + GEIS +     SGH Y +LKD ++++   ++
Sbjct: 1   MSENIYSVSQLNSAARQMLEGSFSQIWLTGEISNFT-QPVSGHWYLTLKDENAQVRGAMF 59

Query: 70  KGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLE 129
           +    ++ F P+ G++ LV   ++ +     YQ+IIES+ P+G G L    E  K KL  
Sbjct: 60  RMKNLRVGFRPQNGMQVLVRANVSLYESRGDYQLIIESMHPAGEGLLQQQFEALKMKLAA 119

Query: 130 EGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPK 188
           EGLF+   K  +P   K + ++TS TGA ++DIL  ++ R P L+V+I+P  VQG E   
Sbjct: 120 EGLFAQNLKKSLPEFAKAVGIVTSSTGAALQDILHILARRDPSLKVVIYPTAVQGKEATA 179

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           EI   I   N  +E       D++I+ RGGGS+EDLW FN+E + RAI  S++PIISA+G
Sbjct: 180 EIVQIIELANARQE------VDVLIVGRGGGSLEDLWCFNEEEVARAIFRSNLPIISAVG 233

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HETD T+AD+ ADLRAPTP+ AAE+    ++ L   L   + RL   + R+  ++   L 
Sbjct: 234 HETDVTIADFVADLRAPTPSAAAELVSRNQQELLQQLAYKQQRLEMALDRIFSHQQQRLQ 293

Query: 309 SLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNI 366
            L   L   +    L   + R ++L   L   ++  + +  +    +  R+K + L + +
Sbjct: 294 QLRLRLQNQHPQNQLLMQKARTEQLHHRLVLAMQRQVDKTQQKLTALSARLKQNPLPYRL 353

Query: 367 QKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITR 426
           QK  Q++ + Q                                                 
Sbjct: 354 QKQSQYLAQLQVR----------------------------------------------- 366

Query: 427 IEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRIL 486
           +    + ++      ++     L   +    L RGY+  +D   + I   + + T   I 
Sbjct: 367 LNLGANRQVTERQNKLATLCGKLDGLSPLKVLARGYSIAEDVKGHAIVSVKQVKTGDTIK 426

Query: 487 INFFDGQANAIV 498
               DG+  + V
Sbjct: 427 TKVADGEITSRV 438


>gi|209694325|ref|YP_002262253.1| exodeoxyribonuclease VII large subunit [Aliivibrio salmonicida
           LFI1238]
 gi|226694633|sp|B6EGZ4|EX7L_ALISL RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|208008276|emb|CAQ78421.1| exodeoxyribonuclease VII large subunit [Aliivibrio salmonicida
           LFI1238]
          Length = 444

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 138/493 (27%), Positives = 235/493 (47%), Gaps = 57/493 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIW 69
            +   ++VS L+  ++ ++E+ +  V + GE+S       SGH Y +LKD+ +++   ++
Sbjct: 5   SNPRIFTVSRLNSEVRLLLENEMGIVWLVGEVSNLTM-PVSGHWYLTLKDSQAQVKCAMF 63

Query: 70  KGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLE 129
           KG   ++ F P+ G + LV  +++ +     YQ+IIES+   G G L    +  K  L  
Sbjct: 64  KGNNRRVTFKPQNGKQVLVKARLSLYEPRGDYQLIIESMQAEGDGRLQQEFDHLKMSLAA 123

Query: 130 EGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPK 188
           EGLF+   K  +P  PK + +ITS TGA + DIL  +  R P L VII+P  VQG     
Sbjct: 124 EGLFAQTAKKALPEQPKCVGIITSKTGAALFDILNVLKRRDPNLPVIIYPTLVQGTNAAI 183

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           +IA AI + N+  E       DI+I+ RGGGS+EDLW FN+E++ R IA S IPI+SA+G
Sbjct: 184 QIAQAIGRANSRNE------CDILIVGRGGGSLEDLWCFNEEIVARTIAASQIPIVSAVG 237

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HE D T+AD+ AD+RAPTP+ AAE+           + + + RL + I R +  +   L+
Sbjct: 238 HEIDVTIADFVADVRAPTPSAAAELVSRDLSSQLQIVSHQKRRLRSAIERYLSQQQKRLS 297

Query: 309 SLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNI 366
           +    +   +    L+    RLD L + LE++++  + R      ++  R+ +      +
Sbjct: 298 TYQFRIEKQHPQLQLNTQSQRLDDLNQRLENHIQQRLERNQHKIENLSLRLSNLSPARKV 357

Query: 367 QKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITR 426
            +++Q I   ++ +                                              
Sbjct: 358 HQDKQRIETLKRRLL--------------------------------------------- 372

Query: 427 IEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRIL 486
               +   +      +++    L + +   TLKRGY+  ++ + + IT  + + T   I 
Sbjct: 373 --DSMDRNLLMQRHQLALAAEKLDTVSPLATLKRGYSITRNASGSLITSTQQVHTGDTIT 430

Query: 487 INFFDGQANAIVI 499
             F DG+  + V 
Sbjct: 431 TRFVDGEVQSTVD 443


>gi|260914446|ref|ZP_05920915.1| exodeoxyribonuclease VII [Pasteurella dagmatis ATCC 43325]
 gi|260631547|gb|EEX49729.1| exodeoxyribonuclease VII [Pasteurella dagmatis ATCC 43325]
          Length = 457

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 148/511 (28%), Positives = 245/511 (47%), Gaps = 57/511 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIW 69
           +    YSVS+L+  ++ ++E+ L +V + GEIS +     SGH Y +LKD ++++   ++
Sbjct: 1   MSEQIYSVSQLNQTVRVMLENQLGYVWLTGEISNFT-QPVSGHWYLTLKDENAQVRCAMF 59

Query: 70  KGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLE 129
           +    ++ F P+ G++ L    ++ +     YQ+IIES+ P+G G L    E  K KL  
Sbjct: 60  RMKNMRVNFRPQNGMQVLARASVSLYEPRGDYQLIIESMHPAGEGLLQQQFEALKMKLAA 119

Query: 130 EGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPK 188
           EGLF+   K  +P   K + ++TS TGA ++DIL  +  R P L+V+I+P  VQG E   
Sbjct: 120 EGLFAQHLKKNLPHFSKAVGIVTSKTGAALQDILHILQRRDPSLKVVIYPTAVQGKEATA 179

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           EI   I   N  +E       D++I+ RGGGS+EDLW FN+E + RAI NS+IP+ISA+G
Sbjct: 180 EIVQMIELANQRQE------VDVLIVGRGGGSLEDLWCFNEESVARAIFNSTIPVISAVG 233

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HETD T+AD+ ADLRAPTP+ AAE+    ++ L   L     RL   + RL   K+  L 
Sbjct: 234 HETDVTIADFVADLRAPTPSAAAELVSRNQQELLQQLAYKRQRLEMALDRLFNDKLQYLQ 293

Query: 309 SLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNI 366
            L   L   +    L   + ++ +L   L   ++ ++ +K      +  R++ + L  N+
Sbjct: 294 RLRLRLQHKHPQTQLQVQKQQMSQLSHRLVLAIKTLVNKKQDKLTALSTRVQKNPLPFNV 353

Query: 367 QKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITR 426
           QK +Q+I + +  +  +                                           
Sbjct: 354 QKQQQYIHQLELRLHTM------------------------------------------- 370

Query: 427 IEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRIL 486
               L+  +       +     L   +    L RGY+  +D     IT+   +    ++ 
Sbjct: 371 ----LNRIVTHKQHQFANLCGRLDGLSPLKVLARGYSIAEDEQGKAITEISQVNVGDKLK 426

Query: 487 INFFDGQANAIVINKAPPKEQPTKKCQLHNN 517
               +G+  + VI+     E+ +K  QL +N
Sbjct: 427 TRVANGEIVSEVISIQSFLEKRSKAKQLKSN 457


>gi|127512228|ref|YP_001093425.1| exodeoxyribonuclease VII large subunit [Shewanella loihica PV-4]
 gi|158513470|sp|A3QCG8|EX7L_SHELP RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|126637523|gb|ABO23166.1| Exodeoxyribonuclease VII large subunit [Shewanella loihica PV-4]
          Length = 442

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 145/491 (29%), Positives = 222/491 (45%), Gaps = 57/491 (11%)

Query: 12  HPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKG 71
           +  Y+VS L+  ++ ++E  L  V +  EIS +    SSGH Y +LKDN+++I A ++KG
Sbjct: 6   NNVYTVSRLNGEVRQLLEGELGKVWLEAEISNFSA-PSSGHWYLTLKDNYAQIRAAMFKG 64

Query: 72  TLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEG 131
               + F P  G + LV G I+ +     YQ+II+S++P+G G L    E  K KL  EG
Sbjct: 65  RNRAVTFRPANGQQVLVKGAISVYEPRGDYQLIIDSMLPAGDGLLAQQYEALKMKLAAEG 124

Query: 132 LFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEI 190
           LF+   K P+P   + I V+TS TGA IRD+L  +  R P + VII+P +VQG+   K +
Sbjct: 125 LFAADTKRPLPSNIQRIGVVTSATGAAIRDVLHVLKRRDPSIEVIIYPSQVQGEHADKSL 184

Query: 191 ANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHE 250
            +AI+Q N   E       D+++L RGGGS+EDLW FN E +   I NS++P++SA+GHE
Sbjct: 185 CHAIMQANDRME------VDVLLLTRGGGSLEDLWCFNSEALAHTIYNSALPVVSAVGHE 238

Query: 251 TDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSL 310
            D T++DY ADLRAPTP+ AAE+           L     RL          +    + L
Sbjct: 239 VDTTISDYVADLRAPTPSAAAELLSQDALSKADKLRMTMTRLKQGWQHYGLKQAQRFSQL 298

Query: 311 LKALPN--SDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQK 368
              L      + L     R D L   L   L   + +  R    +  R+      H +  
Sbjct: 299 HHRLERQDPKRRLQQYEQRFDELQLRLGAALTGKLHQMERRQQSLHARLNQVSPSHQLAL 358

Query: 369 NRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIE 428
               +  + Q +   +                                            
Sbjct: 359 AASRLTHQNQRLHSAM-------------------------------------------- 374

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
                ++ S   S+      L++ +   TL RGY+   DT    +   +++ T  R+   
Sbjct: 375 ---QARLNSAEKSLQYAAHQLETVSPLATLSRGYSITLDTEGKVLHSAQDVRTGARLTTK 431

Query: 489 FFDGQANAIVI 499
             DG+  + VI
Sbjct: 432 LVDGEVQSTVI 442


>gi|61212678|sp|Q7MNE3|EX7L_VIBVY RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
          Length = 443

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 145/495 (29%), Positives = 238/495 (48%), Gaps = 57/495 (11%)

Query: 7   KNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDA 66
            +  +   ++VS L+  ++ ++E+ L  V + GEIS +     SGH YF+LKD+ +++  
Sbjct: 2   SSLTNPNIFTVSRLNSEVRLLLENQLGIVWLVGEISNFSA-PVSGHWYFTLKDSMAQVKC 60

Query: 67  IIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKK 126
            +++G    + F P  G + LV  +++ +     YQ+IIES+ P G G L    +  K K
Sbjct: 61  AMFRGNNRLVSFKPTNGNQVLVKARLSLYEPRGDYQLIIESMQPEGDGRLQQQFDALKMK 120

Query: 127 LLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDE 185
           L  EGLF+   K  IP  PK + +ITS TGA + DIL  +  R P L V+I+P  VQG+E
Sbjct: 121 LASEGLFAQSSKQAIPEHPKCVGIITSKTGAALYDILDVLKRRDPSLPVVIYPTLVQGEE 180

Query: 186 CPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIIS 245
              +IA AI + N+  E       D++I+ RGGGS+EDLW FN+E++ R IA S IPIIS
Sbjct: 181 AAIQIAQAIGRANSRNE------CDVLIVGRGGGSLEDLWCFNNEIVARTIAASQIPIIS 234

Query: 246 AIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKIN 305
           A+GHE D T+AD+ ADLRAPTP+ AAE+      H   +LI+ E +L       +  +  
Sbjct: 235 AVGHEIDVTIADFVADLRAPTPSAAAELVSRDNSHKDQALISREQKLRAAWRHYLTEQNR 294

Query: 306 TLNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLI 363
           T+ SL   L   +    L     + D L   L+  +E  + ++ +  + + ++++    +
Sbjct: 295 TIVSLSHRLEKQHPRYRLMRQTQQADELQIRLQRAMEKYLAQREQKVSRVQHKLQLLSPV 354

Query: 364 HNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKL 423
             I + +  +   +Q +   +                                       
Sbjct: 355 RQISEQKNALARVEQKMMDAM--------------------------------------- 375

Query: 424 ITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKT 483
                     K+      ++I    L + +   TLKRGY+  Q  +   IT++  + T  
Sbjct: 376 --------DRKLLRLRHQIAIAAEKLDTVSPLATLKRGYSITQSESGEVITRQSQIKTGD 427

Query: 484 RILINFFDGQANAIV 498
            ++    DG+  + V
Sbjct: 428 TLVTRLSDGEIRSTV 442


>gi|27363888|ref|NP_759416.1| exodeoxyribonuclease VII large subunit [Vibrio vulnificus CMCP6]
 gi|320157266|ref|YP_004189645.1| exodeoxyribonuclease VII large subunit [Vibrio vulnificus MO6-24/O]
 gi|31563122|sp|Q8DF05|EX7L_VIBVU RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|27360005|gb|AAO08943.1| exodeoxyribonuclease VII, large subunit [Vibrio vulnificus CMCP6]
 gi|319932578|gb|ADV87442.1| exodeoxyribonuclease VII large subunit [Vibrio vulnificus MO6-24/O]
          Length = 443

 Score =  372 bits (955), Expect = e-101,   Method: Composition-based stats.
 Identities = 144/495 (29%), Positives = 239/495 (48%), Gaps = 57/495 (11%)

Query: 7   KNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDA 66
            +  +   ++VS L+  ++ ++E+ L  V + GEIS +     SGH YF+LKD+ +++  
Sbjct: 2   SSLTNPNIFTVSRLNSEVRLLLENQLGIVWLVGEISNFSA-PVSGHWYFTLKDSMAQVKC 60

Query: 67  IIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKK 126
            +++G    + F P  G + LV  +++ +     YQ+IIES+ P G G L    +  K K
Sbjct: 61  AMFRGNNRLVSFKPTNGNQVLVKARLSLYEPRGDYQLIIESMQPEGDGRLQQQFDALKMK 120

Query: 127 LLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDE 185
           L  EGLF+   K  IP  PK + +ITS TGA + DIL  +  R P L V+I+P  VQG+E
Sbjct: 121 LASEGLFAQSSKQAIPEHPKCVGIITSKTGAALYDILDVLKRRDPSLPVVIYPTLVQGEE 180

Query: 186 CPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIIS 245
              +IA AI + N+  E       D++I+ RGGGS+EDLW FN+E++ R IA S IPIIS
Sbjct: 181 AAIQIAQAIGRANSRNE------CDVLIVGRGGGSLEDLWCFNNEIVARTIAASQIPIIS 234

Query: 246 AIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKIN 305
           A+GHE D T+AD+ ADLRAPTP+ AAE+      H   +L++ E +L       +  +  
Sbjct: 235 AVGHEIDVTIADFVADLRAPTPSAAAELVSRDNSHKDQALMSREQKLRAAWRHYLTEQNR 294

Query: 306 TLNSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLI 363
           T+ SL   L   +    L     + D L   L+  +E  + ++ +  + + ++++    +
Sbjct: 295 TIVSLSHRLEKQHPRYRLMRQTQQADELQIRLQRAMEKYLAQREQKVSRVQHKLQLLSPV 354

Query: 364 HNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKL 423
             I + +  +   +Q +   +                                       
Sbjct: 355 RQISEQKNALARVEQKMMDAM--------------------------------------- 375

Query: 424 ITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKT 483
                     K+      ++I    L + +   TLKRGY+  Q  + + IT++  + T  
Sbjct: 376 --------DRKLLRLRHQIAIAAEKLDTVSPLATLKRGYSITQSESGDVITRQSQIKTGD 427

Query: 484 RILINFFDGQANAIV 498
            ++    DG+  + V
Sbjct: 428 TLVTRLSDGEIRSTV 442


>gi|229192392|ref|ZP_04319355.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus ATCC 10876]
 gi|228590969|gb|EEK48825.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus ATCC 10876]
          Length = 452

 Score =  372 bits (955), Expect = e-101,   Method: Composition-based stats.
 Identities = 159/498 (31%), Positives = 242/498 (48%), Gaps = 59/498 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVE--SNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           ++    +V+ L+ ++K  +E   +L  V ++GEIS ++  HS GH YF+LKD ++RI A+
Sbjct: 1   MEKQYLTVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAV 59

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           ++ G    I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L
Sbjct: 60  MFAGHNRNIKFKPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGVGNLHLAYEQLKVRL 119

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDEC 186
            EEGLFS  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+  
Sbjct: 120 EEEGLFSQVYKKAIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESA 179

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
              I  AI   N + E       D++I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA
Sbjct: 180 APSIVQAIRTANEMGE------IDVLIVGRGGGSIEELWAFNEEMVARAIFKSEIPIISA 233

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD+T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   
Sbjct: 234 VGHETDFTIADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMRELVHKKEEK 293

Query: 307 LNSLLKA--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
           L  L K+       Q       +LDR   +L    E  I +K      +   ++      
Sbjct: 294 LQVLQKSYAFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKMNQLKQLSFYLEKHHPSQ 353

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  +   Q+ +++ +                                        
Sbjct: 354 KIMQTKVAVETLQKQLQREM---------------------------------------- 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                     +++   +     + L++ +    + RGY  + D     +   ++++    
Sbjct: 374 -------QTLLQTKEFAFVRAAQKLEALSPLKVMMRGYGLVYDEEKQVLKSVKDVSLGDA 426

Query: 485 ILINFFDGQANAIVINKA 502
           + +   DG  +  V    
Sbjct: 427 VSVQLQDGILDCSVSGIE 444


>gi|229019399|ref|ZP_04176222.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus AH1273]
 gi|228741869|gb|EEL92046.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus AH1273]
          Length = 452

 Score =  372 bits (955), Expect = e-101,   Method: Composition-based stats.
 Identities = 159/498 (31%), Positives = 243/498 (48%), Gaps = 59/498 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVE--SNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           ++    +V+ L+ ++K  +E   +L  V ++GEIS ++  HS GH YF+LKD ++RI A+
Sbjct: 1   MEKQYLTVTALTRYIKTKIEYDPHLQSVWLKGEISNFK-YHSRGHMYFTLKDENARIAAV 59

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           ++ G    I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L
Sbjct: 60  MFAGHNRNIKFKPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGIGNLHLAYEQLKVRL 119

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDEC 186
            EEGLFS  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+  
Sbjct: 120 EEEGLFSQVYKKTIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESA 179

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
              I  AI   N ++E       D++I+ RGGGSIE+LW FN+E++ RAI  S IPIISA
Sbjct: 180 APSIVQAIRTANEMEE------IDVLIVGRGGGSIEELWAFNEEVVARAIFTSEIPIISA 233

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD+T+AD+ ADLRAPTPT AAE+AVP    LQ  ++    RL   +   +  K   
Sbjct: 234 VGHETDFTIADFVADLRAPTPTAAAELAVPNVLELQEKVLQRTLRLQRAMRERVHKKEEK 293

Query: 307 LNSLLKA--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
           L  L K+       Q       +LDR   +L    E  I +K      +   ++      
Sbjct: 294 LQVLQKSYAFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQ 353

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I   Q+ +++ +                                        
Sbjct: 354 KIMQTKVAIETLQKQLQREM---------------------------------------- 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                     ++    +     + L++ +    + RGY  + D     +   ++++    
Sbjct: 374 -------QTLLQMKEFAFVRAAQKLEALSPLKVMMRGYGLVYDEEKQVLKSVKDVSLGDA 426

Query: 485 ILINFFDGQANAIVINKA 502
           + +   DG  +  V +  
Sbjct: 427 VSVQLQDGILDCSVSSIE 444


>gi|196041561|ref|ZP_03108853.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus
           NVH0597-99]
 gi|196027549|gb|EDX66164.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus
           NVH0597-99]
          Length = 452

 Score =  372 bits (954), Expect = e-101,   Method: Composition-based stats.
 Identities = 159/498 (31%), Positives = 243/498 (48%), Gaps = 59/498 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVE--SNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           ++    +V+ L+ ++K  +E   +L  V ++GEIS ++  HS GH YF+LKD ++RI A+
Sbjct: 1   MEKQYLTVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAV 59

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           ++ G    I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L
Sbjct: 60  MFAGHNRNIKFRPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGIGNLHLAYEQLKVRL 119

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDEC 186
            EEGLFS  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+  
Sbjct: 120 EEEGLFSQVYKKTIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESA 179

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
              I  AI   N ++E       D++I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA
Sbjct: 180 APSIVQAIRTANEMEE------IDVLIVGRGGGSIEELWAFNEEMVARAIFKSEIPIISA 233

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD+T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   
Sbjct: 234 VGHETDFTIADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMRELVHKKEEK 293

Query: 307 LNSLLKA--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
           L  L K+       Q       +LDR   +L    E  I +K      +   ++      
Sbjct: 294 LQVLQKSYAFRYPRQIYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQ 353

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  +   Q+ +++ +                                        
Sbjct: 354 KIMQTKVAVETLQKQLQREM---------------------------------------- 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                     +++   +     + L++ +    + RGY  + D     +   ++++    
Sbjct: 374 -------QTLLQTKEFAFVRAAQKLEALSPLKVMMRGYGLVYDEEKQVLKSVKDVSLGDA 426

Query: 485 ILINFFDGQANAIVINKA 502
           + +   DG  +  V    
Sbjct: 427 VSVQLQDGILDCSVSGIE 444


>gi|322831778|ref|YP_004211805.1| exodeoxyribonuclease VII, large subunit [Rahnella sp. Y9602]
 gi|321166979|gb|ADW72678.1| exodeoxyribonuclease VII, large subunit [Rahnella sp. Y9602]
          Length = 457

 Score =  372 bits (954), Expect = e-101,   Method: Composition-based stats.
 Identities = 141/508 (27%), Positives = 228/508 (44%), Gaps = 57/508 (11%)

Query: 9   SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAII 68
               P ++VS L+  ++ ++E+ +  V + GEIS +    SSGH YF+LKD+ +++   +
Sbjct: 4   PSSPPIFTVSRLNQTVRQLLENEMGQVWLSGEISNF-SQPSSGHWYFTLKDDRAQVKCAM 62

Query: 69  WKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLL 128
           ++ T  +  F P+ G + LV   IT +     YQ+I ES+  +G G L    +  K++L 
Sbjct: 63  FRNTNRRTTFRPQNGQQVLVRATITLYEPRGDYQLIAESMQEAGDGLLQQKFDLLKQQLA 122

Query: 129 EEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECP 187
            EGLF  Q K P+P   K + VITS +GA + D+L  +  R P L VII+P  VQG + P
Sbjct: 123 AEGLFDAQFKQPLPSPAKCVGVITSASGAALHDVLNVLKRRDPSLPVIIYPTSVQGADAP 182

Query: 188 KEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAI 247
            +I  AI   N  +E       D++I+ RGGGS+EDLW FNDE + RAI  S IPI+SA+
Sbjct: 183 GQIVRAIELANAREE------VDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPIVSAV 236

Query: 248 GHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTL 307
           GHETD T+AD+ ADLRAPTP+ AAE+    +  L   + + + RL   +   +       
Sbjct: 237 GHETDVTIADFVADLRAPTPSAAAELISRNQLELLRQIQSQQQRLEMAMDYYLAQLTQRF 296

Query: 308 NSLLKALPNSDQTLSCSRYRLD--RLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHN 365
             L   L      L  +R +    +L R L+  ++  + +  R  + +  R+        
Sbjct: 297 TRLNHRLQQQHPHLRLARQQTALFKLRRRLDEAMQNQLRQMLRRTDRLQQRLTQQQPQPR 356

Query: 366 IQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLIT 425
           I + +Q + + Q  ++Q                                           
Sbjct: 357 IHRAQQRVQQLQYRLQQ------------------------------------------- 373

Query: 426 RIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRI 485
                +S ++             L+  +   TL RGY+         + +    A    +
Sbjct: 374 ----AMSSQLTESRQRFGTACTQLEGVSPLATLARGYSVTTTPQGALLKKTTQTAPGDTL 429

Query: 486 LINFFDGQANAIVINKAPPKEQPTKKCQ 513
                DG   + V +    K+   +  +
Sbjct: 430 KTRLADGWIESEVKSIVVEKKVRKRAVK 457


>gi|289824929|ref|ZP_06544338.1| exodeoxyribonuclease VII large subunit [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
          Length = 449

 Score =  372 bits (954), Expect = e-100,   Method: Composition-based stats.
 Identities = 142/489 (29%), Positives = 224/489 (45%), Gaps = 57/489 (11%)

Query: 18  SELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNKIE 77
           S L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   +++ +  ++ 
Sbjct: 13  SRLNQTVRLLLEQEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCAMFRNSNRRVT 71

Query: 78  FLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSDQH 137
           F P+ G + LV   IT +     YQII ES+ P+G G L    E+ K KL  EGLF  QH
Sbjct: 72  FRPQHGQQVLVRANITLYEPRGDYQIIAESMQPAGEGLLQQKYEQLKAKLHAEGLFDQQH 131

Query: 138 KNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANAILQ 196
           K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ P +I  AI  
Sbjct: 132 KQPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDAPGQIVRAIEL 191

Query: 197 LNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWTLA 256
            NT  E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA+GHETD T+A
Sbjct: 192 ANTRGE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSAVGHETDVTIA 245

Query: 257 DYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKALPN 316
           D+ ADLRAPTP+ AAE+    ++ L   + + + RL   +   +  +      +   L  
Sbjct: 246 DFVADLRAPTPSAAAEIVSRNQQELLRQIQSAQQRLGMAMDYYLANRSRRFTQIFHRLQQ 305

Query: 317 SDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHIL 374
               L  +R +   +RL + +   LE  I +  +    +  R+        I + +  I 
Sbjct: 306 QHPQLRLARQQTALERLRQRMGFALEARIKQATQRQQRVSQRLSQQNPQPRIHRVQSRIQ 365

Query: 375 EKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSHK 434
           + +                                                 +   +  +
Sbjct: 366 QLEYR-----------------------------------------------LTENIRSR 378

Query: 435 IKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDGQA 494
           +             L++ +   TL RGYT    T+   + + + +     +     DG  
Sbjct: 379 LSEQRERFGNAVTHLEAVSPLATLARGYTVSTTTDGKVLKKIKQVKAGDIMTTRLEDGWL 438

Query: 495 NAIVINKAP 503
            + V +  P
Sbjct: 439 ESEVKSVTP 447


>gi|49480925|ref|YP_038241.1| exodeoxyribonuclease VII large subunit [Bacillus thuringiensis
           serovar konkukian str. 97-27]
 gi|52141317|ref|YP_085513.1| exodeoxyribonuclease VII large subunit [Bacillus cereus E33L]
 gi|118479371|ref|YP_896522.1| exodeoxyribonuclease VII large subunit [Bacillus thuringiensis str.
           Al Hakam]
 gi|196046399|ref|ZP_03113625.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus 03BB108]
 gi|218905316|ref|YP_002453150.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus AH820]
 gi|228929226|ref|ZP_04092253.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
 gi|228935503|ref|ZP_04098321.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|228947897|ref|ZP_04110184.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|229093239|ref|ZP_04224357.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus Rock3-42]
 gi|229123700|ref|ZP_04252895.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus 95/8201]
 gi|229186423|ref|ZP_04313587.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus BGSC 6E1]
 gi|81824192|sp|Q635A4|EX7L_BACCZ RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|81828207|sp|Q6HDY5|EX7L_BACHK RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|158512496|sp|A0RIH2|EX7L_BACAH RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|226694634|sp|B7JM31|EX7L_BACC0 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|49332481|gb|AAT63127.1| exodeoxyribonuclease VII, large subunit [Bacillus thuringiensis
           serovar konkukian str. 97-27]
 gi|51974786|gb|AAU16336.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus E33L]
 gi|118418596|gb|ABK87015.1| Exodeoxyribonuclease VII large subunit [Bacillus thuringiensis str.
           Al Hakam]
 gi|196022869|gb|EDX61550.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus 03BB108]
 gi|218539843|gb|ACK92241.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus AH820]
 gi|228597050|gb|EEK54706.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus BGSC 6E1]
 gi|228659835|gb|EEL15480.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus 95/8201]
 gi|228690213|gb|EEL44007.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus Rock3-42]
 gi|228811884|gb|EEM58218.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|228824255|gb|EEM70069.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|228830516|gb|EEM76126.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
          Length = 452

 Score =  372 bits (954), Expect = e-100,   Method: Composition-based stats.
 Identities = 159/498 (31%), Positives = 243/498 (48%), Gaps = 59/498 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVE--SNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           ++    +V+ L+ ++K  +E   +L  V ++GEIS ++  HS GH YF+LKD ++RI A+
Sbjct: 1   MEKQYLTVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAV 59

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           ++ G    I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L
Sbjct: 60  MFAGHNRNIKFRPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGIGNLHLAYEQLKVRL 119

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDEC 186
            EEGLFS  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+  
Sbjct: 120 EEEGLFSQVYKKTIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESA 179

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
              I  AI   N ++E       D++I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA
Sbjct: 180 APSIVQAIRTANEMEE------IDVLIVGRGGGSIEELWAFNEEMVARAIFKSEIPIISA 233

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD+T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   
Sbjct: 234 VGHETDFTIADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMRELVHKKEEK 293

Query: 307 LNSLLKA--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
           L  L K+       Q       +LDR   +L    E  I +K      +   ++      
Sbjct: 294 LQVLQKSYAFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQ 353

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  +   Q+ +++ +                                        
Sbjct: 354 KIMQTKVAVETLQKQLQREM---------------------------------------- 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                     +++   +     + L++ +    + RGY  + D     +   ++++    
Sbjct: 374 -------QTLLQTKEFAFVRAAQKLEALSPLKVMMRGYGLVYDEEKQVLKSVKDVSLGDA 426

Query: 485 ILINFFDGQANAIVINKA 502
           + +   DG  +  V    
Sbjct: 427 VSVQLQDGILDCSVSGIE 444


>gi|218231815|ref|YP_002368983.1| exodeoxyribonuclease VII large subunit [Bacillus cereus B4264]
 gi|229152382|ref|ZP_04280574.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus m1550]
 gi|226694636|sp|B7HB51|EX7L_BACC4 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|218159772|gb|ACK59764.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus B4264]
 gi|228630990|gb|EEK87627.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus m1550]
          Length = 452

 Score =  372 bits (954), Expect = e-100,   Method: Composition-based stats.
 Identities = 159/498 (31%), Positives = 242/498 (48%), Gaps = 59/498 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVE--SNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           ++    +V+ L+ ++K  +E   +L  V ++GEIS ++  HS GH YF+LKD ++RI A+
Sbjct: 1   MEKQYLTVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAV 59

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           ++ G    I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L
Sbjct: 60  MFAGHNRNIKFKPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGVGNLHLAYEQLKVRL 119

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDEC 186
            EEGLFS  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+  
Sbjct: 120 EEEGLFSQVYKKAIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESA 179

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
              I  AI   N + E       D++I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA
Sbjct: 180 APSIVQAIRTANEMGE------IDVLIVGRGGGSIEELWAFNEEMVARAIFKSEIPIISA 233

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD+T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   
Sbjct: 234 VGHETDFTIADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMRELVHKKEEK 293

Query: 307 LNSLLKA--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
           L  L K+       Q       +LDR   +L    E  I +K      +   ++      
Sbjct: 294 LQVLQKSYAFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQ 353

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  +   Q+ +++ +                                        
Sbjct: 354 KIMQTKVAVETLQKQLQREM---------------------------------------- 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                     +++   +     + L++ +    + RGY  + D     +   ++++    
Sbjct: 374 -------QTLLQTKEFAFVRAAQKLEALSPLKVMMRGYGLVYDEEKQVLKSVKDVSLGDA 426

Query: 485 ILINFFDGQANAIVINKA 502
           + +   DG  +  V    
Sbjct: 427 VSVQLQDGILDCSVSGIE 444


>gi|310764765|gb|ADP09715.1| exodeoxyribonuclease VII large subunit [Erwinia sp. Ejp617]
          Length = 456

 Score =  372 bits (954), Expect = e-100,   Method: Composition-based stats.
 Identities = 144/511 (28%), Positives = 232/511 (45%), Gaps = 59/511 (11%)

Query: 4   FSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSR 63
            SQ    +   ++VS L+  ++ ++E  +  V +  EIS +    SSGH YF+LKD+ ++
Sbjct: 1   MSQPPGSN--IFTVSRLNSTVRKLLELEMGQVWLSAEISNF-SQPSSGHWYFTLKDDTAQ 57

Query: 64  IDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKR 123
           +   +++    ++ F P+ G + LV   IT +     YQ+I ES+ P+G G L    E+ 
Sbjct: 58  VRCAMFRNGNRRVTFRPQNGQQVLVRATITLYEPRGDYQLIAESMQPAGDGLLQQQFEQL 117

Query: 124 KKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQ 182
           K++L+ EGLF   HK P+P   + + VITS +GA + D+L+ +  R P L V+I+P  VQ
Sbjct: 118 KQRLMAEGLFEQAHKQPLPDPARQVGVITSSSGAALHDVLRVLQRRDPSLPVVIYPTPVQ 177

Query: 183 GDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIP 242
           G E P  I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP
Sbjct: 178 GAEAPPGIVRAIELANVRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIP 231

Query: 243 IISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKY 302
           I+SA+GHETD T+AD+ ADLRAPTP+ AAE+    +      L + + R+   +   +  
Sbjct: 232 IVSAVGHETDVTIADFVADLRAPTPSAAAELVSRNQIERLRQLQSQQQRMEMAMDYYLAQ 291

Query: 303 KINTLNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           +  T   L   L      L  +R +     L R L+  L+  + R  R    +  R+ + 
Sbjct: 292 QQRTFTRLQHRLQQQHPQLRLARQQTALMILQRRLDDALQQHLRRAARRQEILGQRLNAF 351

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420
                I++  Q + + Q  ++Q ++                                   
Sbjct: 352 RPEIRIERASQQLQQWQYRLQQAMQ----------------------------------- 376

Query: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480
                        ++ +           L+  +   TL RG++     +   I + R L 
Sbjct: 377 ------------QQLGTGKQHFGQLAARLEGVSPLATLARGFSVTSTADGQVIKKTRQLH 424

Query: 481 TKTRILINFFDGQANAIVINKAPPKEQPTKK 511
               +     DG   + V    P K+   + 
Sbjct: 425 RGDTLKTRLDDGWVESEVTAITPLKKTRGRS 455


>gi|30022262|ref|NP_833893.1| exodeoxyribonuclease VII large subunit [Bacillus cereus ATCC 14579]
 gi|206971365|ref|ZP_03232316.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus AH1134]
 gi|218899344|ref|YP_002447755.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus G9842]
 gi|228922935|ref|ZP_04086229.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
 gi|228954466|ref|ZP_04116491.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
 gi|228967221|ref|ZP_04128257.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar sotto str. T04001]
 gi|229047876|ref|ZP_04193452.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus AH676]
 gi|229071687|ref|ZP_04204903.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus F65185]
 gi|229081439|ref|ZP_04213939.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus Rock4-2]
 gi|229129460|ref|ZP_04258431.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus BDRD-Cer4]
 gi|229146755|ref|ZP_04275120.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus BDRD-ST24]
 gi|229180460|ref|ZP_04307802.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus 172560W]
 gi|296504669|ref|YP_003666369.1| exodeoxyribonuclease VII large subunit [Bacillus thuringiensis
           BMB171]
 gi|81837301|sp|Q818R6|EX7L_BACCR RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|226694635|sp|B7IXH1|EX7L_BACC2 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|29897819|gb|AAP11094.1| Exodeoxyribonuclease VII large subunit [Bacillus cereus ATCC 14579]
 gi|206734137|gb|EDZ51308.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus AH1134]
 gi|218544494|gb|ACK96888.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus G9842]
 gi|228602884|gb|EEK60363.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus 172560W]
 gi|228636583|gb|EEK93048.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus BDRD-ST24]
 gi|228654065|gb|EEL09932.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus BDRD-Cer4]
 gi|228701854|gb|EEL54340.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus Rock4-2]
 gi|228711418|gb|EEL63377.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus F65185]
 gi|228723333|gb|EEL74702.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus AH676]
 gi|228792590|gb|EEM40156.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar sotto str. T04001]
 gi|228805123|gb|EEM51717.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
 gi|228836706|gb|EEM82053.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
 gi|296325721|gb|ADH08649.1| exodeoxyribonuclease VII large subunit [Bacillus thuringiensis
           BMB171]
          Length = 452

 Score =  372 bits (954), Expect = e-100,   Method: Composition-based stats.
 Identities = 159/498 (31%), Positives = 242/498 (48%), Gaps = 59/498 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVE--SNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           ++    +V+ L+ ++K  +E   +L  V ++GEIS ++  HS GH YF+LKD ++RI A+
Sbjct: 1   MEKQYLTVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAV 59

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           ++ G    I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L
Sbjct: 60  MFAGHNRNIKFKPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGVGNLHLAYEQLKVRL 119

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDEC 186
            EEGLFS  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+  
Sbjct: 120 EEEGLFSQVYKKAIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESA 179

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
              I  AI   N + E       D++I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA
Sbjct: 180 APSIVQAIRTANEMGE------IDVLIVGRGGGSIEELWAFNEEMVARAIFKSEIPIISA 233

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD+T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   
Sbjct: 234 VGHETDFTIADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMRELVHKKEEK 293

Query: 307 LNSLLKA--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
           L  L K+       Q       +LDR   +L    E  I +K      +   ++      
Sbjct: 294 LQVLQKSYAFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQ 353

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  +   Q+ +++ +                                        
Sbjct: 354 KIMQTKVAVETLQKQLQREM---------------------------------------- 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                     +++   +     + L++ +    + RGY  + D     +   ++++    
Sbjct: 374 -------QTLLQTKEFAFVRAAQKLEALSPLKVMMRGYGLVYDEEKQVLKSVKDVSLGDA 426

Query: 485 ILINFFDGQANAIVINKA 502
           + +   DG  +  V    
Sbjct: 427 VSVQLQDGILDCSVSGIE 444


>gi|228916816|ref|ZP_04080381.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
 gi|228843003|gb|EEM88086.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
          Length = 452

 Score =  372 bits (954), Expect = e-100,   Method: Composition-based stats.
 Identities = 158/498 (31%), Positives = 243/498 (48%), Gaps = 59/498 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVE--SNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           ++    +V+ L+ ++K  +E   +L  V ++GEIS ++  HS GH YF+LKD ++RI A+
Sbjct: 1   MEKQYLTVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAV 59

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           ++ G    I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L
Sbjct: 60  MFAGHNRNIKFRPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGIGNLHLAYEQLKVRL 119

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDEC 186
            EEGLFS  +K  IP   K I V+TSPTGA IRDI+  I  R+P+  VI+FPV VQG+  
Sbjct: 120 EEEGLFSQVYKKIIPPYAKTIGVVTSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESA 179

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
              I  AI   N ++E       D++I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA
Sbjct: 180 APSIVQAIRTANEMEE------IDVLIVGRGGGSIEELWAFNEEMVARAIFKSEIPIISA 233

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD+T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   
Sbjct: 234 VGHETDFTIADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMRELVHKKEEK 293

Query: 307 LNSLLKA--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
           L  L K+       Q       +LDR   +L    E  I +K      +   ++      
Sbjct: 294 LQVLQKSYAFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQ 353

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  +   Q+ +++ +                                        
Sbjct: 354 KIMQTKVAVETLQKQLQREM---------------------------------------- 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                     +++   +     + L++ +    + RGY  + D     +   ++++    
Sbjct: 374 -------QTLLQTKEFAFVRAAQKLEALSPLKVMMRGYGLVYDEEKQVLKSVKDVSLGDA 426

Query: 485 ILINFFDGQANAIVINKA 502
           + +   DG  +  V    
Sbjct: 427 VSVQLQDGILDCSVSGIE 444


>gi|229174857|ref|ZP_04302377.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus MM3]
 gi|228608525|gb|EEK65827.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus MM3]
          Length = 452

 Score =  371 bits (953), Expect = e-100,   Method: Composition-based stats.
 Identities = 158/498 (31%), Positives = 242/498 (48%), Gaps = 59/498 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVE--SNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           ++    +V+ L+ ++K  +E   +L  V ++GEIS ++  HS GH YF+LKD ++RI A+
Sbjct: 1   MEKQYLTVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAV 59

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           ++ G    I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L
Sbjct: 60  MFAGHNRNIKFRPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGVGNLHLAYEQLKVRL 119

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDEC 186
            EEGLFS  +K  IP   K I VITSPTGA IRD++  I  R+P+  VI+FPV VQG+  
Sbjct: 120 EEEGLFSQVYKKTIPPYAKTIGVITSPTGAAIRDVITTIKRRYPIGNVIVFPVLVQGESA 179

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
              I  AI   N + E       D++I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA
Sbjct: 180 APSIVQAIRTANEMGE------IDVLIVGRGGGSIEELWAFNEEMVARAIFKSEIPIISA 233

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD+T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   
Sbjct: 234 VGHETDFTIADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMRELVHKKEEK 293

Query: 307 LNSLLKA--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
           L  L K+       Q       +LDR   +L    E  I +K      +   ++      
Sbjct: 294 LQVLQKSYAFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPAQ 353

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  +   Q+ +++ +                                        
Sbjct: 354 KIMQTKVAVETLQKQLQREM---------------------------------------- 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                     +++   +     + L++ +    + RGY  + D     +   ++++    
Sbjct: 374 -------QTLLQTKEFAFVRAAQKLEALSPLKVMMRGYGLVYDEEKQVLKSVKDVSLGDA 426

Query: 485 ILINFFDGQANAIVINKA 502
           + +   DG  +  V    
Sbjct: 427 VSVQLQDGILDCSVSGIE 444


>gi|242240148|ref|YP_002988329.1| exodeoxyribonuclease VII large subunit [Dickeya dadantii Ech703]
 gi|242132205|gb|ACS86507.1| exodeoxyribonuclease VII, large subunit [Dickeya dadantii Ech703]
          Length = 465

 Score =  371 bits (953), Expect = e-100,   Method: Composition-based stats.
 Identities = 138/513 (26%), Positives = 228/513 (44%), Gaps = 57/513 (11%)

Query: 12  HPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKG 71
              ++VS L+  +K ++ES +  + + GEIS +    +SGH YF+LKD  +++   +++ 
Sbjct: 7   SAIFTVSRLNQTVKQLLESEMGLIWLSGEISNF-SQPASGHWYFTLKDERAQVRCAMFRT 65

Query: 72  TLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEG 131
           +  ++ F P+ G + L+   +T +     YQ++ +S+ P+G G L    E  K++L  EG
Sbjct: 66  SNRRVVFRPQNGQQVLIRASVTLYEPRGDYQLLADSMHPAGDGLLQQQFEHLKQRLSAEG 125

Query: 132 LFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEI 190
           LF  QHK P+P     I VITS +GA + DILQ +  R P L V+++P  VQG E P +I
Sbjct: 126 LFDQQHKQPLPKPAYRIGVITSASGAALHDILQVLQRRDPSLPVVVYPTAVQGVEAPLQI 185

Query: 191 ANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHE 250
             AI   N  +E       D++I+ RGGGS+EDLW FNDE + RAI  S+IPI+SA+GHE
Sbjct: 186 VRAIELANQRQE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASNIPIVSAVGHE 239

Query: 251 TDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSL 310
            D T+AD+ ADLRAPTP+ AAE+    +  L   L     RL+  +   +       + L
Sbjct: 240 IDVTIADFVADLRAPTPSAAAELVSRDQTELLRRLQTQRQRLDMAMDYYLAQCQQRFSRL 299

Query: 311 LKALPNSDQTLSCSRYRLD--RLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQK 368
              L      L  +R +    RL + L+  ++  + +  R       R+        + +
Sbjct: 300 HHRLQQQHPQLRLARQQTQLIRLSQRLDEAMQQQLRQTQRRQERAFQRLMQQQPQPRLHR 359

Query: 369 NRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIE 428
             Q + + +  ++ +                                             
Sbjct: 360 AHQQLQQLRYRLQSL--------------------------------------------- 374

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
             L  ++             L++ +   TL RGY+     +   +TQ R  +    +   
Sbjct: 375 --LEKQLGQQKQRFGELCSHLEAVSPLATLARGYSVTTAADGQVLTQTRQASLGDTLKTR 432

Query: 489 FFDGQANAIVINKAPPKEQPTKKCQLHNNKREK 521
             DG   + + +          K +    K   
Sbjct: 433 LQDGWVESRITDVQALSSSIAPKRRSKTRKTTD 465


>gi|251788756|ref|YP_003003477.1| exodeoxyribonuclease VII large subunit [Dickeya zeae Ech1591]
 gi|247537377|gb|ACT05998.1| exodeoxyribonuclease VII, large subunit [Dickeya zeae Ech1591]
          Length = 461

 Score =  371 bits (953), Expect = e-100,   Method: Composition-based stats.
 Identities = 139/519 (26%), Positives = 232/519 (44%), Gaps = 62/519 (11%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M+            ++VS L+  +K ++E  +  V + GEIS +    SSGH YF+LKD 
Sbjct: 1   MSSLPSSA-----IFTVSRLNQTVKQLLEGEMGQVWLSGEISNF-SQPSSGHWYFTLKDE 54

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            +++   +++ +  ++ F P+ G + L+   IT +     YQ++ ES+ P+G G L    
Sbjct: 55  RAQVRCAMFRTSNRRVTFRPQNGQQVLIRATITLYEPRGDYQLLAESMHPAGDGLLQQQF 114

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPV 179
           E+ K++L  EGLF  Q+K  +P   + + VITS +GA + DIL  +  R P L V+I+P 
Sbjct: 115 EQLKQRLSAEGLFDQQYKQSLPKPARQVGVITSASGAALHDILHILQRRDPSLPVVIYPT 174

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
            VQG + P +I  AI   N  +E       D++I+ RGGGS+EDLW FNDE + RAI  S
Sbjct: 175 AVQGVDAPGQIVRAIELANRREE------CDVLIVGRGGGSLEDLWSFNDERVARAIFAS 228

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
            IPI+SA+GHETD T+AD+ ADLRAPTP+ AAE+    +  L   + +   RL   +   
Sbjct: 229 RIPIVSAVGHETDVTIADFVADLRAPTPSAAAELVSRNQLELLRQIQSQRQRLEMAMDYY 288

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLD--RLPRELEHNLEIIIFRKYRHFNHIINRI 357
           + ++      L   L      L  +R +    RL + L+  +++ +  + R    ++ R+
Sbjct: 289 LAHRQQQFVRLQHRLHQQHPQLRLARQQTQLIRLRQRLDEAIQLQLRLRMRRQERLVQRL 348

Query: 358 KSDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLH 417
           +       + + +Q + + +  I+                                    
Sbjct: 349 QQHQPQSRLHRAQQQVQQLRYRIQ------------------------------------ 372

Query: 418 THIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKR 477
                        L  ++             L++ +   TL RGY+     +   + Q  
Sbjct: 373 -----------HALEKQLNQHKQRFGEACSHLEAVSPLATLARGYSVTTAPDGKVMKQTA 421

Query: 478 NLATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHN 516
            +     +     DG   + V        +   K Q  N
Sbjct: 422 QITKGDILKTRLQDGWVESQVTEIKKESTKSRTKRQTKN 460


>gi|30264255|ref|NP_846632.1| exodeoxyribonuclease VII large subunit [Bacillus anthracis str.
           Ames]
 gi|47529698|ref|YP_021047.1| exodeoxyribonuclease VII large subunit [Bacillus anthracis str.
           'Ames Ancestor']
 gi|49187082|ref|YP_030334.1| exodeoxyribonuclease VII large subunit [Bacillus anthracis str.
           Sterne]
 gi|65321565|ref|ZP_00394524.1| COG1570: Exonuclease VII, large subunit [Bacillus anthracis str.
           A2012]
 gi|165872985|ref|ZP_02217607.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis str.
           A0488]
 gi|167634492|ref|ZP_02392812.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis str.
           A0442]
 gi|167638588|ref|ZP_02396864.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis str.
           A0193]
 gi|170687494|ref|ZP_02878711.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis str.
           A0465]
 gi|170709012|ref|ZP_02899442.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis str.
           A0389]
 gi|177654828|ref|ZP_02936585.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis str.
           A0174]
 gi|190566009|ref|ZP_03018928.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis
           Tsiankovskii-I]
 gi|227816956|ref|YP_002816965.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis str.
           CDC 684]
 gi|229604498|ref|YP_002868474.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis str.
           A0248]
 gi|254683944|ref|ZP_05147804.1| exodeoxyribonuclease VII large subunit [Bacillus anthracis str.
           CNEVA-9066]
 gi|254721779|ref|ZP_05183568.1| exodeoxyribonuclease VII large subunit [Bacillus anthracis str.
           A1055]
 gi|254736292|ref|ZP_05193998.1| exodeoxyribonuclease VII large subunit [Bacillus anthracis str.
           Western North America USA6153]
 gi|254741330|ref|ZP_05199017.1| exodeoxyribonuclease VII large subunit [Bacillus anthracis str.
           Kruger B]
 gi|254754036|ref|ZP_05206071.1| exodeoxyribonuclease VII large subunit [Bacillus anthracis str.
           Vollum]
 gi|254757907|ref|ZP_05209934.1| exodeoxyribonuclease VII large subunit [Bacillus anthracis str.
           Australia 94]
 gi|81837607|sp|Q81M51|EX7L_BACAN RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|254783687|sp|C3P7V9|EX7L_BACAA RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|254783688|sp|C3LJV4|EX7L_BACAC RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|30258900|gb|AAP28118.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis str.
           Ames]
 gi|47504846|gb|AAT33522.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis str.
           'Ames Ancestor']
 gi|49181009|gb|AAT56385.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis str.
           Sterne]
 gi|164711268|gb|EDR16823.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis str.
           A0488]
 gi|167513436|gb|EDR88806.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis str.
           A0193]
 gi|167529944|gb|EDR92679.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis str.
           A0442]
 gi|170126039|gb|EDS94936.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis str.
           A0389]
 gi|170668689|gb|EDT19435.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis str.
           A0465]
 gi|172080489|gb|EDT65575.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis str.
           A0174]
 gi|190562928|gb|EDV16894.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis
           Tsiankovskii-I]
 gi|227004511|gb|ACP14254.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis str.
           CDC 684]
 gi|229268906|gb|ACQ50543.1| exodeoxyribonuclease VII, large subunit [Bacillus anthracis str.
           A0248]
          Length = 452

 Score =  371 bits (953), Expect = e-100,   Method: Composition-based stats.
 Identities = 159/498 (31%), Positives = 243/498 (48%), Gaps = 59/498 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVE--SNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           ++    +V+ L+ ++K  +E   +L  V ++GEIS ++  HS GH YF+LKD ++RI A+
Sbjct: 1   MEKQYLTVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAV 59

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           ++ G    I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L
Sbjct: 60  MFAGHNRNIKFRPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGIGNLHLAYEQLKVRL 119

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDEC 186
            EEGLFS  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+  
Sbjct: 120 EEEGLFSQVYKKTIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESA 179

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
              I  AI   N ++E       D++I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA
Sbjct: 180 APSIVQAIRTANEMEE------IDVLIVGRGGGSIEELWAFNEEMVARAIFKSEIPIISA 233

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD+T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   
Sbjct: 234 VGHETDFTIADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMRELVHKKEEK 293

Query: 307 LNSLLKA--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
           L  L K+       Q       +LDR   +L    E  I +K      +   ++      
Sbjct: 294 LQVLQKSYAFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQ 353

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  +   Q+ +++ +                                        
Sbjct: 354 KIMQTKVAVETLQKQLQREM---------------------------------------- 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                     +++   +     + L++ +    + RGY  + D     +   ++++    
Sbjct: 374 -------QTLLQAKEFAFVRAAQKLEALSPLKVMMRGYGLVYDEEKQVLKSVKDVSLGDA 426

Query: 485 ILINFFDGQANAIVINKA 502
           + +   DG  +  V    
Sbjct: 427 VSVQLQDGILDCSVSGIE 444


>gi|271501563|ref|YP_003334589.1| exodeoxyribonuclease VII large subunit [Dickeya dadantii Ech586]
 gi|270345118|gb|ACZ77883.1| exodeoxyribonuclease VII, large subunit [Dickeya dadantii Ech586]
          Length = 462

 Score =  371 bits (953), Expect = e-100,   Method: Composition-based stats.
 Identities = 139/519 (26%), Positives = 231/519 (44%), Gaps = 62/519 (11%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M+            ++VS L+  +K ++E  +  V + GEIS +    SSGH YF+LKD 
Sbjct: 1   MSSLPSSA-----IFTVSRLNQTVKQLLEGEMGQVWLSGEISNF-SQPSSGHWYFTLKDE 54

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            +++   +++ +  ++ F P+ G + L+   IT +     YQ++ ES+ P+G G L    
Sbjct: 55  RAQVRCAMFRTSNRRVTFRPQNGQQVLIRATITLYEPRGDYQLLAESMHPAGDGLLQQQF 114

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPV 179
           E+ K++L  EGLF   +K  +P   + + VITS +GA + DIL  +  R P L V+I+P 
Sbjct: 115 EQLKQRLSAEGLFDQHYKQLLPKPARQVGVITSASGAALHDILHILQRRDPSLPVVIYPT 174

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
            VQG + P +I  AI   N  +E       D++I+ RGGGS+EDLW FNDE + RAI  S
Sbjct: 175 AVQGVDAPGQIVRAIELANLREE------CDVLIVGRGGGSLEDLWSFNDERVARAIFAS 228

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
            IPI+SA+GHETD T+AD+ ADLRAPTP+ AAE+    +  L   +     RL   +   
Sbjct: 229 RIPIVSAVGHETDVTIADFVADLRAPTPSAAAELVSRNQLELLRQIRAQRQRLEMAMDYY 288

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLD--RLPRELEHNLEIIIFRKYRHFNHIINRI 357
           +  +      L   L      L  +R +    RL + L+  +++ + ++ R    +  R+
Sbjct: 289 LAQRQQQFVRLQHRLHQQHPQLRLARQQTQLIRLRQRLDDAIQLQLRQQTRRQERLAQRL 348

Query: 358 KSDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLH 417
           +       + + +Q I + +  +                                     
Sbjct: 349 QQHQPQSRLHRAQQQIQQLRYRMH------------------------------------ 372

Query: 418 THIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKR 477
                        L  ++             L++ +   TL RGY+    ++   + Q  
Sbjct: 373 -----------HALEKQLSQYKQQFGEACSHLEAVSPLATLARGYSVTTTSDGKVMKQTV 421

Query: 478 NLATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHN 516
            +    ++     DG   + V        +P  K Q  N
Sbjct: 422 QVTKGDKLKTRLQDGWVESQVTEIKKESTKPRAKRQPKN 460


>gi|196034996|ref|ZP_03102403.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus W]
 gi|195992535|gb|EDX56496.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus W]
          Length = 452

 Score =  371 bits (953), Expect = e-100,   Method: Composition-based stats.
 Identities = 159/498 (31%), Positives = 243/498 (48%), Gaps = 59/498 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVE--SNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           ++    +V+ L+ ++K  +E   +L  V ++GEIS ++  HS GH YF+LKD ++RI A+
Sbjct: 1   MEKQYLTVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAV 59

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           ++ G    I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L
Sbjct: 60  MFAGHNRNIKFRPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGIGNLHLAYEQLKVRL 119

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDEC 186
            EEGLFS  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+  
Sbjct: 120 EEEGLFSQVYKKTIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESA 179

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
              I  AI   N ++E       D++I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA
Sbjct: 180 APSIVQAIRTANEMEE------IDVLIVGRGGGSIEELWAFNEEMVARAIFKSEIPIISA 233

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD+T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   
Sbjct: 234 VGHETDFTIADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMRELVHKKEEK 293

Query: 307 LNSLLKA--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
           L  L K+       Q       +LDR   +L    E  I +K      +   ++      
Sbjct: 294 LQVLQKSYAFRYPRQVYEQKEEQLDRAIEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQ 353

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  +   Q+ +++ +                                        
Sbjct: 354 KIMQTKVAVETLQKQLQREM---------------------------------------- 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                     +++   +     + L++ +    + RGY  + D     +   ++++    
Sbjct: 374 -------QTLLQTKEFAFVRAAQKLEALSPLKVMMRGYGLVYDEEKQVLKSVKDVSLGDA 426

Query: 485 ILINFFDGQANAIVINKA 502
           + +   DG  +  V    
Sbjct: 427 VSVQLQDGILDCSVSGIE 444


>gi|270264717|ref|ZP_06192982.1| exodeoxyribonuclease 7 large subunit [Serratia odorifera 4Rx13]
 gi|270041400|gb|EFA14499.1| exodeoxyribonuclease 7 large subunit [Serratia odorifera 4Rx13]
          Length = 461

 Score =  371 bits (953), Expect = e-100,   Method: Composition-based stats.
 Identities = 138/503 (27%), Positives = 228/503 (45%), Gaps = 57/503 (11%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
            ++VS L+  ++ ++E  +  + +  EIS +    +SGH YF+LKD+ +++   +++ + 
Sbjct: 9   IFTVSRLNQTVRQLLEMEMGQIWLSAEISNF-SQPASGHWYFTLKDDRAQVRCAMFRNSN 67

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            +  F P+ G + LV   IT +     YQ+I ES+ P+G G L    E+ K++L  EGLF
Sbjct: 68  RRTTFRPQNGQQVLVRASITLYEPRGDYQLIAESMQPAGDGLLQQQFEQLKQRLSAEGLF 127

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIAN 192
             Q K P+P   K + VITS +GA + D+LQ +  R P L ++I+P  VQG E P +I  
Sbjct: 128 DQQFKQPLPSPAKRVGVITSASGAALHDVLQVLQRRDPSLPIVIYPTSVQGAEAPLQIVR 187

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IPI+SA+GHETD
Sbjct: 188 AIETANRRDE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPIVSAVGHETD 241

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            T+AD+ ADLRAPTP+ AAE+    +  L   L + + R+   +   +  +      +  
Sbjct: 242 VTIADFVADLRAPTPSAAAELVSRNQLELLRQLQSQQQRMEMAMDYYLAQRQQQFTRINH 301

Query: 313 ALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNR 370
            L      L  +R +    +L R LE  ++  +    R  +    R+        I + +
Sbjct: 302 RLQQQHPHLRLARQQTLLFKLQRRLEDGMQNQLRLSSRRSDRAQQRLAQVQPQARIHRYQ 361

Query: 371 QHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFI 430
           Q + +++  ++Q                                                
Sbjct: 362 QRVQQQEYRLQQ-----------------------------------------------A 374

Query: 431 LSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFF 490
           L  ++ +      +    L++ +   TL RGY+  Q      +   +       +     
Sbjct: 375 LERRLNAYRQRFGVACSQLEAVSPLATLARGYSVTQTPRGELLKTTKQAQVGELLKTRLQ 434

Query: 491 DGQANAIVINKAPPKEQPTKKCQ 513
           DG   + V      K+   K+  
Sbjct: 435 DGWVESEVKTITVAKKPRKKRAA 457


>gi|228902698|ref|ZP_04066845.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis IBL
           4222]
 gi|228856885|gb|EEN01398.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis IBL
           4222]
          Length = 452

 Score =  371 bits (953), Expect = e-100,   Method: Composition-based stats.
 Identities = 159/498 (31%), Positives = 242/498 (48%), Gaps = 59/498 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVE--SNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           ++    +V+ L+ ++K  +E   +L  V ++GEIS ++  HS GH YF+LKD ++RI A+
Sbjct: 1   MEKQYLTVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAV 59

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           ++ G    I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L
Sbjct: 60  MFAGHNRNIKFKPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGVGNLHLAYEQLKVRL 119

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDEC 186
            EEGLFS  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+  
Sbjct: 120 EEEGLFSQVYKKAIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESA 179

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
              I  AI   N + E       D++I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA
Sbjct: 180 APSIVQAIRTANEMGE------IDVLIVGRGGGSIEELWAFNEEMVARAIFKSEIPIISA 233

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD+T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   
Sbjct: 234 VGHETDFTIADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMRELVHKKDEK 293

Query: 307 LNSLLKA--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
           L  L K+       Q       +LDR   +L    E  I +K      +   ++      
Sbjct: 294 LQVLQKSYAFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQ 353

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  +   Q+ +++ +                                        
Sbjct: 354 KIMQTKVAVETLQKQLQREM---------------------------------------- 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                     +++   +     + L++ +    + RGY  + D     +   ++++    
Sbjct: 374 -------QTLLQTKEFAFVRAAQKLEALSPLKVMMRGYGLVYDEEKQVLKSVKDVSLGDA 426

Query: 485 ILINFFDGQANAIVINKA 502
           + +   DG  +  V    
Sbjct: 427 VSVQLQDGILDCSVSGIE 444


>gi|149375100|ref|ZP_01892872.1| exodeoxyribonuclease VII, large subunit [Marinobacter algicola
           DG893]
 gi|149360464|gb|EDM48916.1| exodeoxyribonuclease VII, large subunit [Marinobacter algicola
           DG893]
          Length = 451

 Score =  371 bits (953), Expect = e-100,   Method: Composition-based stats.
 Identities = 150/490 (30%), Positives = 226/490 (46%), Gaps = 55/490 (11%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
            SVSEL++  +H++E++   V V GE+SG+    SSGH YFSLKD   +I   +++G   
Sbjct: 13  LSVSELNHQARHLLEASFMQVWVEGELSGF-SRPSSGHWYFSLKDRKCQIRCAMFRGFNQ 71

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
           +++ +P+EG +  + GK+T +     +QII+E + P+G G L  A E+ K+KL  EGLF 
Sbjct: 72  RVKEIPKEGEQVRIRGKVTLYENRGDFQIIVEHVEPAGLGALQQAYEELKRKLQMEGLFD 131

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANA 193
              K P+P  P+ I V+TSPTGA I DIL  ++ R P + V ++P  VQG     +I  A
Sbjct: 132 AARKKPLPSTPRHIGVVTSPTGAAIHDILTVLARRCPAIPVTLYPTAVQGQAATSDIVRA 191

Query: 194 ILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDW 253
           I +             D++I+ RGGGS+EDLW FN+E + RAIA   +P +SA+GHE D 
Sbjct: 192 IDRAAR------HGVADVLIIGRGGGSLEDLWCFNEEAVARAIAACPLPTVSAVGHEVDV 245

Query: 254 TLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKA 313
           T+AD+ ADLRAPTP+ AAE   P ++     L   E RL     R +K     L  L   
Sbjct: 246 TIADFVADLRAPTPSAAAEKISPDQQDWLRQLRERERRLAGAASRALKRMGTQLEHLSAR 305

Query: 314 LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHI 373
           L +  + L     R+D L   L   +   I R+     H+  R++       +  NR+ +
Sbjct: 306 LRDPRRELMEKAQRMDDLDLRLGKAMRQRIERENVRTEHLGQRLRMQSPAKRLNDNRRSV 365

Query: 374 LEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFILSH 433
            +  + + ++                          +  +      +             
Sbjct: 366 SQLSERLARV-------------------------ARQSVVQRQERL------------- 387

Query: 434 KIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFFDGQ 493
                        + L   +   TL RGY  +Q  N N + Q   L    RI      G 
Sbjct: 388 ---------EHLAQTLHVVSPLATLGRGYAIVQQENGNIVRQASELVPGDRITARVASGH 438

Query: 494 ANAIVINKAP 503
             A V     
Sbjct: 439 LEANVTAVKS 448


>gi|229075888|ref|ZP_04208864.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus Rock4-18]
 gi|229104808|ref|ZP_04235469.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus Rock3-28]
 gi|228678681|gb|EEL32897.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus Rock3-28]
 gi|228707203|gb|EEL59400.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus Rock4-18]
          Length = 452

 Score =  371 bits (953), Expect = e-100,   Method: Composition-based stats.
 Identities = 158/498 (31%), Positives = 240/498 (48%), Gaps = 59/498 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVE--SNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           ++    +V+ L+ ++K  +E   +L  V ++GEIS ++  HS GH YF+LKD ++RI A+
Sbjct: 1   MEKQYLTVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAV 59

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           ++ G    I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L
Sbjct: 60  MFAGHNRNIKFRPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGVGNLHLAYEQLKVRL 119

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDEC 186
            EEGLFS  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+  
Sbjct: 120 EEEGLFSQVYKKIIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESA 179

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
              I  AI   N           D++I+ RGGGSIE+LW FN+E++ RAI  S IPIISA
Sbjct: 180 APSIVQAIRTAN------EMGDIDVLIVGRGGGSIEELWAFNEEVVARAIFKSEIPIISA 233

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD+T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   
Sbjct: 234 VGHETDFTIADFVADLRAPTPTAAAELAAPNVIELQEKVLQRTLRLQRAMRELVHKKEEK 293

Query: 307 LNSLLKA--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
           L  L K+       Q       +LDR   +L    E  I +K      +   ++      
Sbjct: 294 LQVLQKSYAFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQ 353

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I   Q+ +++ +                                        
Sbjct: 354 KIIQTKVAIETLQKQLQREM---------------------------------------- 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                     +++   +     + L++ +    + RGY  + D     +   ++++    
Sbjct: 374 -------QTLLQTKEFAFVRAAQKLEALSPLKVMMRGYGLVYDEEKQVLKSVKDVSLGDA 426

Query: 485 ILINFFDGQANAIVINKA 502
           + +   DG  +  V    
Sbjct: 427 VSVQLQDGILDCSVSGIE 444


>gi|291618403|ref|YP_003521145.1| XseA [Pantoea ananatis LMG 20103]
 gi|291153433|gb|ADD78017.1| XseA [Pantoea ananatis LMG 20103]
          Length = 464

 Score =  371 bits (953), Expect = e-100,   Method: Composition-based stats.
 Identities = 139/506 (27%), Positives = 228/506 (45%), Gaps = 57/506 (11%)

Query: 9   SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAII 68
             +   ++VS L+  ++ ++E+ +  V +  EIS +    +SGH YF+LKD+ +++   +
Sbjct: 11  PPNANIFTVSRLNTTVRQLLENEMGLVWLSAEISNFT-QPASGHWYFTLKDDGAQVRCAM 69

Query: 69  WKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLL 128
           ++    ++ F P+ G + LV   IT +     YQ+IIES+ P+G G L    E+ K +L 
Sbjct: 70  FRNGNRRVTFRPQHGQQVLVRANITLYEPRGDYQLIIESMHPAGEGLLQQQFEQLKARLA 129

Query: 129 EEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECP 187
           +EGLF  +HK P+P   K + V+TS TGA + D+L+ +  R P L V+I+P  VQG + P
Sbjct: 130 QEGLFEPEHKKPLPQPAKQVGVVTSATGAALHDVLRVLHRRDPSLPVVIYPTAVQGVDAP 189

Query: 188 KEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAI 247
             I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA+
Sbjct: 190 AAIVRAIELANQRAE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSAV 243

Query: 248 GHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTL 307
           GHETD T+AD+ ADLRAPTP+ AAE+    +  L   L + + RL   +   +  +    
Sbjct: 244 GHETDVTIADFVADLRAPTPSAAAEIVSRNQLELLRQLQSQQQRLEMAMDYYLARQQRVF 303

Query: 308 NSLLKALPNSDQTLSCSRYRLD--RLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHN 365
           + L   L      L  +R +    RL + L   +E  +    R  + +  R+        
Sbjct: 304 SRLDHRLQQQHPQLRLARQQTALFRLQQRLGEAMEQRLRNATRQQDRLSQRLAQQQPQQR 363

Query: 366 IQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLIT 425
           +   ++ +      ++Q +                                         
Sbjct: 364 LYLTQKSLQSWHYRLQQSM----------------------------------------- 382

Query: 426 RIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRI 485
                    +             L+  +   TL RG++   D     + + R ++T   +
Sbjct: 383 ------EKLLNRDKNRFGQLAAQLEGVSPLATLARGFSVTTDNAGQVVKKTRQVSTGDLL 436

Query: 486 LINFFDGQANAIVINKAPPKEQPTKK 511
                DG   + V    P K +  K 
Sbjct: 437 RTRLDDGWVESQVTQLIPEKPKRKKS 462


>gi|228960448|ref|ZP_04122099.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar pakistani str. T13001]
 gi|228799212|gb|EEM46178.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar pakistani str. T13001]
          Length = 452

 Score =  371 bits (953), Expect = e-100,   Method: Composition-based stats.
 Identities = 159/498 (31%), Positives = 242/498 (48%), Gaps = 59/498 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVE--SNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           ++    +V+ L+ ++K  +E   +L  V ++GEIS ++  HS GH YF+LKD ++RI A+
Sbjct: 1   MEKQYLTVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAV 59

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           ++ G    I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L
Sbjct: 60  MFAGHNRNIKFKPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGVGNLHLAYEQLKVRL 119

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDEC 186
            EEGLFS  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+  
Sbjct: 120 EEEGLFSQVYKKAIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESA 179

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
              I  AI   N + E       D++I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA
Sbjct: 180 APSIVQAIRTANEMGE------IDVLIVGRGGGSIEELWAFNEEMVARAIFQSEIPIISA 233

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD+T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   
Sbjct: 234 VGHETDFTIADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMRELVHKKEEK 293

Query: 307 LNSLLKA--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
           L  L K+       Q       +LDR   +L    E  I +K      +   ++      
Sbjct: 294 LQVLQKSYAFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQ 353

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  +   Q+ +++ +                                        
Sbjct: 354 KIMQTKVAVETLQKQLQREM---------------------------------------- 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                     +++   +     + L++ +    + RGY  + D     +   ++++    
Sbjct: 374 -------QTLLQTKEFAFVRAAQKLEALSPLKVMMRGYGLVYDEEKQVLKSVKDVSLGDA 426

Query: 485 ILINFFDGQANAIVINKA 502
           + +   DG  +  V    
Sbjct: 427 VSVQLQDGILDCSVSGIE 444


>gi|119775494|ref|YP_928234.1| exodeoxyribonuclease VII large subunit [Shewanella amazonensis
           SB2B]
 gi|158513091|sp|A1S858|EX7L_SHEAM RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|119767994|gb|ABM00565.1| Exodeoxyribonuclease VII large subunit [Shewanella amazonensis
           SB2B]
          Length = 447

 Score =  371 bits (953), Expect = e-100,   Method: Composition-based stats.
 Identities = 148/494 (29%), Positives = 224/494 (45%), Gaps = 57/494 (11%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
            Y+VS L+  ++ ++E  L  + + GEIS +    SSGH Y +LKD+HS++   ++KG  
Sbjct: 8   VYTVSRLNGEVRQLLEGQLGRIWLTGEISNFSS-PSSGHWYLTLKDSHSQLRCAMFKGRN 66

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
             + F P  G + LV G I+ +     YQ++IE++ P+G G L    E  K KL  EGLF
Sbjct: 67  TTVAFKPINGQQVLVRGSISVYEPRGDYQLLIEAMFPAGDGLLAAQFEALKMKLAAEGLF 126

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIAN 192
           +   K P+P   + I VITSPTGA IRD+L  +  R P + V+I+P  VQG    K+I  
Sbjct: 127 AQDTKRPLPESIQRIGVITSPTGAAIRDVLHVLKRRDPSVEVVIYPTAVQGTGADKDIIR 186

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N   E       D+++L RGGGS+EDLW FN E +  AI NS++ I+SA+GHE D
Sbjct: 187 AIELANQRLE------VDVLLLTRGGGSLEDLWCFNSEALAHAIYNSTLTIVSAVGHEVD 240

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            ++AD+ AD+RAPTP+  AE+    + H Q  L    ARL          + + L SL  
Sbjct: 241 TSIADFVADVRAPTPSAGAELLSGDQSHKQQKLAGALARLTQGWRHYALKRHSGLISLQS 300

Query: 313 ALPNSDQT--LSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNR 370
            L   D    L     RLD L   L  +++  +         +  R++       +   +
Sbjct: 301 RLDRQDPKRQLQQQSQRLDELELRLTSSIQRRLSSHTLTTERLKARLERHSPAQRLMMEQ 360

Query: 371 QHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFI 430
           Q +    + +                                               +  
Sbjct: 361 QRLTYLDERL-----------------------------------------------KGA 373

Query: 431 LSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFF 490
           +  +++   T +   +  L S +   TL RGY+  +D     +TQ  ++ T   I     
Sbjct: 374 MEDRLEDAQTHLGGLSHSLASVSPLATLSRGYSITRDAGGRVLTQASSMKTGDTIETQLE 433

Query: 491 DGQANAIVINKAPP 504
            G   A VI   P 
Sbjct: 434 QGSLLARVIEIKPE 447


>gi|225866162|ref|YP_002751540.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus 03BB102]
 gi|254783689|sp|C1ERQ3|EX7L_BACC3 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|225786828|gb|ACO27045.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus 03BB102]
          Length = 452

 Score =  371 bits (952), Expect = e-100,   Method: Composition-based stats.
 Identities = 159/498 (31%), Positives = 243/498 (48%), Gaps = 59/498 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVE--SNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           ++    +V+ L+ ++K  +E   +L  V ++GEIS ++  HS GH YF+LKD ++RI A+
Sbjct: 1   MEKQYLTVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAV 59

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           ++ G    I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L
Sbjct: 60  MFAGHNRNIKFRPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGIGNLHLAYEQLKVRL 119

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDEC 186
            EEGLFS  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+  
Sbjct: 120 EEEGLFSQVYKKTIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESA 179

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
              I  AI   N ++E       D++I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA
Sbjct: 180 APSIVQAIRTANEMEE------IDVLIVGRGGGSIEELWAFNEEMVARAIFKSEIPIISA 233

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD+T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   
Sbjct: 234 VGHETDFTVADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMRELVHKKEEK 293

Query: 307 LNSLLKA--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
           L  L K+       Q       +LDR   +L    E  I +K      +   ++      
Sbjct: 294 LQVLQKSYAFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQ 353

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  +   Q+ +++ +                                        
Sbjct: 354 KIMQTKVAVETLQKQLQREM---------------------------------------- 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                     +++   +     + L++ +    + RGY  + D     +   ++++    
Sbjct: 374 -------QTLLQTKEFAFVRAAQKLEALSPLKVMMRGYGLVYDEEKQVLKSVKDVSLGDA 426

Query: 485 ILINFFDGQANAIVINKA 502
           + +   DG  +  V    
Sbjct: 427 VSVQLQDGILDCSVSGIE 444


>gi|227328665|ref|ZP_03832689.1| exodeoxyribonuclease VII large subunit [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 464

 Score =  371 bits (952), Expect = e-100,   Method: Composition-based stats.
 Identities = 141/521 (27%), Positives = 230/521 (44%), Gaps = 58/521 (11%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M+ F          ++VS L+  ++ ++E  +  + + GEIS      SSGH YF+LKD 
Sbjct: 1   MSQFPSSA-----IFTVSRLNQTVRQLLEMEMGQIWLSGEISNL-SQPSSGHWYFTLKDE 54

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            +++   +++ +  K+ F P+ G + L+   IT +     YQ++ ES+ P+G G L    
Sbjct: 55  RAQVRCAMFRTSNRKVTFRPQNGQQVLIRASITLYEPRGDYQLLAESMQPAGDGLLQQQF 114

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPV 179
           E+ K++L  EGLF  Q K  +P   K + VITS +GA + DILQ +  R P L VI++P 
Sbjct: 115 EQLKQRLAAEGLFDQQFKQVLPSPAKQVGVITSASGAALHDILQVLQRRDPSLPVIVYPT 174

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
            VQG E P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S
Sbjct: 175 SVQGAEAPLQIVRAIELANQRDE------CDVLIVGRGGGSLEDLWSFNDERVARAIFAS 228

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
            IPI+SA+GHETD T+AD+  DLRAPTP+ AAE+    +  L   + +   RL   +   
Sbjct: 229 RIPIVSAVGHETDVTIADFVGDLRAPTPSAAAELVSRNQLELLRQIQSQRQRLEMAMDYY 288

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
           +  +      L   L      L  +R                                  
Sbjct: 289 LAQRNRDFTRLHHRLQQQHPQLRLARQ--------------------------------- 315

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH 419
                 + K RQ + +  Q   Q+ +   R   L+++           + + R+      
Sbjct: 316 ---QAQLVKLRQRLDDAMQQ--QLRQTSRRSERLQQRLMQQQPQTRIHRAQQRL------ 364

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
            ++L  +++  +  ++      + I    L+  +   TL RGY      +   +     +
Sbjct: 365 -QQLSYQMQSAVERQLNQNKQKLGIACSRLEGVSPLATLARGYNVTTAPDGKVLKNVAQI 423

Query: 480 ATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKRE 520
                +     DG   + V    P  +   K+ +  +   +
Sbjct: 424 TPGETLKTRLQDGWVESQVTTLVPNPDSAKKQRKPSSRTPK 464


>gi|42783299|ref|NP_980546.1| exodeoxyribonuclease VII large subunit [Bacillus cereus ATCC 10987]
 gi|47569439|ref|ZP_00240120.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus G9241]
 gi|217961670|ref|YP_002340240.1| exodeoxyribonuclease VII large subunit [Bacillus cereus AH187]
 gi|222097626|ref|YP_002531683.1| exodeoxyribonuclease vii large subunit [Bacillus cereus Q1]
 gi|229140914|ref|ZP_04269458.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus BDRD-ST26]
 gi|229157779|ref|ZP_04285854.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus ATCC 4342]
 gi|229198307|ref|ZP_04325014.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus m1293]
 gi|81830971|sp|Q731B3|EX7L_BACC1 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|226694637|sp|B7HNU3|EX7L_BACC7 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|254783690|sp|B9IXH3|EX7L_BACCQ RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|42739227|gb|AAS43154.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus ATCC
           10987]
 gi|47553854|gb|EAL12224.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus G9241]
 gi|217066432|gb|ACJ80682.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus AH187]
 gi|221241684|gb|ACM14394.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus Q1]
 gi|228585186|gb|EEK43297.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus m1293]
 gi|228625736|gb|EEK82488.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus ATCC 4342]
 gi|228642490|gb|EEK98777.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus BDRD-ST26]
 gi|324328094|gb|ADY23354.1| exodeoxyribonuclease VII large subunit [Bacillus thuringiensis
           serovar finitimus YBT-020]
          Length = 452

 Score =  371 bits (952), Expect = e-100,   Method: Composition-based stats.
 Identities = 158/498 (31%), Positives = 240/498 (48%), Gaps = 59/498 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVE--SNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           ++    +V+ L+ ++K  +E   +L  V ++GEIS ++  HS GH YF+LKD ++RI A+
Sbjct: 1   MEKQYLTVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAV 59

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           ++ G    I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L
Sbjct: 60  MFAGHNRNIKFRPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGVGNLHLAYEQLKVRL 119

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDEC 186
            EEGLFS  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+  
Sbjct: 120 EEEGLFSQVYKKTIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESA 179

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
              I  AI   N           D++I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA
Sbjct: 180 APSIVQAIRTAN------EMEGIDVLIVGRGGGSIEELWAFNEEMVARAIFKSEIPIISA 233

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD+T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   
Sbjct: 234 VGHETDFTIADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMRELVHKKEEK 293

Query: 307 LNSLLKA--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
           L  L K+       Q       +LDR   +L    E  I +K      +   ++      
Sbjct: 294 LQVLQKSYAFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQ 353

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  +   Q+ +++ +                                        
Sbjct: 354 KIMQTKVAVETLQKQLQREM---------------------------------------- 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                     +++   +     + L++ +    + RGY  + D     +   ++++    
Sbjct: 374 -------QTLLQTKEFAFVRAAQKLEALSPLKVMMRGYGLVYDEEKQVLKSVKDVSLGDA 426

Query: 485 ILINFFDGQANAIVINKA 502
           + +   DG  +  V    
Sbjct: 427 VSVQLQDGILDCSVSGIE 444


>gi|229111655|ref|ZP_04241205.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus Rock1-15]
 gi|228671790|gb|EEL27084.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus Rock1-15]
          Length = 452

 Score =  371 bits (952), Expect = e-100,   Method: Composition-based stats.
 Identities = 159/498 (31%), Positives = 242/498 (48%), Gaps = 59/498 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVE--SNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           ++    +V+ L+ ++K  +E   +L  V ++GEIS ++  HS GH YF+LKD ++RI A+
Sbjct: 1   MEKQYLTVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAV 59

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           ++ G    I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L
Sbjct: 60  MFAGHNRNIKFKPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGVGNLHLAYEQLKVRL 119

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDEC 186
            EEGLFS  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+  
Sbjct: 120 EEEGLFSQVYKKAIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESA 179

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
              I  AI   N + E       D++I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA
Sbjct: 180 APSIVQAIRTANEMGE------IDVLIVGRGGGSIEELWAFNEEMVARAIFQSEIPIISA 233

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD+T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   
Sbjct: 234 VGHETDFTIADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMRELVHKKEEK 293

Query: 307 LNSLLKA--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
           L  L K+       Q       +LDR   +L    E  I +K      +   ++      
Sbjct: 294 LQVLQKSYAFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQ 353

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  +   Q+ +++ +                                        
Sbjct: 354 KIMQTKVAVETLQKQLQREM---------------------------------------- 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                     +++   +     + L++ +    + RGY  + D     +   ++++    
Sbjct: 374 -------QTLLQTKEFAFVRAAQKLEALSPLKVMMRGYGLVYDEEKQVLKSVKDVSLGDA 426

Query: 485 ILINFFDGQANAIVINKA 502
           + +   DG  +  V    
Sbjct: 427 VSVQLQDGILDCSVSGIE 444


>gi|292489037|ref|YP_003531924.1| exodeoxyribonuclease VII large subunit [Erwinia amylovora CFBP1430]
 gi|292900167|ref|YP_003539536.1| exodeoxyribonuclease VII large subunit [Erwinia amylovora ATCC
           49946]
 gi|291200015|emb|CBJ47140.1| exodeoxyribonuclease VII large subunit [Erwinia amylovora ATCC
           49946]
 gi|291554471|emb|CBA21989.1| exodeoxyribonuclease VII large subunit [Erwinia amylovora CFBP1430]
          Length = 457

 Score =  371 bits (952), Expect = e-100,   Method: Composition-based stats.
 Identities = 144/513 (28%), Positives = 235/513 (45%), Gaps = 59/513 (11%)

Query: 4   FSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSR 63
            SQ    +   ++VS L+  ++ ++E  +  V +  EIS +    SSGH YF+LKD+ ++
Sbjct: 1   MSQAPGSN--IFTVSRLNSTVRKLLELEMGQVWLSAEISNF-SQPSSGHWYFTLKDDSAQ 57

Query: 64  IDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKR 123
           +   +++    ++ F P+ G + LV   IT +     YQ+I ES++P+G G L    E+ 
Sbjct: 58  VRCAMFRNGNRRVTFRPQNGQQVLVRATITLYEPRGDYQLIAESMLPAGDGLLQQQFEQL 117

Query: 124 KKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQ 182
           K++L+ EGLF  +HK P+P   + + VITS +GA + D+L+ +  R P L V+I+P  VQ
Sbjct: 118 KQRLMAEGLFEQRHKQPLPDPARQVGVITSASGAALHDVLRVLQRRDPSLPVVIYPTPVQ 177

Query: 183 GDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIP 242
           G E P  I  AI   N   E       D++I+ RGGGS+EDL  FNDE + RAI  S IP
Sbjct: 178 GAEAPPGIVRAIELANARNE------CDVLIVGRGGGSLEDLCSFNDERVARAIFASRIP 231

Query: 243 IISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKY 302
           I+SA+GHETD T+AD+AADLRAPTP+ AAE+    +      L + + R+   +   +  
Sbjct: 232 IVSAVGHETDVTIADFAADLRAPTPSAAAELVSRNQTERLRQLQSQQQRMEMAMDYYLAR 291

Query: 303 KINTLNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           +  T   L   L      L  +R +    +L R L   L+  + +  R   H+  R+ + 
Sbjct: 292 QQRTFTRLQHRLQQQHPQLRLARQQTALMQLQRRLGDALQQHLRQATRRQQHLGQRLNAF 351

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420
                I++  Q + + Q  + Q ++                                   
Sbjct: 352 RPELRIERASQQLQQWQYRLRQAMQ----------------------------------- 376

Query: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480
                        ++ +           L+  +   TL RG++     N   + + R L 
Sbjct: 377 ------------QQLGANKQRFGQLAARLEGVSPLATLARGFSVTSTANGQLVKKTRQLH 424

Query: 481 TKTRILINFFDGQANAIVINKAPPKEQPTKKCQ 513
               +     DG   + V    P K+   +  +
Sbjct: 425 QGDTLKTRLDDGWVESEVTVITPLKKTRGRSVK 457


>gi|228941341|ref|ZP_04103893.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar berliner ATCC 10792]
 gi|228974273|ref|ZP_04134842.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228980866|ref|ZP_04141170.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis Bt407]
 gi|228778802|gb|EEM27065.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis Bt407]
 gi|228785323|gb|EEM33333.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228818267|gb|EEM64340.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar berliner ATCC 10792]
          Length = 452

 Score =  371 bits (952), Expect = e-100,   Method: Composition-based stats.
 Identities = 159/498 (31%), Positives = 243/498 (48%), Gaps = 59/498 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVE--SNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           ++    +V+ L+ ++K  +E   +L  V ++GEIS ++  HS GH YF+LKD ++RI A+
Sbjct: 1   MEKQYLTVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAV 59

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           ++ G    I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L
Sbjct: 60  MFAGHNRNIKFKPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGVGNLHLAYEQLKVRL 119

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDEC 186
            EEGLFS  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+  
Sbjct: 120 EEEGLFSQVYKKAIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESA 179

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
              I  AI   N ++E       D++I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA
Sbjct: 180 APSIVQAIRTANEMRE------IDVLIVGRGGGSIEELWAFNEEMVARAIFKSEIPIISA 233

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD+T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   
Sbjct: 234 VGHETDFTIADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMKELVHKKEEK 293

Query: 307 LNSLLKA--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
           L  L K+       Q       +LDR   +L    E  I +K      +   ++      
Sbjct: 294 LQVLQKSYAFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQ 353

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  +   Q+ +++ +                                        
Sbjct: 354 KIIQTKVAVETLQKQLQREM---------------------------------------- 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                     +++   +     + L++ +    + RGY  + D     +   ++++    
Sbjct: 374 -------QTLLQTKEFAFVRAAQKLEALSPLKVMMRGYGLVYDEEKQVLKSVKDVSLGDA 426

Query: 485 ILINFFDGQANAIVINKA 502
           + +   DG  +  V    
Sbjct: 427 VSVQLQDGILDCSVSGIE 444


>gi|327394796|dbj|BAK12218.1| probable exodeoxyribonuclease VII large subunit XseA [Pantoea
           ananatis AJ13355]
          Length = 457

 Score =  371 bits (952), Expect = e-100,   Method: Composition-based stats.
 Identities = 139/506 (27%), Positives = 228/506 (45%), Gaps = 57/506 (11%)

Query: 9   SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAII 68
             +   ++VS L+  ++ ++E+ +  V +  EIS +    +SGH YF+LKD+ +++   +
Sbjct: 4   PPNANIFTVSRLNTTVRQLLENEMGLVWLSAEISNFT-QPASGHWYFTLKDDGAQVRCAM 62

Query: 69  WKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLL 128
           ++    ++ F P+ G + LV   IT +     YQ+IIES+ P+G G L    E+ K +L 
Sbjct: 63  FRNGNRRVTFRPQHGQQVLVRANITLYEPRGDYQLIIESMHPAGEGLLQQQFEQLKARLA 122

Query: 129 EEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECP 187
           +EGLF  +HK P+P   K + V+TS TGA + D+L+ +  R P L V+I+P  VQG + P
Sbjct: 123 QEGLFEAEHKKPLPQPAKQVGVVTSATGAALHDVLRVLHRRDPSLPVVIYPTAVQGVDAP 182

Query: 188 KEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAI 247
             I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA+
Sbjct: 183 AAIVRAIELANQRAE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSAV 236

Query: 248 GHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTL 307
           GHETD T+AD+ ADLRAPTP+ AAE+    +  L   L + + RL   +   +  +    
Sbjct: 237 GHETDVTIADFVADLRAPTPSAAAEIVSRNQLELLRQLQSQQQRLEMAMDYYLARQQRVF 296

Query: 308 NSLLKALPNSDQTLSCSRYRLD--RLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHN 365
           + L   L      L  +R +    RL + L   +E  +    R  + +  R+        
Sbjct: 297 SRLDHRLQQQHPQLRLARQQTALFRLQQRLGEAMEQRLRNVTRQQDRLSQRLAQQQPQQR 356

Query: 366 IQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLIT 425
           +   ++ +      ++Q +                                         
Sbjct: 357 LYLAQKSLQSWHYRLQQSM----------------------------------------- 375

Query: 426 RIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRI 485
                    +             L+  +   TL RG++   D     + + R ++T   +
Sbjct: 376 ------EKLLNRDKNRFGQLAAQLEGVSPLATLARGFSVTTDNAGQVVKKTRQVSTGDLL 429

Query: 486 LINFFDGQANAIVINKAPPKEQPTKK 511
                DG   + V    P K +  K 
Sbjct: 430 RTRLDDGWVESQVTQLIPEKPKRKKS 455


>gi|229031829|ref|ZP_04187817.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus AH1271]
 gi|228729447|gb|EEL80436.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus AH1271]
          Length = 452

 Score =  371 bits (951), Expect = e-100,   Method: Composition-based stats.
 Identities = 158/498 (31%), Positives = 242/498 (48%), Gaps = 59/498 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVE--SNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           ++    +V+ L+ ++K  +E   +L  V ++GEIS ++  HS GH YF+LKD ++RI A+
Sbjct: 1   MEKQYLTVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAV 59

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           ++ G    I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L
Sbjct: 60  MFAGHNRNIKFRPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGVGNLHLAYEQLKVRL 119

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDEC 186
            EEGLFS  +K  IP   K I VITSPTGA IRD++  I  R+P+  VI+FPV VQG+  
Sbjct: 120 EEEGLFSQVYKKTIPPYAKTIGVITSPTGAAIRDVITTIKRRYPIGNVIVFPVLVQGESA 179

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
              I  AI   N + E       D++I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA
Sbjct: 180 APSIVQAIRTANEMGE------IDVLIVGRGGGSIEELWAFNEEMVARAIFKSEIPIISA 233

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD+T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   
Sbjct: 234 VGHETDFTIADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMRELVHKKEEK 293

Query: 307 LNSLLKA--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
           L  L K+       Q       +LDR   +L    E  I +K      +   ++      
Sbjct: 294 LQVLQKSYAFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPAQ 353

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  +   Q+ +++ +                                        
Sbjct: 354 KIMQTKVAVETLQKQLQREM---------------------------------------- 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                     +++   +     + L++ +    + RGY  + D     +   ++++    
Sbjct: 374 -------QTLLQTKEFAFVRVAQKLEALSPLKVMMRGYGLVYDEEKQVLKSVKDVSLGDA 426

Query: 485 ILINFFDGQANAIVINKA 502
           + +   DG  +  V    
Sbjct: 427 VSVQLQDGILDCSVSGIE 444


>gi|259907727|ref|YP_002648083.1| exodeoxyribonuclease VII large subunit [Erwinia pyrifoliae Ep1/96]
 gi|224963349|emb|CAX54834.1| Exodeoxyribonuclease VII large subunit [Erwinia pyrifoliae Ep1/96]
 gi|283477581|emb|CAY73497.1| exodeoxyribonuclease VII large subunit [Erwinia pyrifoliae DSM
           12163]
          Length = 456

 Score =  371 bits (951), Expect = e-100,   Method: Composition-based stats.
 Identities = 144/511 (28%), Positives = 232/511 (45%), Gaps = 59/511 (11%)

Query: 4   FSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSR 63
            SQ    +   ++VS L+  ++ ++E  +  V +  EIS +    SSGH YF+LKD+ ++
Sbjct: 1   MSQPPGSN--IFTVSRLNSTVRKLLEMEMGQVWLSAEISNF-SQPSSGHWYFTLKDDTAQ 57

Query: 64  IDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKR 123
           +   +++    ++ F P+ G + LV   IT +     YQ+I ES+ P+G G L    E+ 
Sbjct: 58  VRCAMFRNGNRRVTFRPQNGQQVLVRATITLYEPRGDYQLIAESMQPAGDGLLQQQFEQL 117

Query: 124 KKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQ 182
           K++L+ EGLF   HK P+P   + + VITS +GA + D+L+ +  R P L V+I+P  VQ
Sbjct: 118 KQRLMTEGLFEQAHKQPLPDPARQVGVITSSSGAALHDVLRVLQRRDPSLPVVIYPTPVQ 177

Query: 183 GDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIP 242
           G E P  I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP
Sbjct: 178 GAEAPPGIVRAIELANARNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIP 231

Query: 243 IISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKY 302
           I+SA+GHETD T+AD+ ADLRAPTP+ AAE     +      L + + R+   +   +  
Sbjct: 232 IVSAVGHETDVTIADFVADLRAPTPSAAAEQVSRNQIERLRQLQSQQQRMEMAMDYYLAQ 291

Query: 303 KINTLNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           +  T   L   L      L  +R +     L R L+  L+  + R  R    +  R+ + 
Sbjct: 292 QQRTFTRLQHRLQQQHPQLRLARQQTALMILQRRLDDALQQQLRRAARRQEILGQRLNAF 351

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420
                I++  Q + + Q  ++Q ++                                   
Sbjct: 352 RPEIRIERASQQLQQWQYRLQQAMQ----------------------------------- 376

Query: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480
                        ++ +           L+  +   TL RG++   + +   I + R L 
Sbjct: 377 ------------QQLGTGKQHFGQLAARLEGVSPLATLARGFSVTSNADGQVIKKTRQLH 424

Query: 481 TKTRILINFFDGQANAIVINKAPPKEQPTKK 511
               +     DG   + V    P K+   + 
Sbjct: 425 RGDTLKTRLDDGWVESEVTVITPLKKTRGRS 455


>gi|228910016|ref|ZP_04073836.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis IBL
           200]
 gi|228849533|gb|EEM94367.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis IBL
           200]
          Length = 452

 Score =  371 bits (951), Expect = e-100,   Method: Composition-based stats.
 Identities = 159/498 (31%), Positives = 242/498 (48%), Gaps = 59/498 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVE--SNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           ++    +V+ L+ ++K  +E   +L  V ++GEIS ++  HS GH YF+LKD ++RI A+
Sbjct: 1   MEKQYLTVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAV 59

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           ++ G    I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L
Sbjct: 60  MFAGHNRNIKFKPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGVGNLHLAYEQLKVRL 119

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDEC 186
            EEGLFS  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+  
Sbjct: 120 EEEGLFSQVYKKAIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESA 179

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
              I  AI   N + E       DI+I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA
Sbjct: 180 APSIVQAIRTANEMGE------IDILIVGRGGGSIEELWAFNEEMVARAIFKSEIPIISA 233

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD+T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   
Sbjct: 234 VGHETDFTIADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMRELVHKKEEK 293

Query: 307 LNSLLKA--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
           L  L ++       Q       +LDR   +L    E  I +K      +   ++      
Sbjct: 294 LQVLQRSYAFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQ 353

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  +   Q+ +++ +                                        
Sbjct: 354 KIIQTKVAVETLQKQLQREM---------------------------------------- 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                     +++   +     + L++ +    + RGY  + D     +   ++++    
Sbjct: 374 -------QTLLQTKEFAFVRAAQKLEALSPLKVMMRGYGLVYDEEKQVLKSVKDVSLGDA 426

Query: 485 ILINFFDGQANAIVINKA 502
           + +   DG  +  V    
Sbjct: 427 VSVQLQDGILDCSVSGIE 444


>gi|229098652|ref|ZP_04229592.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus Rock3-29]
 gi|229117677|ref|ZP_04247047.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus Rock1-3]
 gi|228665769|gb|EEL21241.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus Rock1-3]
 gi|228684731|gb|EEL38669.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus Rock3-29]
          Length = 452

 Score =  371 bits (951), Expect = e-100,   Method: Composition-based stats.
 Identities = 158/498 (31%), Positives = 240/498 (48%), Gaps = 59/498 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVE--SNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           ++    +V+ L+ ++K  +E   +L  V ++GEIS ++  HS GH YF+LKD ++RI A+
Sbjct: 1   MEKQYLTVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAV 59

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           ++ G    I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L
Sbjct: 60  MFAGHNRNIKFRPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGVGNLHLAYEQLKVRL 119

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDEC 186
            EEGLFS  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+  
Sbjct: 120 EEEGLFSQVYKKIIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESA 179

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
              I  AI   N           D++I+ RGGGSIE+LW FN+E++ RAI  S IPIISA
Sbjct: 180 APSIVQAIRTAN------EMGDIDVLIVGRGGGSIEELWAFNEEVVARAIFKSEIPIISA 233

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD+T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   
Sbjct: 234 VGHETDFTIADFVADLRAPTPTAAAELAAPNVIELQEKVLQRTLRLQRAMRELVHKKEEK 293

Query: 307 LNSLLKA--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
           L  L K+       Q       +LDR   +L    E  I +K      +   ++      
Sbjct: 294 LQVLQKSYAFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQ 353

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I   Q+ +++ +                                        
Sbjct: 354 KIIQTKVAIETLQKQLQREM---------------------------------------- 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                     +++   +     + L++ +    + RGY  + D     +   ++++    
Sbjct: 374 -------QTLLQTKEFAFVRAAQKLEALSPLKVMMRGYGLVYDEEKQVLKSVKDISLGDA 426

Query: 485 ILINFFDGQANAIVINKA 502
           + +   DG  +  V    
Sbjct: 427 VSVQLQDGILDCSVSGIE 444


>gi|262276500|ref|ZP_06054309.1| exodeoxyribonuclease VII large subunit [Grimontia hollisae CIP
           101886]
 gi|262220308|gb|EEY71624.1| exodeoxyribonuclease VII large subunit [Grimontia hollisae CIP
           101886]
          Length = 442

 Score =  371 bits (951), Expect = e-100,   Method: Composition-based stats.
 Identities = 140/492 (28%), Positives = 233/492 (47%), Gaps = 57/492 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIW 69
            +   Y+VS L+  ++ ++E+ +  V + GEIS      +SGH YF+LKD  +++   ++
Sbjct: 4   TNTNIYTVSRLNAEVRLLLENEMGIVWLVGEISNLTM-ATSGHWYFTLKDRQAQVKCAMF 62

Query: 70  KGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLE 129
           KG   ++ F P  G + LV  +++ +     YQII+ES+ P G G L    EK K +L  
Sbjct: 63  KGNNRRVTFRPANGNQVLVRARLSLYEPRGDYQIIVESMQPEGDGLLQQQFEKLKMQLAA 122

Query: 130 EGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPK 188
           EGLF+   K P+P  P+ + V+TS TGA + DIL  +  R P L V+I+P +VQG +   
Sbjct: 123 EGLFAASLKKPLPEQPRRVGVVTSSTGAALHDILHVLKRRDPSLPVVIYPTQVQGKDAAI 182

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           +IA AI + N+  E       D++I+ RGGGS+EDLW FN+E++ R IA S+IPI+SA+G
Sbjct: 183 QIAQAIGRANSRNE------CDVLIVGRGGGSLEDLWCFNEEIVARTIAASTIPIVSAVG 236

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HE D T+AD+ AD+RAPTP+ AAE+           L     RL +   R +      L 
Sbjct: 237 HEIDVTIADFVADVRAPTPSAAAELVSRDTSVRVQQLSQRTDRLAHAFSRHLSRSQEQLT 296

Query: 309 SLLKA--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNI 366
            L     L +    +     +LD L R L  ++   +    +  +  + +++     + I
Sbjct: 297 RLQHRLALQHPKARIQHQAQQLDELKRRLHQSMRYRLQTDAQRLDRALEKLERYSPANQI 356

Query: 367 QKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITR 426
              +  +   +Q +   +++ LR                                     
Sbjct: 357 PGQKALLGYMEQRLIDAMRRQLR------------------------------------- 379

Query: 427 IEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRIL 486
                         ++++    L + +   TL RGY+  ++     I     L +  +I+
Sbjct: 380 ----------QHQHALALKMETLDAVSPLATLARGYSITRNERGEVIRSVSMLKSGDQII 429

Query: 487 INFFDGQANAIV 498
            +F DG+  + V
Sbjct: 430 SSFGDGEIQSTV 441


>gi|206976322|ref|ZP_03237230.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus H3081.97]
 gi|206745518|gb|EDZ56917.1| exodeoxyribonuclease VII, large subunit [Bacillus cereus H3081.97]
          Length = 452

 Score =  371 bits (951), Expect = e-100,   Method: Composition-based stats.
 Identities = 159/498 (31%), Positives = 241/498 (48%), Gaps = 59/498 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVE--SNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           ++    +V+ L+ ++K  +E   +L  V ++GEIS ++  HS GH YF+LKD ++RI A+
Sbjct: 1   MEKQYLTVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAV 59

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           ++ G    I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L
Sbjct: 60  MFAGHNRNIKFRPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGVGNLHLAYEQLKVRL 119

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDEC 186
            EEGLFS  +K  IP   K I VITSPTGAVIRDI+  I  R+P+  VI+FPV VQG+  
Sbjct: 120 EEEGLFSQVYKKTIPPYAKTIGVITSPTGAVIRDIITTIKRRYPIGNVIVFPVLVQGESA 179

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
              I  AI   N           D++I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA
Sbjct: 180 APSIVQAIRTAN------EMEGIDVLIVGRGGGSIEELWAFNEEMVARAIFKSEIPIISA 233

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD+T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   
Sbjct: 234 VGHETDFTIADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMRELVHKKEEK 293

Query: 307 LNSLLKA--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
           L  L K+       Q       +LDR   +L    E  I +K      +   ++      
Sbjct: 294 LQVLQKSYAFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQ 353

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  +   Q+ +++ +                                        
Sbjct: 354 KIMQTKVAVETLQKQLQREM---------------------------------------- 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                     +++   +     + L++ +    + RGY  + D     +   ++++    
Sbjct: 374 -------QTLLQTKEFAFVRAAQKLEALSPLKVMMRGYGLVYDEEKQVLKSVKDVSLGDA 426

Query: 485 ILINFFDGQANAIVINKA 502
           + +   DG  +  V    
Sbjct: 427 VSVQLQDGILDCSVSGIE 444


>gi|301055673|ref|YP_003793884.1| exodeoxyribonuclease VII large subunit [Bacillus anthracis CI]
 gi|300377842|gb|ADK06746.1| exodeoxyribonuclease VII large subunit [Bacillus cereus biovar
           anthracis str. CI]
          Length = 452

 Score =  370 bits (950), Expect = e-100,   Method: Composition-based stats.
 Identities = 159/498 (31%), Positives = 241/498 (48%), Gaps = 59/498 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVE--SNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           ++    +V+ L+ ++K  +E   +L  V ++GEIS ++  HS GH YF+LKD ++RI A+
Sbjct: 1   MEKQYLTVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAV 59

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           ++ G    I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L
Sbjct: 60  MFAGHNRNIKFRPENGMKVLVKGKISIYEASGSYQIYIQDMQPDGVGNLHLAYEQLKVRL 119

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDEC 186
            EEGLFS  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+  
Sbjct: 120 EEEGLFSQVYKKTIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESA 179

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
              I  AI   N           D++I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA
Sbjct: 180 APSIVQAIRTAN------EMEGIDVLIVGRGGGSIEELWAFNEEMVARAIFKSEIPIISA 233

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD+T+AD+ ADLRAPTPT AAE+AVP    LQ  ++    RL   +  L+  K   
Sbjct: 234 VGHETDFTIADFVADLRAPTPTAAAELAVPNIIELQEKVLQRTLRLQRAMRELVHKKEEK 293

Query: 307 LNSLLKA--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
           L  L K+       Q       +LDR   +L    E  I +K      +   ++      
Sbjct: 294 LQVLQKSYAFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQ 353

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  +   Q+ +++ +                                        
Sbjct: 354 KIMQTKVAVETLQKQLQREM---------------------------------------- 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                     +++   +     + L++ +    + RGY  + D     +   ++++    
Sbjct: 374 -------QTLLQTKEFAFVRAAQKLEALSPLKVMMRGYGLVYDEEKQVLKSVKDVSLGDA 426

Query: 485 ILINFFDGQANAIVINKA 502
           + +   DG  +  V    
Sbjct: 427 VSVQLQDGILDCSVSGIE 444


>gi|329297574|ref|ZP_08254910.1| exodeoxyribonuclease VII large subunit [Plautia stali symbiont]
          Length = 455

 Score =  370 bits (950), Expect = e-100,   Method: Composition-based stats.
 Identities = 143/511 (27%), Positives = 236/511 (46%), Gaps = 59/511 (11%)

Query: 4   FSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSR 63
            S   + +   ++VS L+  ++ ++E+ +  V +  EIS +    +SGH YF+LKD+ ++
Sbjct: 1   MSLPPTAN--IFTVSRLNTTVRQLLENEMGLVWLSAEISNFT-QPASGHWYFTLKDDGAQ 57

Query: 64  IDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKR 123
           +   +++ +  ++ F P+ G + LV   IT +     YQ+IIES+ P+G G L    E+ 
Sbjct: 58  VRCAMFRNSNRRVSFRPQHGQQVLVRASITLYEPRGDYQLIIESMHPAGEGLLQQQFEQL 117

Query: 124 KKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQ 182
           K +L  EGLF  Q K P+P   + +AVITS TGA + D+L+ +  R P L V+I+P  VQ
Sbjct: 118 KARLAAEGLFDQQFKQPLPEPARQVAVITSATGAALHDVLRVLHRRDPSLPVVIYPTAVQ 177

Query: 183 GDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIP 242
           G + P  I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S +P
Sbjct: 178 GVDAPAAIVRAIELANQRDE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRLP 231

Query: 243 IISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKY 302
           I+SA+GHETD T+AD+ ADLRAPTP+ AAE+    +  L   L + + R+   +   +  
Sbjct: 232 IVSAVGHETDVTIADFVADLRAPTPSAAAELVSRNQIELLRRLQSQQQRMEMAMDYYVAQ 291

Query: 303 KINTLNSLLKALPNSDQTLSCSRYRLD--RLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           +      L   L      L  +R +    +L R L+  ++  +    R  + ++ R++S 
Sbjct: 292 QQRRFTRLQHRLQQQHPQLRLARQQTTLLQLQRRLQEAVDQRLRLANRQQDRLLQRLQSQ 351

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420
                I + +Q + +    ++Q                                      
Sbjct: 352 QPQERILRAQQQLQQWHYRLQQG------------------------------------- 374

Query: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480
                     +  ++             L+  +   TL RG++   D+    + + R L 
Sbjct: 375 ----------MEKQLNHSRQRFGALAAQLEGVSPLATLARGFSVTTDSQGQVVKKTRQLH 424

Query: 481 TKTRILINFFDGQANAIVINKAPPKEQPTKK 511
           T   +     DG   + V    P K +  K 
Sbjct: 425 TGDLLRTRLDDGWVESQVTALQPQKTRSRKA 455


>gi|228987371|ref|ZP_04147491.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
 gi|228772343|gb|EEM20789.1| Exodeoxyribonuclease 7 large subunit [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
          Length = 452

 Score =  370 bits (950), Expect = e-100,   Method: Composition-based stats.
 Identities = 158/498 (31%), Positives = 240/498 (48%), Gaps = 59/498 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVE--SNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           ++    +V+ L+ ++K  +E   +L  V ++GEIS ++  HS GH YF+LKD ++RI A+
Sbjct: 1   MEKQYLTVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAV 59

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           ++ G    I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L
Sbjct: 60  MFAGHNRNIKFRPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGVGNLHLAYEQLKVRL 119

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDEC 186
            EEGLFS  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+  
Sbjct: 120 EEEGLFSQVYKKTIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESA 179

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
              I  AI   N           D++I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA
Sbjct: 180 APSIVQAIRTAN------EMEGIDVLIVGRGGGSIEELWAFNEEMVARAIFKSEIPIISA 233

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD+T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   
Sbjct: 234 VGHETDFTIADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMRELVHKKEEK 293

Query: 307 LNSLLKA--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
           L  L K+       Q       +LDR   +L    E  I +K      +   ++      
Sbjct: 294 LQVLQKSYAFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQ 353

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  +   Q+ +++ +                                        
Sbjct: 354 KIMQTKVAVETLQKQLQREM---------------------------------------- 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                     +++   +     + L++ +    + RGY  + D     +   ++++    
Sbjct: 374 -------QTLLQTKEFAFVRVAQKLEALSPLKVMMRGYGLVYDEEKQVLKSVKDVSLGDA 426

Query: 485 ILINFFDGQANAIVINKA 502
           + +   DG  +  V    
Sbjct: 427 VSVQLQDGILDCSVSGIE 444


>gi|229163126|ref|ZP_04291082.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus R309803]
 gi|228620532|gb|EEK77402.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus R309803]
          Length = 452

 Score =  370 bits (950), Expect = e-100,   Method: Composition-based stats.
 Identities = 159/498 (31%), Positives = 241/498 (48%), Gaps = 59/498 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVE--SNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           ++    +V+ L+ ++K  +E   +L  V ++GEIS ++  HS GH YF+LKD ++RI A+
Sbjct: 1   MEKQYLTVTALTRYIKTKIEYDPHLQSVWLKGEISNFKN-HSRGHMYFTLKDENARIAAV 59

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           ++ G    I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L
Sbjct: 60  MFAGHNRNIKFRPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGIGNLHLAYEQLKVRL 119

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDEC 186
            EEGLFS  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+  
Sbjct: 120 EEEGLFSQVYKKIIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESA 179

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
              I  AI   N + E       D++I+ RGGGSIE+LW FN+EM+ RAI  S IPIISA
Sbjct: 180 APSIVQAIRTANEMGE------IDVLIVGRGGGSIEELWAFNEEMVARAIFKSEIPIISA 233

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD+T+AD+ ADLRAPTPT AAE+A P    LQ  ++    RL   +  L+  K   
Sbjct: 234 VGHETDFTIADFVADLRAPTPTAAAELAAPNIIELQEKVLQRTLRLQRAMRELVHKKEEK 293

Query: 307 LNSLLKA--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
           L  L K+       Q       +LDR   +L    E  I +K      +   ++      
Sbjct: 294 LQVLQKSYAFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQ 353

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I   Q+ +++ +                                        
Sbjct: 354 KIMQTKVAIETLQKQLQREM---------------------------------------- 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                     +++   +     + L++ +    + RGY  +       +   ++++    
Sbjct: 374 -------QTLLQTKEFAFVRAAQKLEALSPLKVMMRGYGLVYGEEKQVLKSVKDVSLGDA 426

Query: 485 ILINFFDGQANAIVINKA 502
           + +   DG  +  V    
Sbjct: 427 VSVQLQDGILDCSVSGIE 444


>gi|212634310|ref|YP_002310835.1| exodeoxyribonuclease VII large subunit [Shewanella piezotolerans
           WP3]
 gi|212555794|gb|ACJ28248.1| Exonuclease VII, large subunit [Shewanella piezotolerans WP3]
          Length = 449

 Score =  370 bits (949), Expect = e-100,   Method: Composition-based stats.
 Identities = 138/496 (27%), Positives = 221/496 (44%), Gaps = 57/496 (11%)

Query: 9   SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAII 68
           +  +  Y+VS L+  ++ ++E  L  + +  EIS +     SGH Y +LKDN S+I   +
Sbjct: 8   TSKNNVYTVSRLNGEVRQLLEGQLGRIWLNAEISNF-AAPGSGHWYLTLKDNFSQIRCAM 66

Query: 69  WKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLL 128
           +KG    + F P  G + LV G I+ +     YQ++IES++P+G G L    E  K KL 
Sbjct: 67  FKGRNQAVTFRPANGQQVLVKGNISVYEPRGDYQLLIESMLPAGDGLLAQQYEALKMKLA 126

Query: 129 EEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRF-PLRVIIFPVKVQGDECP 187
            EG+F+   K P+P   + I V+TSPTGA IRDIL  ++ R   + VII+P  VQG +  
Sbjct: 127 AEGMFATDTKRPLPENIQRIGVVTSPTGAAIRDILHVLARRDSSIEVIIYPTAVQGTDAA 186

Query: 188 KEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAI 247
             I NAI   N+  E       D++++ RGGGS+EDLW FNDE +   I NS IP++SA+
Sbjct: 187 VSICNAINLANSRAE------VDVLLVTRGGGSLEDLWSFNDEGLAHTIYNSGIPVVSAV 240

Query: 248 GHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTL 307
           GHE D T++DY ADLRAPTP+  AE+     ++    L  + +RL          + N L
Sbjct: 241 GHEVDTTISDYVADLRAPTPSAGAELLSKDADNKAQKLNAVLSRLQQSWQHYQLKQQNRL 300

Query: 308 NSLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHN 365
            +    L   +  + L       D +   L+  L+  +         + NR+ +    H 
Sbjct: 301 QTCEHKLQKQDPQRRLQTYEQTFDEMQLRLQKALQTKLHSLTLKQQQLANRLDNQSPQHR 360

Query: 366 IQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLIT 425
           ++   Q +    + ++  +                                   +     
Sbjct: 361 LELESQRLSYLAEKLKTSMT--------------------------------DKLAMSEQ 388

Query: 426 RIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRI 485
           R               V+   + L + +   TL RGY+   +     +    + +    +
Sbjct: 389 R---------------VAHRAQQLDTVSPLATLSRGYSITLNGEGKVVQGADDTSVGDTL 433

Query: 486 LINFFDGQANAIVINK 501
                DG   + VI+ 
Sbjct: 434 TTRLRDGNITSTVIDI 449


>gi|197285406|ref|YP_002151278.1| exodeoxyribonuclease VII large subunit [Proteus mirabilis HI4320]
 gi|227355889|ref|ZP_03840281.1| exodeoxyribonuclease VII large subunit [Proteus mirabilis ATCC
           29906]
 gi|226697596|sp|B4EY61|EX7L_PROMH RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|194682893|emb|CAR43242.1| exodeoxyribonuclease VII large subunit [Proteus mirabilis HI4320]
 gi|227163877|gb|EEI48779.1| exodeoxyribonuclease VII large subunit [Proteus mirabilis ATCC
           29906]
          Length = 462

 Score =  370 bits (949), Expect = e-100,   Method: Composition-based stats.
 Identities = 149/512 (29%), Positives = 235/512 (45%), Gaps = 57/512 (11%)

Query: 9   SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAII 68
            +++  ++VS L+  ++ ++E  +  + +  EIS +    +SGH YF+LKD H++I A +
Sbjct: 4   PINNNIFTVSRLNKTVRQLLEMEMGRIWISAEISNFT-QPASGHWYFTLKDTHAQIRAAM 62

Query: 69  WKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLL 128
           ++G   K+ F P+ G + LV   IT +     YQ+I+ES+ P+G G L    E  K+KL 
Sbjct: 63  FRGQNTKVTFRPQHGQQVLVRATITLYEPRGDYQLIVESMQPAGDGLLQQQFELLKQKLS 122

Query: 129 EEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECP 187
            EGLF   HK P+P   K I VITS TGA + DIL  +  R P L +II+P  VQG E P
Sbjct: 123 AEGLFDALHKKPLPTPAKQIGVITSSTGAALHDILNILRRRDPSLPIIIYPTAVQGAEAP 182

Query: 188 KEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAI 247
            +I +AI   N  KE       D++I+ RGGGS+EDLW FNDE + RAI  S IPI+SA+
Sbjct: 183 MQIVHAIELANRRKE------CDVLIVGRGGGSLEDLWAFNDERVARAIFASDIPIVSAV 236

Query: 248 GHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTL 307
           GHETD T+AD+ ADLRAPTP+ AAE+    K  L   L + + RL   +   +  K+  L
Sbjct: 237 GHETDVTIADFIADLRAPTPSAAAELISRNKLELLRQLQSQQQRLEMAMDYYLAKKLRAL 296

Query: 308 NSLLKALPNSDQTLSCSRYRLDRLPRELE--HNLEIIIFRKYRHFNHIINRIKSDFLIHN 365
             L   L      L  +R +      +     + + ++  K      +  R+        
Sbjct: 297 TQLHHRLQQQHPHLRLARQQNVLATTKQRLVTSFQRLLQTKQNQHTQLQKRLNYQEPSPQ 356

Query: 366 IQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLIT 425
           IQ   +   +    + +                                           
Sbjct: 357 IQALLRQQQQLIYRMRE------------------------------------------- 373

Query: 426 RIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRI 485
                +S ++       +I+   L+S +   TL RGY+  +  + + +   + +     +
Sbjct: 374 ----SISQQLARQREQFAISCSRLESVSPLATLSRGYSISEVASGDVLKNTKQVKKGDTL 429

Query: 486 LINFFDGQANAIVINKAPPKEQPTKKCQLHNN 517
                DG   + VIN      +     +  ++
Sbjct: 430 KTRVEDGWITSEVINTQKIPAKRKPAPKSKSS 461


>gi|260771389|ref|ZP_05880314.1| exodeoxyribonuclease VII large subunit [Vibrio furnissii CIP
           102972]
 gi|260613515|gb|EEX38709.1| exodeoxyribonuclease VII large subunit [Vibrio furnissii CIP
           102972]
          Length = 440

 Score =  370 bits (949), Expect = e-100,   Method: Composition-based stats.
 Identities = 139/492 (28%), Positives = 239/492 (48%), Gaps = 57/492 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIW 69
            +   Y+VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++   ++
Sbjct: 2   TNPNIYTVSRLNAEVRLLLENEMGIVWLIGEISNFSA-PVSGHWYLTLKDSRAQVKCAMF 60

Query: 70  KGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLE 129
           KG+   + F P+ G + LV  +++ +     YQIIIES+ P G G L    ++ K +L  
Sbjct: 61  KGSNRFVRFKPQNGQQVLVKARLSLYEPRGDYQIIIESMQPEGDGRLQQEFDQLKMQLAA 120

Query: 130 EGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPK 188
           EGLF+   K+P+P  P+ + VITS TGA + DILQ +  R P L +II+P  VQG++   
Sbjct: 121 EGLFAQTLKHPLPEHPRCVGVITSKTGAALHDILQVLKRRDPSLPIIIYPTLVQGEDAAI 180

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
           +IA AI + N  +E       D++I+ RGGGS+EDLW FN E++ R IA S IPIISA+G
Sbjct: 181 QIAQAIGRANAREE------CDVLIVGRGGGSLEDLWCFNHEIVARTIAASQIPIISAVG 234

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HE D T+AD+ AD+RAPTP+ AAE+      H + +    E +L++ +   +  +   L 
Sbjct: 235 HEIDVTIADFVADVRAPTPSAAAELVSRDNSHKKQAFQGYEHKLSSAMRHYVSEQKGALK 294

Query: 309 SLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNI 366
            L   L   +    L   + +LD L   LE  ++  + +  +H     +R++       +
Sbjct: 295 QLQYRLDKQHPMYRLQRQQQQLDELSMRLERAIQKQLNQTRQHVAKQQHRLQLQSPEKTL 354

Query: 367 QKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITR 426
           ++    +  +++ +                                              
Sbjct: 355 REQHYTLALRERSLI--------------------------------------------- 369

Query: 427 IEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRIL 486
               +  ++ S     +     L + +   TL RGY+  Q +    + Q  ++ T  +++
Sbjct: 370 --DAMQRQLVSSRHRFTRLIDKLDTVSPLATLSRGYSITQTSQGEIVRQASDVKTGDQLV 427

Query: 487 INFFDGQANAIV 498
               DG+ ++ V
Sbjct: 428 TRLADGEIHSTV 439


>gi|90021105|ref|YP_526932.1| exodeoxyribonuclease VII large subunit [Saccharophagus degradans
           2-40]
 gi|89950705|gb|ABD80720.1| Exodeoxyribonuclease VII large subunit [Saccharophagus degradans
           2-40]
          Length = 454

 Score =  369 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 140/498 (28%), Positives = 238/498 (47%), Gaps = 55/498 (11%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
           N  + K   +   +SV EL+  +K ++E +L  + V GEIS +    +SGH YF+LKD  
Sbjct: 10  NQITAKRGGERKTFSVEELNRRVKDLLEVHLPLIWVEGEISNFSA-PASGHWYFTLKDER 68

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           +++   ++KG   +++F P+ G + L+  +++ + G   +Q+I E +  SG G L    E
Sbjct: 69  AQVRCAMFKGRNQQVKFRPKAGDKVLLRARVSLYEGRGDFQLIAEHMEESGFGLLQQRYE 128

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVK 180
             K +LL EGLF++  K PIP +P  I +ITSPTGA +RD+L  +  RFP + V + P  
Sbjct: 129 ALKAQLLNEGLFNEADKQPIPTLPNHIGIITSPTGAAVRDVLSVLQRRFPSIPVTVIPAP 188

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQGD+ P ++  AI               D+++L RGGGSIEDLW FN+E + R I    
Sbjct: 189 VQGDDAPAKLIQAIDI------AENSGLFDVLLLCRGGGSIEDLWAFNNEALARRIYECD 242

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IPI+SA+GHE D+T+AD+ ADLRAPTP+ AAE+  P K  +   L +   +L   + + +
Sbjct: 243 IPIVSAVGHEVDFTIADFVADLRAPTPSAAAELLCPNKTDIDQLLQHFAKQLKQRLHQRL 302

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
                 +N L   L +  + L+    +LD+L   L   +++ + +      +   R+   
Sbjct: 303 SQYAQAVNHLRTRLKHPGERLNARAQQLDQLEIRLTRAIQLRLQKDGTTLRNREQRLTQQ 362

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420
                + ++++ + + +  + Q + +                                 +
Sbjct: 363 HPQKLLAQHQKDLAKLRLQLNQAISRL--------------------------------L 390

Query: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480
            K   R++  +                +L   +   TLKRGY+     +   I    +  
Sbjct: 391 DKKTDRLQRAV---------------ALLDIASPLATLKRGYSITTKADGTVIRTPADTP 435

Query: 481 TKTRILINFFDGQANAIV 498
               I I   +G+ +A +
Sbjct: 436 KGETIHIKLAEGELSAKI 453


>gi|331673961|ref|ZP_08374724.1| exodeoxyribonuclease VII, large subunit [Escherichia coli TA280]
 gi|331069234|gb|EGI40626.1| exodeoxyribonuclease VII, large subunit [Escherichia coli TA280]
          Length = 456

 Score =  369 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 143/506 (28%), Positives = 233/506 (46%), Gaps = 57/506 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQYKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANQRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSARQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRAGQQQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +                                          
Sbjct: 356 RIHRAQTRIQQLEYRLAE------------------------------------------ 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +           L++ +  +TL RGY+     +   + Q + +     
Sbjct: 374 -----TLRAQLSATRERFGNAVTHLEAVSPLSTLARGYSVTSAADGAVLKQVKQVKAGDT 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTK 510
           +     DG   ++V + A  ++   K
Sbjct: 429 LTTRLNDGVVVSVVSDVAKTRKPRKK 454


>gi|157371832|ref|YP_001479821.1| exodeoxyribonuclease VII large subunit [Serratia proteamaculans
           568]
 gi|166919634|sp|A8GHV3|EX7L_SERP5 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|157323596|gb|ABV42693.1| exodeoxyribonuclease VII, large subunit [Serratia proteamaculans
           568]
          Length = 458

 Score =  369 bits (947), Expect = e-100,   Method: Composition-based stats.
 Identities = 140/504 (27%), Positives = 227/504 (45%), Gaps = 57/504 (11%)

Query: 14  EYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
            ++VS L+  ++ ++E  +  + +  EIS +    SSGH YF+LKD+ +++   +++ T 
Sbjct: 9   IFTVSRLNQTVRQLLEMEMGQIWLSAEISNF-SQPSSGHWYFTLKDDRAQVRCAMFRNTN 67

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            +  F P+ G + LV   IT +     YQ+I ES+ P+G G L    ++ K++L  EGLF
Sbjct: 68  RRTTFRPQNGQQVLVRASITLYEPRGDYQLIAESMQPAGDGLLQQQFDQLKQRLSAEGLF 127

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIAN 192
             Q K P+P   K + VITS +GA + D+LQ +  R P L +II+P  VQG E P +I  
Sbjct: 128 DQQFKQPLPSPAKRVGVITSASGAALHDVLQVLQRRDPSLPIIIYPTSVQGAEAPLQIVR 187

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IPI+SA+GHETD
Sbjct: 188 AIETANRRDE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPIVSAVGHETD 241

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
            T+AD+ ADLRAPTP+ AAE+    +  L   L + + R+   +   +  +      +  
Sbjct: 242 VTIADFVADLRAPTPSAAAELVSRNQLELLRQLQSQQQRMEMAMDYYLAQRQQQFTRINH 301

Query: 313 ALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNR 370
            L      L  +R +    +L R LE  ++  +    R       R+        I + +
Sbjct: 302 RLQQQHPHLRLARQQTLLFKLQRRLEDGMQNQLRLSSRRSERAQQRLAQMQPQARIHRYQ 361

Query: 371 QHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFI 430
           Q + +++  ++Q                                                
Sbjct: 362 QRVQQQEYRLQQ-----------------------------------------------A 374

Query: 431 LSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFF 490
           L  ++ +      +    L++ +   TL RGY+  Q      +   +       +     
Sbjct: 375 LERQLNAWRQRFGVACSQLEAVSPLATLARGYSVTQTPRGELLKTTKQAQVGELLKTRLQ 434

Query: 491 DGQANAIVINKAPPKEQPTKKCQL 514
           DG   + V      K+   K+   
Sbjct: 435 DGWVESEVKTITLAKKPRKKRAAE 458


>gi|226326335|ref|ZP_03801853.1| hypothetical protein PROPEN_00183 [Proteus penneri ATCC 35198]
 gi|225205286|gb|EEG87640.1| hypothetical protein PROPEN_00183 [Proteus penneri ATCC 35198]
          Length = 460

 Score =  369 bits (947), Expect = e-100,   Method: Composition-based stats.
 Identities = 152/507 (29%), Positives = 243/507 (47%), Gaps = 53/507 (10%)

Query: 9   SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAII 68
            +++  ++VS L+  ++ ++E  +  + +  EIS +    SSGH YF+LKD H++I A +
Sbjct: 4   PINNNIFTVSRLNKTVRQLLEMEMGRIWISAEISNFT-QPSSGHWYFTLKDTHAQIRAAM 62

Query: 69  WKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLL 128
           ++G   K+ F P+ G + LV   IT +     YQ+I+ES+ P+G G L    E  K+KL 
Sbjct: 63  FRGQNAKVTFRPQHGQQVLVRATITLYEPRGDYQLIVESMQPAGDGLLQQQFELLKQKLS 122

Query: 129 EEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECP 187
            EGLF   +K P+P   K I VITS TGA + DIL  +  R P L V+I+P  VQG E P
Sbjct: 123 AEGLFDAIYKKPLPSPAKQIGVITSSTGAALHDILNILRRRDPSLPVLIYPTAVQGAEAP 182

Query: 188 KEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAI 247
            +I +AI   N  KE       D++I+ RGGGS+EDLW FNDE + RAI  S IPI+SA+
Sbjct: 183 MQIVHAIELANRRKE------CDVLIVGRGGGSLEDLWAFNDERVARAIFASEIPIVSAV 236

Query: 248 GHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTL 307
           GHETD T+AD+ ADLRAPTP+ AAE+    K  L   L + + RL   +   +  K+  +
Sbjct: 237 GHETDVTIADFIADLRAPTPSAAAELISRNKLELLRQLQSQQQRLEMAMDYYLAKKLRAI 296

Query: 308 NSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQ 367
             L   L      L  +R +                                      + 
Sbjct: 297 TQLYHRLQQQHPHLRLARQQN-----------------------------VLASTQQRLV 327

Query: 368 KNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRI 427
            + Q +L+ +QH +  +++ L Y                ++  ++I  L    + LI R+
Sbjct: 328 SSFQRLLQAKQHQQTQLQKRLNY----------------QEPSSQIQTLLRQQQLLIYRM 371

Query: 428 EFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILI 487
              ++ ++       +I+   L+S +   TL RGY+  +  +   +   + +     +  
Sbjct: 372 RESIAQQLSRQREQFAISCSRLESVSPLATLSRGYSISETMSGEVLKNTKQVKVGDPLKT 431

Query: 488 NFFDGQANAIVINKAPPKEQPTKKCQL 514
              DG   + V+     + +     + 
Sbjct: 432 RVEDGWITSEVVKTQKIRAKRKTTAKN 458


>gi|296114490|ref|ZP_06833143.1| exodeoxyribonuclease VII large subunit [Gluconacetobacter hansenii
           ATCC 23769]
 gi|295978846|gb|EFG85571.1| exodeoxyribonuclease VII large subunit [Gluconacetobacter hansenii
           ATCC 23769]
          Length = 486

 Score =  369 bits (947), Expect = e-100,   Method: Composition-based stats.
 Identities = 160/496 (32%), Positives = 263/496 (53%), Gaps = 29/496 (5%)

Query: 3   PFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHS 62
           P     + +  EYSVSE+S  ++  +E     + VRGEI+ ++  +SSGH YFSLKD   
Sbjct: 7   PSGAPGATNIAEYSVSEISGAIRSTLEGTFGRIRVRGEITEFK-RYSSGHLYFSLKDEKG 65

Query: 63  RIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEK 122
           ++ +++W+G+++++   PE G+E +  GKI+++   S YQ++I+ L  +G G LL  +EK
Sbjct: 66  KLSSVVWRGSVSRLGLKPENGVEVIATGKISSYGERSSYQMVIDRLEYAGEGALLARIEK 125

Query: 123 RKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQ 182
            + +L +EG+F  + K  IPF+P++I V+TS  GAV+ DI   ++ RFP  ++++PV VQ
Sbjct: 126 LRLRLAQEGVFDAERKQRIPFLPRVIGVVTSAQGAVLHDIRTTVARRFPRDLLVWPVPVQ 185

Query: 183 GDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIP 242
           G+   + IA A+   + +       RPD++I+ARGGGS+EDL  FNDE ++RA+A  +IP
Sbjct: 186 GEGAAERIAEAVAGFDRIDGRTGIARPDVLIVARGGGSLEDLMAFNDESVLRAVAACTIP 245

Query: 243 IISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKY 302
           +ISA+GHETD TL D+ +D RAPTPT AAEMAVPV+  L++ L +  ARL+N + R+++ 
Sbjct: 246 VISAVGHETDTTLIDFVSDRRAPTPTAAAEMAVPVRTELEADLAHRMARLSNGLGRVLQL 305

Query: 303 KINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFL 362
               L      LP+    L  +R RLD     L+  L  ++ R+        +R+     
Sbjct: 306 GRARLGRAAAGLPDLPSLLETARIRLDDRGYRLDMALPALLERRRARLQAACDRLP--TP 363

Query: 363 IHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKK 422
              I   R  +      + +             +++   +  LR                
Sbjct: 364 GTIIALKRSGLTLASAALARGGP-------QYLRDRRGRVTALRPSAP------------ 404

Query: 423 LITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATK 482
                   L   ++     V      L+S + +  L+RGY  +QD   + +T    +   
Sbjct: 405 -------ALLALLRERRARVQGEGGRLESLSPRAVLERGYVLVQDRAGHPLTLAAEVKAG 457

Query: 483 TRILINFFDGQANAIV 498
            ++++ F DG   A V
Sbjct: 458 AQVIMTFADGDVAARV 473


>gi|145298846|ref|YP_001141687.1| exodeoxyribonuclease VII, large subunit [Aeromonas salmonicida
           subsp. salmonicida A449]
 gi|142851618|gb|ABO89939.1| exodeoxyribonuclease VII, large subunit [Aeromonas salmonicida
           subsp. salmonicida A449]
          Length = 456

 Score =  369 bits (946), Expect = e-100,   Method: Composition-based stats.
 Identities = 144/504 (28%), Positives = 238/504 (47%), Gaps = 57/504 (11%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
            P S  N  +   ++V+ L+  ++ I+E +L  V + GE+S    + SSGH YFSLKD  
Sbjct: 5   TPSSAANGREQQVFTVTRLNSAVRMILEQDLGLVWLTGELSNL-AMPSSGHWYFSLKDLG 63

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           +++   ++KG   ++ F P++G++ LV  +++ +     YQ+IIES+ P+G G L    E
Sbjct: 64  AQVRCAMFKGNNRRVAFRPQDGMQVLVQARVSLYEPRGDYQLIIESMQPAGDGVLALRFE 123

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVK 180
           + K++L  EGLF +  K P+P  P+ + ++TS TGA + D+L  +  R P L V I+P +
Sbjct: 124 ELKRRLGAEGLFDEGRKRPLPREPRAVGLVTSATGAALHDMLTVLKRRAPDLPVFIYPTQ 183

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQG     +I  AI   N   E       D++I+ RGGGS+EDLW FN+E++ RAIANS+
Sbjct: 184 VQGSAAIGQIVAAIALANRRAE------VDVLIVGRGGGSLEDLWCFNEEVVARAIANSA 237

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP+ISA+GHE D T++D+AADLRAPTP+ AAE+  P +      L +L  RL   + R  
Sbjct: 238 IPVISAVGHEVDVTISDFAADLRAPTPSAAAELVAPDQSARAQRLAHLWQRLVQAMNRHQ 297

Query: 301 KYKINTLNSLLKALPN--SDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIK 358
               +    L K L +    + L     RLD L   L+  L   + +  R   ++  R++
Sbjct: 298 TAARHGFVLLQKRLDHQDPKRRLEQQSQRLDELSARLQQLLNQRLHQGERRLANLELRLQ 357

Query: 359 SDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHT 418
           +      +   R+     Q+ +  ++ +                                
Sbjct: 358 AKSPERLLAIGRRRHQLAQERLYALITKRQDQASH------------------------- 392

Query: 419 HIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRN 478
                                  +++ T  L   +   TL RGY+  +  + + I +   
Sbjct: 393 ----------------------RLAMLTARLDGVSPLATLGRGYSITRTQSGDVINRAAQ 430

Query: 479 LATKTRILINFFDGQANAIVINKA 502
           +     ++    +G     V    
Sbjct: 431 VNAGQTLVTTLAEGHLQVRVEEVH 454


>gi|292493718|ref|YP_003529157.1| exodeoxyribonuclease VII large subunit [Nitrosococcus halophilus
           Nc4]
 gi|291582313|gb|ADE16770.1| exodeoxyribonuclease VII, large subunit [Nitrosococcus halophilus
           Nc4]
          Length = 452

 Score =  369 bits (946), Expect = e-100,   Method: Composition-based stats.
 Identities = 139/502 (27%), Positives = 238/502 (47%), Gaps = 55/502 (10%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M   S         Y++S L    ++++E N   + V GEIS      SSGH YF+LKD 
Sbjct: 1   MANVSSNPKSAQDIYTISRLVREARYVLERNFPLLWVAGEISNL-SQPSSGHIYFTLKDK 59

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            +++   +++     + F  E+G++ L   ++  +    ++Q+I+E L  +G G L  A 
Sbjct: 60  TAQVRCAMFRNRNRLLGFSLEDGMQVLARAQVGLYETRGEFQLIVEYLEEAGDGALRRAF 119

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPV 179
           E+ K+KL  EGLF+ +HK P+P +P+ + VITSP+GA I+DIL  +  RFP + V+I+P 
Sbjct: 120 EELKQKLSAEGLFAPEHKRPLPTLPRQVGVITSPSGAAIQDILSVLKRRFPAIPVLIYPT 179

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
            VQG+   ++IA AI +     +       D++ILARGGGS+EDLW FN+E + R I N 
Sbjct: 180 PVQGEGASQKIAAAIAKAEQRCD------CDLLILARGGGSLEDLWAFNNETLARTIYNC 233

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
           ++PII  +GHE D+T+AD+AAD RAPTP+ AAE+AVP         +NLE RL  +  + 
Sbjct: 234 TLPIICGVGHEIDFTIADFAADQRAPTPSAAAEIAVPDSREWCQHFLNLEQRLGFLFQQR 293

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
           +++  ++L  L + L +    L     R+D L + L      +   ++     ++  ++ 
Sbjct: 294 LQHLRHSLEGLTQRLRHPHTRLQEWAQRVDELEQRLHRAYTTLERERFHRLERLLTHLQR 353

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH 419
                 ++     +++  + ++   +QH                                
Sbjct: 354 LSPAQRLEVYHSRLVDLDRRLQASQQQH-------------------------------- 381

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
                          ++       +  R LQ+ + + TL+RGY  +       + +   +
Sbjct: 382 ---------------LEQQRMRFEMAQRALQAVSPQATLERGYAIVTGPQGVVLRKASQV 426

Query: 480 ATKTRILINFFDGQANAIVINK 501
               RI      G+    +   
Sbjct: 427 EPGARIEARLARGRIRGEITEI 448


>gi|307132052|ref|YP_003884068.1| exonuclease VII, large subunit [Dickeya dadantii 3937]
 gi|306529581|gb|ADM99511.1| exonuclease VII, large subunit [Dickeya dadantii 3937]
          Length = 467

 Score =  369 bits (946), Expect = e-100,   Method: Composition-based stats.
 Identities = 137/514 (26%), Positives = 231/514 (44%), Gaps = 57/514 (11%)

Query: 6   QKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRID 65
             +      ++VS L+  +K ++E  +  V + GEIS +    SSGH YF+LKD  +++ 
Sbjct: 7   SSSLPSSAIFTVSRLNQTVKQLLEGEMGQVWLSGEISNF-SQPSSGHWYFTLKDERAQVR 65

Query: 66  AIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKK 125
             +++    ++ F P+ G + L+   IT +     YQ++ ES+ P+G G L    E+ K+
Sbjct: 66  CAMFRTGNRRVTFRPQNGQQVLIRATITLYEPRGDYQLLAESMHPAGDGLLQQQFEQLKQ 125

Query: 126 KLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGD 184
           +L  EGLF  Q+K  +P   + + VITS +GA + DIL  +  R P L V+I+P  VQG 
Sbjct: 126 RLSAEGLFDQQYKQLLPKPARQVGVITSASGAALHDILHILQRRDPSLPVVIYPTAVQGV 185

Query: 185 ECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPII 244
           + P +I  AI   N  +E       D++I+ RGGGS+EDLW FNDE + RAI  S IPI+
Sbjct: 186 DAPAQIVRAIELANLRQE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPIV 239

Query: 245 SAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKI 304
           SA+GHETD T+AD+ ADLRAPTP+ AAE+    +  L   + +   RL   +   +  + 
Sbjct: 240 SAVGHETDVTIADFVADLRAPTPSAAAELVSRNQLELLRQIQSQRQRLEMAMDYYLAQRQ 299

Query: 305 NTLNSLLKALPNSDQTLSCSRYRLD--RLPRELEHNLEIIIFRKYRHFNHIINRIKSDFL 362
                L   L      L  +R +    RL + L+  +++ + ++ R    ++ R++    
Sbjct: 300 QQFVRLQHRLHQQHPQLRLARQQTQLIRLRQRLDEAIQLQLRQQTRRQERVVQRLRQHQP 359

Query: 363 IHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKK 422
              + + +Q + + +  ++                                         
Sbjct: 360 QPRLHRAQQQVQQLRYRMQ----------------------------------------- 378

Query: 423 LITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATK 482
                   L  ++             L++ +   TL RGY+     +   + +    A  
Sbjct: 379 ------SALEKQLNQHKQRFGEACSHLEAVSPLATLARGYSVTTAPDGKVMKRTAQAAKG 432

Query: 483 TRILINFFDGQANAIVINKAPPKEQPTKKCQLHN 516
             +     DG   + +        +P  K Q  N
Sbjct: 433 DILKTRLQDGWVESQITEIQKESTKPRTKRQTKN 466


>gi|253689374|ref|YP_003018564.1| exodeoxyribonuclease VII, large subunit [Pectobacterium carotovorum
           subsp. carotovorum PC1]
 gi|259646296|sp|C6DBG5|EX7L_PECCP RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|251755952|gb|ACT14028.1| exodeoxyribonuclease VII, large subunit [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 462

 Score =  369 bits (946), Expect = e-100,   Method: Composition-based stats.
 Identities = 140/519 (26%), Positives = 229/519 (44%), Gaps = 58/519 (11%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M+ F          ++VS L+  ++ ++E  +  + + GEIS      SSGH YF+LKD 
Sbjct: 1   MSQFPSSA-----IFTVSRLNQTVRQLLEMEMGQIWLSGEISNL-SQPSSGHWYFTLKDE 54

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            +++   +++ +  ++ F P+ G + L+   IT +     YQ++ ES+ P+G G L    
Sbjct: 55  RAQVRCAMFRTSNRRVTFRPQNGQQVLIRATITLYEPRGDYQLLAESMQPAGDGLLQQQF 114

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPV 179
           E+ K+KL  EGLF  Q K  +P   K + VITS +GA + DILQ +  R P L VI++P 
Sbjct: 115 EQLKQKLAAEGLFDQQFKQVLPSPAKQVGVITSASGAALHDILQVLQRRDPSLPVIVYPT 174

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
            VQG + P +I  AI   N  +E       D++I+ RGGGS+EDLW FNDE + RAI  S
Sbjct: 175 SVQGADAPLQIVRAIELANQREE------CDVLIVGRGGGSLEDLWSFNDERVARAIFAS 228

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
            IPI+SA+GHETD T+AD+  DLRAPTP+ AAE+    +  L   + +   RL   +   
Sbjct: 229 RIPIVSAVGHETDVTIADFVGDLRAPTPSAAAELVSRNQLELLRQIQSQRQRLEMAMDYY 288

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
           +  +      L   L      L  +R                                  
Sbjct: 289 LAQRNREFTRLHHRLQQQHPQLRLARQ--------------------------------- 315

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH 419
                 + K RQ + +  Q   Q+ +   R   L+++           + + R       
Sbjct: 316 ---QAQLVKLRQRLDDAMQQ--QLRQTLRRSERLQQRLMQQQPQTRIHRAQQR------- 363

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
           +++L  +++  +  ++      + I    L+  +   TL RGY      +   +     +
Sbjct: 364 LQQLSYQMQSAVERQLNQNKQKLGIACSRLEGVSPLATLARGYNVTTAPDGKVLKNVTQI 423

Query: 480 ATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNK 518
                +     DG   + V    P      K+ +  +  
Sbjct: 424 TPGETLKTRLQDGWVESQVTTLVPNPSSVKKRRKPSSQS 462


>gi|119476444|ref|ZP_01616795.1| Exodeoxyribonuclease VII [marine gamma proteobacterium HTCC2143]
 gi|119450308|gb|EAW31543.1| Exodeoxyribonuclease VII [marine gamma proteobacterium HTCC2143]
          Length = 469

 Score =  369 bits (946), Expect = e-100,   Method: Composition-based stats.
 Identities = 138/503 (27%), Positives = 234/503 (46%), Gaps = 50/503 (9%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M   +   +      ++S+L+   K ++E N   V + GEIS      SSGH YFSLKD+
Sbjct: 12  MQTNTDIQTPKRDTLTISQLNRQAKRLLEGNFPSVWIVGEISNL-SRPSSGHWYFSLKDS 70

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
           ++++   +++ +  ++ F  + G + +   K++ +     YQ+I+E +  +G G L    
Sbjct: 71  NAQVRCAMFRTSNARLRFQADSGQQVMARAKLSLYEARGDYQLIVEHMELAGDGLLARQF 130

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPV 179
           ++ K +L +EGLF  QHK  +P +P+ IA++TSPTGA I DIL  +  RFP + V IFP 
Sbjct: 131 DELKHRLFQEGLFDQQHKQILPTLPRHIAIVTSPTGAAIHDILTVLGRRFPSIPVTIFPT 190

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
            VQG      IA AI  +N L    + P  D+I+++RGGGS+EDLW FN+E++ RAI+ S
Sbjct: 191 PVQGQAAAAGIAKAISLVNQLAASGSLP-VDVILVSRGGGSLEDLWAFNEEVVARAISQS 249

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
            +P++SA+GHE D T+AD+ AD RAPTP+  AE+  P ++ + ++    E  L   +++ 
Sbjct: 250 DLPVVSAVGHEVDVTIADFVADHRAPTPSAGAELLSPDRQEILANFTGYEQALIRRMLQQ 309

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
           ++     L+     L +    L     RLD L   L+++      ++    + I +R++ 
Sbjct: 310 LESSRQRLHWQQTRLRHPGSRLQEHSQRLDELELRLKNSWRNRCQQQKLGIDLIQSRLQQ 369

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH 419
               H  ++         + +EQ V + + +                             
Sbjct: 370 QTPAHLTRQLTVRYQNLYRRLEQQVAKQMTHR---------------------------- 401

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
                                 +  T  +L + +   TL RGY  + D     IT     
Sbjct: 402 -------------------RQKLDNTMHLLDAVSPLATLDRGYAIVADAKGQVITNAATA 442

Query: 480 ATKTRILINFFDGQANAIVINKA 502
                I      G   + V++  
Sbjct: 443 TVGQSIHTKLAKGAIKSTVVSIE 465


>gi|238753869|ref|ZP_04615229.1| Exodeoxyribonuclease 7 large subunit [Yersinia ruckeri ATCC 29473]
 gi|238707857|gb|EEQ00215.1| Exodeoxyribonuclease 7 large subunit [Yersinia ruckeri ATCC 29473]
          Length = 459

 Score =  368 bits (945), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 141/510 (27%), Positives = 228/510 (44%), Gaps = 57/510 (11%)

Query: 9   SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAII 68
           +     ++VS L+  ++ ++E  +  + +  EIS +    +SGH YF+LKD+ +++   +
Sbjct: 4   TSATSIFTVSRLNQTVRQLLEMEMGQIWLTAEISNF-SQPASGHWYFTLKDDRAQVRCAM 62

Query: 69  WKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLL 128
           ++ +  +  F P+ G   LV   IT +     YQ+I ES+ P+G G L    E+ K +L 
Sbjct: 63  FRNSNRRTTFKPQNGQMVLVRASITLYEPRGDYQLIAESMQPAGDGLLQQQFEQLKARLA 122

Query: 129 EEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECP 187
            EGLF   HK P+P   K + VITS +GA + D+LQ +  R P L V+I+P  VQG E P
Sbjct: 123 AEGLFDALHKQPLPAPAKRVGVITSASGAALHDVLQVLQRRDPSLPVVIYPTSVQGAEAP 182

Query: 188 KEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAI 247
            +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IPI+SA+
Sbjct: 183 MQIVRAIEMANQRAE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASQIPIVSAV 236

Query: 248 GHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTL 307
           GHETD T+AD+ ADLRAPTP+ AAEM    +  L   +   + R+   +   +  +    
Sbjct: 237 GHETDVTIADFVADLRAPTPSAAAEMISRNQVELVRQIQAQQQRMEMAMDYYLAQRHQQF 296

Query: 308 NSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHN 365
             L   L      L  +R +    +L R LE   +  I    R    +  R+ +   +  
Sbjct: 297 TRLHHRLQQQHPHLRLARQQTLLLKLQRRLEDAAQNQIRLLARRGERLQQRLNNRQPLGK 356

Query: 366 IQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLIT 425
           I    Q + +++  ++Q                                           
Sbjct: 357 IHHYHQRVQQQEYRLKQ------------------------------------------- 373

Query: 426 RIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRI 485
                L  ++        I    L++ +   TL RGY+  Q  + + +   + +     +
Sbjct: 374 ----ALERQLNGYRQRFGIACSQLETVSPLATLARGYSVTQTPSGSLLKTTQQVHIGDTL 429

Query: 486 LINFFDGQANAIVINKAPPKEQPTKKCQLH 515
                DG   + +    P K+    + +  
Sbjct: 430 KTRLQDGWVESEITRLTPVKKTLKPRSRAK 459


>gi|293410920|ref|ZP_06654496.1| exodeoxyribonuclease VII [Escherichia coli B354]
 gi|291471388|gb|EFF13872.1| exodeoxyribonuclease VII [Escherichia coli B354]
          Length = 456

 Score =  368 bits (945), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 143/506 (28%), Positives = 233/506 (46%), Gaps = 57/506 (11%)

Query: 8   NSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
            S     ++VS L+  ++ ++E  +  V + GEIS +    +SGH YF+LKD+ +++   
Sbjct: 3   PSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFT-QPASGHWYFTLKDDTAQVRCA 61

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           +++ +  ++ F P+ G + LV   IT +     YQII+ES+ P+G G L    E+ K KL
Sbjct: 62  MFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKL 121

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDEC 186
             EGLF  Q+K P+P     + VITS TGA + DIL  +  R P L VII+P  VQGD+ 
Sbjct: 122 QAEGLFDQQYKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPTAVQGDDA 181

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
           P +I  AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IP++SA
Sbjct: 182 PGQIVRAIELANQRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASLIPVVSA 235

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD T+AD+ ADLRAPTP+ AAE+    ++ L   + +   RL   +   +  +   
Sbjct: 236 VGHETDVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSARQRLEMAMDYYLANRTRR 295

Query: 307 LNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
              +   L      L  +R +   +RL + +   LE  + R  +    +  R+       
Sbjct: 296 FTQIHHRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRAGQQQQRLTQRLNQQNPQP 355

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I + +  + +                                          
Sbjct: 356 RIHRAQTRIQQLEYRLAE------------------------------------------ 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                 L  ++ +           L++ +  +TL RGY+     +   + Q + +     
Sbjct: 374 -----TLRAQLSATRERFGNAVTHLEAVSPLSTLARGYSVTSAADGAVLKQVKQVKAGDT 428

Query: 485 ILINFFDGQANAIVINKAPPKEQPTK 510
           +     DG   ++V + A  ++   K
Sbjct: 429 LTTRLNDGVVVSVVSDVAKTRKPRKK 454


>gi|188533180|ref|YP_001906977.1| exodeoxyribonuclease VII large subunit [Erwinia tasmaniensis
           Et1/99]
 gi|226695873|sp|B2VE96|EX7L_ERWT9 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|188028222|emb|CAO96080.1| Exodeoxyribonuclease VII large subunit [Erwinia tasmaniensis
           Et1/99]
          Length = 456

 Score =  368 bits (944), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 142/511 (27%), Positives = 231/511 (45%), Gaps = 59/511 (11%)

Query: 4   FSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSR 63
            SQ    +   ++VS L+  ++ ++E  +  V +  EIS +    SSGH YF+LKD+ ++
Sbjct: 1   MSQPPGTN--IFTVSRLNSTVRKLLEMEMGQVWLSAEISNF-SQPSSGHWYFTLKDDTAQ 57

Query: 64  IDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKR 123
           +   +++    ++ F P+ G + LV   IT +     YQ+I ES+ P+G G L    ++ 
Sbjct: 58  VRCAMFRNGNRRVTFRPQNGQQVLVRATITLYEPRGDYQLIAESMQPAGDGLLQQQFDQL 117

Query: 124 KKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQ 182
           K++L+ EGLF   HK P+P   + + VITS +GA + D+L+ +  R P L V+I+P  VQ
Sbjct: 118 KQRLMAEGLFEQAHKQPLPDPARQVGVITSSSGAALHDVLRVLQRRDPSLPVVIYPTPVQ 177

Query: 183 GDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIP 242
           G E P  I  AI   N  KE       D++I+ RGGGS+EDLW FNDE + RAI  S IP
Sbjct: 178 GAEAPTGIVRAIELANARKE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIP 231

Query: 243 IISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKY 302
           I+SA+GHETD T+AD+ ADLRAPTP+ AAE+    +      L   + R+   +   +  
Sbjct: 232 IVSAVGHETDVTIADFVADLRAPTPSAAAELVSRDQIERLRQLQQQQQRMEMAMDYYLAR 291

Query: 303 KINTLNSLLKALPNSDQTLSCSRYRL--DRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           + +T   L   L      L  +R +    ++ R L+  L+  + +  R    +  R+ + 
Sbjct: 292 QQSTFTRLQHRLQQQHPQLRLARQQTALMKVQRRLDDALQQHLRQATRRQEQLGQRLNAF 351

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420
                I++  Q + + Q  + Q +                         + R+     H 
Sbjct: 352 RPEMRIERASQQLQQWQYRLRQAM-------------------------QQRLGTGKQH- 385

Query: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480
                                       L+  +   TL RG++         + +   L 
Sbjct: 386 ---------------------FGQLAARLEGVSPLATLARGFSVTSTAEGQVVKKTGQLH 424

Query: 481 TKTRILINFFDGQANAIVINKAPPKEQPTKK 511
               +     DG   + V    P K+   + 
Sbjct: 425 QGDTLKTRLDDGWIESEVTAITPLKKTRRRS 455


>gi|319405222|emb|CBI78827.1| exodeoxyribonuclease VII large subunit [Bartonella sp. AR 15-3]
          Length = 475

 Score =  368 bits (944), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 210/530 (39%), Positives = 305/530 (57%), Gaps = 56/530 (10%)

Query: 1   MNPFSQKN-SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKD 59
           M+ F +K+ + +  E+SVSE++  L+ IVE    +V VRGEISGYRG+H+SGHAYF+LKD
Sbjct: 1   MDLFLEKSVATNVAEFSVSEIAGALRRIVEEKFGYVRVRGEISGYRGVHASGHAYFALKD 60

Query: 60  NHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTA 119
           + +R++A+IW+G + K++F PEEG+E + +GK+TT+ GSSKYQIII++L P+G G L+T 
Sbjct: 61  DKARLEAVIWRGVIEKLQFPPEEGMEVVAVGKLTTYQGSSKYQIIIDTLEPTGVGALMTL 120

Query: 120 LEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPV 179
           LE RKKK  +EGLF D  K  +P++P+II V+TSPTGAVIRDI+ RIS RFPL ++++PV
Sbjct: 121 LENRKKKFADEGLFDDAKKKKLPYMPRIIGVVTSPTGAVIRDIIHRISDRFPLHILVWPV 180

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
           +VQG+   +E+A AI   N L  G    +PD+II+ARGGGS+EDLW FNDE +VRA++ S
Sbjct: 181 RVQGETSGQEVAAAIAGFNALPLGNVLSKPDLIIVARGGGSLEDLWGFNDEAVVRAVSAS 240

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
           +IPIISA+GHETDWTL DY AD RAPTPTGAAE AVPVK  L++ L +L  R      R 
Sbjct: 241 AIPIISAVGHETDWTLIDYVADWRAPTPTGAAERAVPVKLDLETQLASLNLRFFVGSARY 300

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
             +    L+++++ LP  DQ  +  R   D +   L+  L +   +K   F  ++ R+  
Sbjct: 301 FSFYKQKLSAVVRGLPTVDQLFALPRRNFDEISSRLQRALCVNYDKKRFCFYTLVIRLSP 360

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH 419
             L  N +K +Q+  E    +                                       
Sbjct: 361 RLL--NTKKAQQNTKEYTVRLHHAFL---------------------------------- 384

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
                          ++     + +  R+L+S +Y++ L+RG+       NN I +    
Sbjct: 385 -------------RNVEKQRVQIEMAFRLLKSTSYQSILERGFVLALGQENNPIKRLVQF 431

Query: 480 ATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
               +I + FFDG+ N    N        +K+ +   +       QG LF
Sbjct: 432 PRTGQISLRFFDGEVNVSTCNSVSKNSPNSKQLKRQKD------DQGTLF 475


>gi|119713108|gb|ABL97177.1| exodeoxyribonuclease VII large subunit [uncultured marine bacterium
           EB0_49D07]
          Length = 461

 Score =  368 bits (944), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 137/495 (27%), Positives = 221/495 (44%), Gaps = 49/495 (9%)

Query: 9   SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAII 68
           + +    SV +L+   K ++E+    + V GEIS      SSGH YF+LKD    I   +
Sbjct: 15  NHEEQVISVGQLNQQAKRLLENQFRGIAVLGEISNL-ARPSSGHIYFTLKDEDGAIRCAM 73

Query: 69  WKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLL 128
           ++   +++ F P+ G + ++ G+++ +     YQ+I+ S+ P+GSG L+   ++ KKKL 
Sbjct: 74  FRNQNSRLNFEPQNGDQCILKGQVSLYAPRGDYQLIVSSMQPAGSGNLMQQFDELKKKLD 133

Query: 129 EEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECP 187
            EGLFS   K  +P  P+ I VITS + A  +DIL  I  R P+ +V + P  VQGD  P
Sbjct: 134 AEGLFSQDIKQNLPTQPRHIGVITSESTAAFQDILTTIQRRAPISQVTLIPATVQGDTAP 193

Query: 188 KEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAI 247
           + + NA+               D+I++ RGGGSIEDLW FN+E + R I +  IPIIS +
Sbjct: 194 RTLINALQNALDFNNVNPENSFDVILMCRGGGSIEDLWAFNNESLAREIFDYPIPIISGV 253

Query: 248 GHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTL 307
           GHE D+T+AD+ ADLRAPTPT AAE+       L+ ++ + +  L +    L+K K   +
Sbjct: 254 GHEIDFTIADFVADLRAPTPTAAAELVTEYYFQLEDAIEDAKDALMHSFKNLVKEKYQRI 313

Query: 308 NSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQ 367
             + ++L +    L      LD L   L   ++  +    +      N +     +  I+
Sbjct: 314 LLISQSLKSPIILLKEQSQSLDNLEIRLSQIIQNSLNSTKQDLKIASNLLYQSNAMRVIE 373

Query: 368 KNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRI 427
           K +  I  K Q I+                                              
Sbjct: 374 KYQGMISSKMQSIQ---------------------------------------------- 387

Query: 428 EFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILI 487
              +   +     ++      L + +    L RGY  + D++   +T   N+     I  
Sbjct: 388 -HQIKSAMIKKGYALKNLETNLVAVSPLAVLDRGYAIVMDSSGKALTSSANIKVGDTIQT 446

Query: 488 NFFDGQANAIVINKA 502
               G   + V  K 
Sbjct: 447 RLATGNLTSDVTKKK 461


>gi|163941938|ref|YP_001646822.1| exodeoxyribonuclease VII large subunit [Bacillus weihenstephanensis
           KBAB4]
 gi|229013398|ref|ZP_04170535.1| Exodeoxyribonuclease 7 large subunit [Bacillus mycoides DSM 2048]
 gi|229061870|ref|ZP_04199200.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus AH603]
 gi|229135002|ref|ZP_04263808.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus BDRD-ST196]
 gi|229168924|ref|ZP_04296641.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus AH621]
 gi|226694638|sp|A9VGD4|EX7L_BACWK RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|163864135|gb|ABY45194.1| exodeoxyribonuclease VII, large subunit [Bacillus
           weihenstephanensis KBAB4]
 gi|228614516|gb|EEK71624.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus AH621]
 gi|228648504|gb|EEL04533.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus BDRD-ST196]
 gi|228717431|gb|EEL69099.1| Exodeoxyribonuclease 7 large subunit [Bacillus cereus AH603]
 gi|228747810|gb|EEL97676.1| Exodeoxyribonuclease 7 large subunit [Bacillus mycoides DSM 2048]
          Length = 452

 Score =  367 bits (943), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 157/498 (31%), Positives = 238/498 (47%), Gaps = 59/498 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVE--SNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAI 67
           ++    +V+ L+ ++K  +E   +L  V ++GEIS ++  HS GH YF+LKD ++RI A+
Sbjct: 1   MEKQYLTVTALTRYIKTKIEYDPHLQSVWLKGEISNFK-YHSRGHMYFTLKDENARIAAV 59

Query: 68  IWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKL 127
           ++ G    I+F PE G++ LV GKI+ +  S  YQI I+ + P G G L  A E+ K +L
Sbjct: 60  MFAGHNRNIKFRPENGMKVLVKGKISVYEASGSYQIYIQDMQPDGIGNLHLAYEQLKVRL 119

Query: 128 LEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDEC 186
            EEGLFS  +K  IP   K I VITSPTGA IRDI+  I  R+P+  VI+FPV VQG+  
Sbjct: 120 EEEGLFSQVYKKIIPPYAKTIGVITSPTGAAIRDIITTIKRRYPIGNVIVFPVLVQGESA 179

Query: 187 PKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISA 246
              I  AI   N           D++I+ RGGGSIE+LW FN+E++ R I  S IPIISA
Sbjct: 180 APSIVQAIRTAN------EMGDIDVLIVGRGGGSIEELWAFNEEVVAREIFTSEIPIISA 233

Query: 247 IGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINT 306
           +GHETD+T+AD+ ADLRAPTPT AAE+AVP    LQ  ++    RL   +   +  K   
Sbjct: 234 VGHETDFTIADFVADLRAPTPTAAAELAVPNTIELQEKVLQRTLRLQRAMRERVHKKEEK 293

Query: 307 LNSLLKA--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIH 364
           L  L K+       Q       +LDR   +L    E  I +K      +   ++      
Sbjct: 294 LQVLQKSYAFRYPRQVYEQKEEQLDRALEQLVLAKERYIDKKVNQLKQLSFYLEKHHPSQ 353

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLI 424
            I + +  I   Q+ +++ +                                        
Sbjct: 354 KIIQTKTAIETLQKQLQREM---------------------------------------- 373

Query: 425 TRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTR 484
                     +++         + L+  +    + RGY  + D     +   ++++    
Sbjct: 374 -------QTLLQTKEFVFVRAAQKLEVLSPLKVMMRGYGLVYDEEKQVLKSVKDVSLGDA 426

Query: 485 ILINFFDGQANAIVINKA 502
           + +   DG  +  V +  
Sbjct: 427 VSVQLQDGILDCSVSSIE 444


>gi|158521676|ref|YP_001529546.1| exodeoxyribonuclease VII, large subunit [Desulfococcus oleovorans
           Hxd3]
 gi|158510502|gb|ABW67469.1| exodeoxyribonuclease VII, large subunit [Desulfococcus oleovorans
           Hxd3]
          Length = 448

 Score =  367 bits (943), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 146/499 (29%), Positives = 245/499 (49%), Gaps = 58/499 (11%)

Query: 6   QKNSLDHPE---YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHS 62
            +     PE   Y+VS L+  +K ++E     + V GEIS ++    SGH YF+LKD+ +
Sbjct: 2   AQTHTSLPESGIYTVSRLTGEIKVLLEKQFPIIWVEGEISNFK-RPGSGHFYFTLKDSTA 60

Query: 63  RIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEK 122
           ++ A+++      ++F+PE+G++   +G+I+ +     YQ+I E ++P G G L+ A E+
Sbjct: 61  QVQAVMFVNQNRGLKFMPEDGMKITGLGRISVYAPRGNYQVIFEHIMPQGMGELVAAFEQ 120

Query: 123 RKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKV 181
            KKKL +EGLF    K P+PF+P  + +I+SPTGAV+ D++  ++ RFP + + I P  V
Sbjct: 121 LKKKLADEGLFDPGRKKPVPFLPAKVCLISSPTGAVVHDMIHVMTRRFPGIEIEILPASV 180

Query: 182 QGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           QGD+   EIA A+   N   +       D++++ARGGGS+EDL+ FN E + RA+A S+I
Sbjct: 181 QGDKAAVEIAAALALANRRADA------DVLVVARGGGSLEDLFAFNTETVARAVAASAI 234

Query: 242 PIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIK 301
           P++SA+GHETD+T+ D+ ADLRAPTP+ AAE+ VPVK+ L +   NL  R+      +I+
Sbjct: 235 PVVSAVGHETDFTICDFVADLRAPTPSAAAELIVPVKKELLAHCRNLRVRMVKGFDNIIR 294

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDF 361
           ++   L  + K L +  + L  +  RLD L   L   L+  I ++         ++ S  
Sbjct: 295 HRRRALRDMAKRLIDPRRALGDALLRLDELAMRLVRALDREIAKRAERLAWQQKQLFSRM 354

Query: 362 LIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIK 421
                 +         + +   ++                                    
Sbjct: 355 PERLTTEGLALTDRLVERLSSAMQ------------------------------------ 378

Query: 422 KLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQD-TNNNFITQKRNLA 480
                     +  ++     V   T+ L + + +  L+RGY+  Q  ++   I +     
Sbjct: 379 ----------TTYLRENRHRVDGLTQRLFALSPRAVLERGYSITQKVSDGQVIKKTGQAD 428

Query: 481 TKTRILINFFDGQANAIVI 499
               + I   DG     V 
Sbjct: 429 PGDALTIIVSDGSVRCTVD 447


>gi|152998145|ref|YP_001342980.1| exodeoxyribonuclease VII large subunit [Marinomonas sp. MWYL1]
 gi|150839069|gb|ABR73045.1| exodeoxyribonuclease VII, large subunit [Marinomonas sp. MWYL1]
          Length = 446

 Score =  367 bits (943), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 142/500 (28%), Positives = 241/500 (48%), Gaps = 57/500 (11%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           M  F+   S +   ++VS+L+  ++ ++E++L  + V GEIS      SSGH YFSLKD+
Sbjct: 1   MKKFTTSVSQET-AFTVSQLNRQIQQLLEASLPWILVEGEISNL-AKPSSGHWYFSLKDD 58

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
            ++I   ++KG    + F P++G    +  ++T +      Q+ +E +  +G G L  A 
Sbjct: 59  KAQIRCAMFKGKNAAVRFKPKDGDMVRLRARVTFYGPRGDCQLSVEGMESAGEGALQQAF 118

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPV 179
           E+ K  L  EGLF+ +HK P+P  P+ +A+ITSP GA +RD++     RFPL  + I P 
Sbjct: 119 ERLKNTLQAEGLFAPEHKKPLPTKPERVAIITSPIGAAVRDMVIAFRRRFPLTELTILPS 178

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
            VQG +  K I   + +             D IIL RGGGS+EDLW FNDE + RAI  +
Sbjct: 179 LVQGQDAAKNILRQLQR------ADGSGHFDAIILGRGGGSLEDLWSFNDETLARAIFAA 232

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
             PI+SA+GHETD+T+AD+ AD+RA TPT AAE+  P + HL   +   E +L   + R+
Sbjct: 233 QTPIVSAVGHETDFTIADFVADVRAATPTAAAELLSPDRNHLVRQIEQQEKQLARRMSRI 292

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
           ++     L+ ++K + +  + +   + +LD+L R L+ +++  +  +     ++ +R++ 
Sbjct: 293 LEQSQQQLDFMIKRIRHPKERIEQQQIQLDQLKRRLQQSMQRKVIEQQTQTANLAHRLER 352

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH 419
           +     I ++RQ +      + +                                     
Sbjct: 353 NSPSRRIDQDRQKLKNMDARLAR------------------------------------- 375

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
                      LS+ + +  T+ +     L   +  NTL RGY      +   I   +++
Sbjct: 376 ----------ALSNTLTNKQTTFARIIDKLNLVSPLNTLARGYAIA-SKDEQVIRSVKDV 424

Query: 480 ATKTRILINFFDGQANAIVI 499
                I +   DG  +  V 
Sbjct: 425 KAGDSISVRVQDGVLSCDVT 444


>gi|295706549|ref|YP_003599624.1| exodeoxyribonuclease VII large subunit [Bacillus megaterium DSM
           319]
 gi|294804208|gb|ADF41274.1| exodeoxyribonuclease VII, large subunit [Bacillus megaterium DSM
           319]
          Length = 446

 Score =  367 bits (943), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 146/492 (29%), Positives = 231/492 (46%), Gaps = 58/492 (11%)

Query: 15  YSVSELSYHLKHI--VESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
            +V+ L+ ++K    V+ ++  V ++GEIS ++  HS GH YF+LKD ++RI A+++ G 
Sbjct: 7   LTVTALTRYIKRKFDVDPHMQDVWIKGEISNFK-RHSRGHMYFTLKDQNARIAAVMFAGH 65

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
             ++ F PEEG+  L+  +I+ +  S  YQ+ ++ + P G G L  A E+ KKKL +EGL
Sbjct: 66  NRQLNFQPEEGMNVLIRAEISVYEPSGNYQMYVKEMQPDGVGNLYLAYEQLKKKLEKEGL 125

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F    K  +P  P  I VITSPTGA +RDI+  +  R+   +I+ P  VQG      I  
Sbjct: 126 FDPARKRKLPKYPTTIGVITSPTGAAVRDIITTLKRRYNANIIVMPALVQGVNAAPSIIK 185

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI + N  KE       D++I+ RGGGSIE+LW FN+E + RAI  S+IP+ISA+GHETD
Sbjct: 186 AIEEANRRKEA------DVLIVGRGGGSIEELWAFNEESVARAIFTSTIPVISAVGHETD 239

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ ADLRAPTPTGAAE+AVP    +   L     RL   +  +++     L    K
Sbjct: 240 FTIADFVADLRAPTPTGAAELAVPHISEITERLTQRNIRLLRSMKEMLQSSSRRLERSQK 299

Query: 313 A--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNR 370
           +       + +     +LD+L           I  K  ++  +   +  +   H + K  
Sbjct: 300 SYAFRYPQKLVEQKEQQLDQLMERFYREGRRYIEHKRTNYEQLTAALLRNHPEHQLTKAA 359

Query: 371 QHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFI 430
           +   +                                               L   +   
Sbjct: 360 ERQQQ-----------------------------------------------LTKMLTKE 372

Query: 431 LSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFF 490
           +   +K      +  T  L + +   T++RGY+ + D     I   + ++    + +   
Sbjct: 373 MQQLLKQKQLLFATATSKLHTLSPLKTMERGYSLVYDKEKELIKSTKQVSKGDVVNVRLT 432

Query: 491 DGQANAIVINKA 502
           DGQ    V    
Sbjct: 433 DGQLQCEVSKIE 444


>gi|117919683|ref|YP_868875.1| exodeoxyribonuclease VII large subunit [Shewanella sp. ANA-3]
 gi|158512316|sp|A0KUK0|EX7L_SHESA RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|117612015|gb|ABK47469.1| Exodeoxyribonuclease VII large subunit [Shewanella sp. ANA-3]
          Length = 448

 Score =  367 bits (943), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 144/497 (28%), Positives = 220/497 (44%), Gaps = 57/497 (11%)

Query: 12  HPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKG 71
           +  Y+VS L+  ++ I+E  L  V + GEIS +    SSGH Y +LKD++S+I   ++KG
Sbjct: 6   NNIYTVSRLNGEVRQILEGQLGKVWLNGEISNFSA-PSSGHWYLTLKDHYSQIRCAMFKG 64

Query: 72  TLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEG 131
               + F P  G + LV G I+ +     YQ++IES++P+G G L    E  K KL  +G
Sbjct: 65  RNQSVSFKPVNGQQVLVKGAISVYEPRGDYQLLIESMLPAGDGLLAQQFEALKMKLAAQG 124

Query: 132 LFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEI 190
           LF+   K  +P   + I VITSPTGA IRD+L  ++ R P + VII+P +VQG+     I
Sbjct: 125 LFAADTKRQLPKNIQRIGVITSPTGAAIRDVLHVLARRDPSIEVIIYPTQVQGENADMNI 184

Query: 191 ANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHE 250
             AI   N   E       D+++L RGGGS+EDLW FN E +   I NS++P++SA+GHE
Sbjct: 185 CQAINIANQRLE------VDVLLLTRGGGSLEDLWCFNSEALAHTIYNSALPVVSAVGHE 238

Query: 251 TDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSL 310
            D T++DY AD+RAPTP+  AE+     ++    L  + +RL          +   L+ L
Sbjct: 239 VDTTISDYVADVRAPTPSAGAELLSQDSDNKSQRLATVLSRLKQSASHYQLKQEKRLSLL 298

Query: 311 LKALPN--SDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQK 368
              L      +TL     R D +   LE  L   +    R    + NR++     H +  
Sbjct: 299 EHRLQRLDPKRTLQQFEQRFDEMQLRLEAALSNKLHGLSRRQQQLANRLEQQSPKHKLAL 358

Query: 369 NRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIE 428
               +      ++                                               
Sbjct: 359 ETNRLSYLATRLQ----------------------------------------------- 371

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
             +   +      ++     L++ +   TL RGY+   D NN  I     L+   +I   
Sbjct: 372 DAMQDTLNQSEQRITYAAHQLETVSPLATLSRGYSITTDANNQVIDNAAQLSVGDKINTR 431

Query: 489 FFDGQANAIVINKAPPK 505
              GQ  + V       
Sbjct: 432 LRHGQVQSTVTQITDES 448


>gi|330991091|ref|ZP_08315045.1| Exodeoxyribonuclease 7 large subunit [Gluconacetobacter sp. SXCC-1]
 gi|329761912|gb|EGG78402.1| Exodeoxyribonuclease 7 large subunit [Gluconacetobacter sp. SXCC-1]
          Length = 486

 Score =  367 bits (942), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 160/493 (32%), Positives = 268/493 (54%), Gaps = 29/493 (5%)

Query: 11  DHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWK 70
           + PE+SV+E+S  ++  +E     + VRGEI+ ++    SGH YFSLKD   ++ +++W+
Sbjct: 15  NTPEFSVAEISGAIRRTLEGTFGRIRVRGEITEFKRYP-SGHLYFSLKDEGGKLSSVVWR 73

Query: 71  GTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEE 130
           GT++++   PE G+E +  GKI+ +   S YQ++I+ L  +G G LL  +E+ +  L EE
Sbjct: 74  GTVSRLGLKPENGVEVIATGKISAYGERSSYQMVIDRLEYAGEGALLARIERLRLSLAEE 133

Query: 131 GLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEI 190
           GLF    K P+PF+P++I V+TS  GAV+ DI   I+ RFP RV+++PV VQGD   + I
Sbjct: 134 GLFDSARKRPLPFLPRVIGVVTSAQGAVLHDIRTTIARRFPHRVLVWPVPVQGDGAAERI 193

Query: 191 ANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHE 250
           A AI   + ++     PRPD++I+ARGGGS+EDL  FNDE ++RA+A   IP+ISA+GHE
Sbjct: 194 AQAIAGFDRIEGSPALPRPDVLIVARGGGSLEDLMAFNDEGVLRAVAACRIPVISAVGHE 253

Query: 251 TDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSL 310
           TD TL D+ +D RAPTPT AAEMAVPV+  L+++L   +ARL   + R ++     L+  
Sbjct: 254 TDTTLVDFVSDCRAPTPTAAAEMAVPVRAELEAALAQRDARLRGGLGRCLQLARARLDRA 313

Query: 311 LKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNR 370
              LP+    +  +R RLD L   L+  L   +        +  +R+ +  ++       
Sbjct: 314 AAGLPDLPGVVENARRRLDDLGYRLDLALPARVHAMRGRLQNASDRLPAPHML------- 366

Query: 371 QHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFI 430
             +  ++  + ++     + +    + + AIL  LR      +                 
Sbjct: 367 --LALRRADLARVGTASQQAMGALLRRREAILAGLRVPPAVLVS---------------- 408

Query: 431 LSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFF 490
              ++++  + ++ T   L + + +  L+RGY  + D+    +           +++ F 
Sbjct: 409 ---QLRASTSRLAGTGGRLDALSPRAVLERGYVLVTDSAGRPLAHAAQARGAPEVVMTFA 465

Query: 491 DGQANAIVINKAP 503
           DG+  A  + +A 
Sbjct: 466 DGKVAARPLGEAS 478


>gi|330829941|ref|YP_004392893.1| exodeoxyribonuclease 7 large subunit [Aeromonas veronii B565]
 gi|328805077|gb|AEB50276.1| Exodeoxyribonuclease 7 large subunit [Aeromonas veronii B565]
          Length = 459

 Score =  367 bits (942), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 141/509 (27%), Positives = 241/509 (47%), Gaps = 57/509 (11%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
            P S  N  +   ++V+ L+  ++ I+E +L  V + GE+S    + SSGH YFSLKD  
Sbjct: 5   TPSSAANGREQQVFTVTRLNSAVRMILEQDLGLVWLTGELSNL-AMPSSGHWYFSLKDMS 63

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
           +++   ++KG   ++ F P++G++ LV  +++ +     YQ+IIES+ P+G G L    E
Sbjct: 64  AQVRCAMFKGNNRRVAFRPQDGMQVLVQARVSLYEPRGDYQLIIESMQPAGDGVLALRFE 123

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVK 180
           + K++L  EGLF +  K P+P  P+ + ++TS TGA + D+L  +  R P L V I+P +
Sbjct: 124 ELKRRLGAEGLFDESRKRPLPREPRAVGLVTSSTGAALHDMLTVLKRRAPDLPVFIYPTQ 183

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQG     +I  AI + N   E       D++I+ RGGGS+EDLW FN+E + RAIA+S+
Sbjct: 184 VQGSAAISQIVAAIAKANQRAE------VDVLIVGRGGGSLEDLWCFNEEAVARAIAHSA 237

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP++SA+GHE D T++D+AADLRAPTP+ AAE+  P +      L++L+ RL   + R  
Sbjct: 238 IPVVSAVGHEVDVTISDFAADLRAPTPSAAAELVAPDQSARAQRLVHLKQRLLQAMSRQQ 297

Query: 301 KYKINTLNSLLKALPN--SDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIK 358
               +    L K L +    + L     RLD L   L+  L   +               
Sbjct: 298 TAARHDFILLQKRLDHQDPKRRLEQQSQRLDELSSRLQQLLRQRLH-------------- 343

Query: 359 SDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHT 418
                           + ++ +  +                  L +  +  +  +     
Sbjct: 344 ----------------QGERRLTNL-----------------ELRLQGKSPERLLAAGKR 370

Query: 419 HIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRN 478
             +    R+  +++ +       +++ T  L   +   TL RGY+  +      I++   
Sbjct: 371 RHQLAEERLHALIAKRQDLASHRLAMLTARLDGVSPLATLGRGYSITRTARGEVISRADQ 430

Query: 479 LATKTRILINFFDGQANAIVINKAPPKEQ 507
           + +  +++     G     V        Q
Sbjct: 431 VNSGDQLVTTLAQGSLQVRVEEVIKDSAQ 459


>gi|290475587|ref|YP_003468475.1| exonuclease VII, large subunit [Xenorhabdus bovienii SS-2004]
 gi|289174908|emb|CBJ81709.1| exonuclease VII, large subunit [Xenorhabdus bovienii SS-2004]
          Length = 455

 Score =  367 bits (942), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 146/504 (28%), Positives = 234/504 (46%), Gaps = 57/504 (11%)

Query: 9   SLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAII 68
             +   +SVS L+  ++ ++E  +  + +  EIS +    SSGH YF+LKD  ++I A +
Sbjct: 4   PTNTGIFSVSRLNQTVRQLLELEMGRIWLSAEISNF-SQPSSGHWYFTLKDERAQIRAAM 62

Query: 69  WKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLL 128
           ++ +  +  F P+ G + LV  +IT +     YQ+I+ES+ P+G G L    E  K+KL 
Sbjct: 63  FRSSNLRATFRPQNGQQVLVRAQITLYEPRGDYQLIVESIQPAGDGLLQQQFEILKQKLT 122

Query: 129 EEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECP 187
            EGLF   HK P+P   K + VITS +GA + DIL  +  R P L +II+P  VQG E P
Sbjct: 123 SEGLFDSIHKKPLPSPAKRLGVITSASGAALHDILHILKRRDPSLPIIIYPTAVQGAEAP 182

Query: 188 KEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAI 247
            +I  AI   N  +E       D++I+ RGGGS+EDLW FNDE + RAI  S IPI+SAI
Sbjct: 183 LQIIRAIELANDRQE------CDVLIVGRGGGSLEDLWCFNDEQVARAIFQSRIPIVSAI 236

Query: 248 GHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTL 307
           GHETD T+AD+ ADLRAPTP+ AAE+    +  L   + +L+ RL   +      K+   
Sbjct: 237 GHETDVTIADFIADLRAPTPSAAAELVSRNQIELLRQVQSLQQRLEMAMDYFFAQKLRIF 296

Query: 308 NSLLKALPNSDQTLSCSRYRLD--RLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHN 365
           N+L   L      L  +R +     L ++L  +L   + + +     +  R+        
Sbjct: 297 NTLQHQLQQQRPDLRLARQQNKLVELRQKLVDSLLRCLKQHFLSHEKLNLRLLQTNPEQQ 356

Query: 366 IQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLIT 425
           I+   Q I +    ++Q                                           
Sbjct: 357 IRHYSQQIQQYDFRLKQ------------------------------------------- 373

Query: 426 RIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRI 485
                +  ++       +++   L + +   TL+RGY+  +  +   + + + +     +
Sbjct: 374 ----AIERQLGHYREKFAVSCSQLNAVSPLATLQRGYSISETADGTLLKETKQVKVGDTL 429

Query: 486 LINFFDGQANAIVINKAPPKEQPT 509
                DG   + VI    P ++  
Sbjct: 430 NTRLQDGWVKSQVIQVKRPTKREK 453


>gi|304398576|ref|ZP_07380448.1| exodeoxyribonuclease VII, large subunit [Pantoea sp. aB]
 gi|304353787|gb|EFM18162.1| exodeoxyribonuclease VII, large subunit [Pantoea sp. aB]
          Length = 457

 Score =  367 bits (942), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 143/505 (28%), Positives = 226/505 (44%), Gaps = 57/505 (11%)

Query: 12  HPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKG 71
              ++VS L+  ++ ++E  +  V +  EIS +    +SGH YF+LKD+ +++   +++ 
Sbjct: 7   ANIFTVSRLNTTVRQLLEKEMGLVWISAEISNFT-QPASGHWYFTLKDDGAQVRCAMFRN 65

Query: 72  TLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEG 131
           +  ++ F P+ G + LV   IT +     YQ+I ES+ P+G G L    E  K KL  EG
Sbjct: 66  SNRRVTFRPQHGQQVLVRANITLYEPRGDYQLIAESMHPAGEGLLQQQFELLKAKLATEG 125

Query: 132 LFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEI 190
           LF  QHK P+P   + + VITS TGA + D+L+ +  R P L V+I+P  VQG + P  I
Sbjct: 126 LFDPQHKQPLPEPARQVGVITSSTGAALHDVLRVLHRRDPSLPVVIYPTVVQGVDAPAAI 185

Query: 191 ANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHE 250
             AI   N   E       D++I+ RGGGS+EDLW FNDE + RAI  S IPI+SA+GHE
Sbjct: 186 VRAIEIANLRNE------CDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPIVSAVGHE 239

Query: 251 TDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSL 310
           TD T+AD+ ADLRAPTP+ AAE+    +  L   L + + RL   +   +  +      L
Sbjct: 240 TDVTIADFVADLRAPTPSAAAEIVSRNQLELLRQLQSQQQRLEMAMDYYLARQQRLYTRL 299

Query: 311 LKALPNSDQTLSCSRYRLD--RLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQK 368
              L      L  +R +    RL + L   +E  +    R  + +  R+ +      + +
Sbjct: 300 EHRLQQQHPQLRLARQQTALFRLQQRLGEAMETRLRHATRQQDRLSQRLNAQQPQQRLFE 359

Query: 369 NRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIE 428
            ++ +      ++Q + Q L                                        
Sbjct: 360 AQKQLQNWHYRLQQSITQQLNSNRQH---------------------------------- 385

Query: 429 FILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILIN 488
                               L+  +   TL RG++   DT    + +   L +   +   
Sbjct: 386 -------------FGQLVAQLEGVSPLATLARGFSVTTDTTGQVVKKTAQLQSGDLLRTR 432

Query: 489 FFDGQANAIVINKAPPKEQPTKKCQ 513
             DG   + V    P K++  K   
Sbjct: 433 LDDGWVESQVTQLLPEKKRRRKTAS 457


>gi|260773380|ref|ZP_05882296.1| exodeoxyribonuclease VII large subunit [Vibrio metschnikovii CIP
           69.14]
 gi|260612519|gb|EEX37722.1| exodeoxyribonuclease VII large subunit [Vibrio metschnikovii CIP
           69.14]
          Length = 440

 Score =  367 bits (942), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 141/492 (28%), Positives = 226/492 (45%), Gaps = 57/492 (11%)

Query: 10  LDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIW 69
            +   Y+VS L+  ++ ++E+ +  V + GEIS +     SGH Y +LKD+ +++   ++
Sbjct: 2   TNPNIYTVSRLNAEVRLLLENEMGIVWLIGEISNFSA-PVSGHWYLTLKDSRAQVKCAMF 60

Query: 70  KGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLE 129
           KG    + F P+ G + LV  +++ +     YQIIIES+ P G G L    E+ K +L  
Sbjct: 61  KGNNRSVSFKPQNGQQVLVKARLSLYEPRGDYQIIIESMQPEGDGRLQQEFEQLKMRLAA 120

Query: 130 EGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPK 188
           EGLF+   K  +P  P+ + VITS TGA + DILQ +  R P L +II+P  VQG E   
Sbjct: 121 EGLFAQSLKKTLPEHPRCVGVITSKTGAALHDILQVLKRRDPSLPIIIYPTIVQGSEAAI 180

Query: 189 EIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIG 248
            IA AI   N+  E       D++I+ RGGGS+EDLW FN E++ R IA S IPIISA+G
Sbjct: 181 SIAQAIGCANSRAE------CDVLIVGRGGGSLEDLWCFNHEIVARTIAASQIPIISAVG 234

Query: 249 HETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLN 308
           HE D T+AD+ AD+RAPTP+ AAE+      + + S+   + +L N I      + N L 
Sbjct: 235 HEVDVTIADFVADMRAPTPSAAAELVSRDNSNKKQSVNQKQHQLTNSIRYYFAQQKNQLQ 294

Query: 309 SLLKAL--PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNI 366
            L   L   +    L   R +LD L  +L   ++  +    +  +   +R++       +
Sbjct: 295 QLQHRLDKQHPAHRLQRQRQQLDELTLQLTQVMQRRLMLLAKGVSQQQHRLQLRSPEKQL 354

Query: 367 QKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITR 426
              +  ++  Q  + +                                            
Sbjct: 355 SAQKHQLMMSQHQLRKA------------------------------------------- 371

Query: 427 IEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRIL 486
               +  ++       +     L + +   TL RGY+  Q+ +   I  K  + +   I+
Sbjct: 372 ----MERQLLDAQHRYARLVDKLHTVSPLATLSRGYSITQNEHGEVIHTKDQVQSGEVIV 427

Query: 487 INFFDGQANAIV 498
                G   + V
Sbjct: 428 TRLAQGDIRSTV 439


>gi|212638786|ref|YP_002315306.1| exodeoxyribonuclease VII large subunit [Anoxybacillus flavithermus
           WK1]
 gi|212560266|gb|ACJ33321.1| Exonuclease VII large subunit [Anoxybacillus flavithermus WK1]
          Length = 449

 Score =  367 bits (942), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 166/492 (33%), Positives = 249/492 (50%), Gaps = 59/492 (11%)

Query: 16  SVSELSYHLKHIVE--SNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTL 73
           +V+ L+ ++K   E   +L  + ++GEIS +   HS GH YF+LKD  +RI A+++ G  
Sbjct: 8   TVAALTKYIKRKFEVDPHLQDLWIKGEISNFT-YHSRGHMYFTLKDEQARIQAVMFAGYN 66

Query: 74  NKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLF 133
            ++ F PE G+  LV G+I+ +  S  YQ+ ++ + P G G L  A E+ KKKL +EGLF
Sbjct: 67  RQLTFKPENGMTVLVRGEISVYEPSGTYQVYVKEMQPDGVGALYLAYEQLKKKLEQEGLF 126

Query: 134 SDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPL-RVIIFPVKVQGDECPKEIAN 192
           + +HK PIP  P+ I V+TSPTGA IRDIL  I  R+PL +VI+FP  VQG++ P  I  
Sbjct: 127 AKEHKKPIPKFPQHIGVVTSPTGAAIRDILTTIRRRYPLAKVILFPTLVQGEQAPLSIVQ 186

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           +I + N +         D++I+ RGGGSIE+LW FN+E++ RAI  S +PIISA+GHETD
Sbjct: 187 SIQKANDIGY------IDVLIVGRGGGSIEELWAFNEEIVARAIFASRVPIISAVGHETD 240

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ ADLRAPTPTGAAE+AVP    L S + + +ARL       +  +   L SL  
Sbjct: 241 YTIADFVADLRAPTPTGAAELAVPHVADLLSRVSDQQARLIRATKERLNAEQKRLQSLRS 300

Query: 313 A--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNR 370
           +       +       +LD L   L+  +  ++ +K      +   + +      I+K  
Sbjct: 301 SYAFRYPKRLYEQKEQQLDMLVDRLQRQMNDMLKQKEHKLQQLQLTLFAHHPQSRIEKAA 360

Query: 371 QHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFI 430
             I   QQ I + +   ++                                         
Sbjct: 361 DRIRTLQQTIVRNMNDVMK----------------------------------------- 379

Query: 431 LSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFF 490
                     S++ T   L + +    ++RGY+   D     I     L T  R+ I F 
Sbjct: 380 ------QKKWSLATTMAKLDALSPLKIMERGYSLAYDEQETLIKTVTQLQTGDRVHIRFQ 433

Query: 491 DGQANAIVINKA 502
           DG+A+ IV N  
Sbjct: 434 DGRAHCIVSNIE 445


>gi|120554649|ref|YP_959000.1| exodeoxyribonuclease VII large subunit [Marinobacter aquaeolei VT8]
 gi|120324498|gb|ABM18813.1| Exodeoxyribonuclease VII large subunit [Marinobacter aquaeolei VT8]
          Length = 451

 Score =  367 bits (942), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 152/506 (30%), Positives = 233/506 (46%), Gaps = 58/506 (11%)

Query: 2   NPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNH 61
            P+           +VSEL++  +H++ES+   V V GE+SG+    SSGH YFSLKD  
Sbjct: 3   TPYPDTRPRA---LTVSELNHQARHLLESSFMQVWVEGELSGF-SRPSSGHWYFSLKDQK 58

Query: 62  SRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALE 121
            +I   +++G   +I  LP EG +  + GK+T +     +QII+E L P+G G L  A E
Sbjct: 59  CQIRCAMFRGANQRIRTLPREGDQIRIRGKVTLYENRGDFQIIVEHLEPAGLGALQQAFE 118

Query: 122 KRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVK 180
             K +L  EGLF    K PIP  P+ I V+TSPTGA I DIL  +  R P + V ++P  
Sbjct: 119 ALKARLQGEGLFDPARKKPIPATPRHIGVVTSPTGAAIHDILTVLKRRCPAIPVTLYPTA 178

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQG     +I  AI +       +     D++I+ RGGGS+EDLW FN+E + RAIA   
Sbjct: 179 VQGQPATADIVQAIDR------AQQHGLADVLIIGRGGGSLEDLWCFNEEAVARAIAACP 232

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IP +SA+GHE D T+AD+ ADLRAPTP+ AAE   P ++     L   + RL     RL+
Sbjct: 233 IPTVSAVGHEVDVTIADFVADLRAPTPSAAAEKISPDQQDWLRRLTEQQGRLGQSARRLL 292

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           +   N L  L   L +  + L     R+D L   L   +   + ++ +  ++++ R+ + 
Sbjct: 293 QRLDNQLGHLSARLRDPRRELLEKAQRMDELELRLNKAIRDRLDQQKQKTDYLLQRMSAQ 352

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420
                ++  R+     ++ +    +  LR      +                        
Sbjct: 353 SPRRTLKTVREQTQRLEERLTLATRHQLRQKDERLQH----------------------- 389

Query: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480
                                     + L   +   TL RGY  ++D N+  + +  +L 
Sbjct: 390 ------------------------IAQTLHVVSPLVTLGRGYAIVKDDNDRIVRKAGDLE 425

Query: 481 TKTRILINFFDGQANAIVINKAPPKE 506
           T ++I      G  +A V       E
Sbjct: 426 TGSQITARLGHGSVSARVTEINSSSE 451


>gi|183599370|ref|ZP_02960863.1| hypothetical protein PROSTU_02839 [Providencia stuartii ATCC 25827]
 gi|188021608|gb|EDU59648.1| hypothetical protein PROSTU_02839 [Providencia stuartii ATCC 25827]
          Length = 459

 Score =  367 bits (942), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 140/512 (27%), Positives = 238/512 (46%), Gaps = 57/512 (11%)

Query: 7   KNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDA 66
               +   YSVS+L+  ++ +++  +  + +  EIS +    SSGH Y +LKD+ +++ A
Sbjct: 2   STQQNSGIYSVSKLNQAVRELLDRQMGKIWLTAEISNF-SQPSSGHWYLTLKDDKAQVRA 60

Query: 67  IIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKK 126
            +++G   ++ F P+ G + LV   +T +     YQIIIES+ P+G G L    E  K+ 
Sbjct: 61  AMFRGQNARVTFRPQNGQQVLVRASVTLYEPRGDYQIIIESMQPAGEGLLQQRFELLKQM 120

Query: 127 LLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDE 185
           L  EGLF   HK P+P   K I VITS TGA + DIL  +  R P L V+I+P  VQGD+
Sbjct: 121 LGAEGLFDVTHKQPLPSPAKRIGVITSATGAALHDILHILRRRDPSLPVVIYPTAVQGDQ 180

Query: 186 CPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIIS 245
            P +IA AI   N   E       D++I+ RGGGS+EDLW FN+E++ RAI  S +PI+S
Sbjct: 181 APAQIARAIELANKRGE------CDVLIVGRGGGSLEDLWAFNEEIVARAIFASRLPIVS 234

Query: 246 AIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKIN 305
           A+GHETD T+AD+ AD+RAPTP+ AAE+    +  L   L + + RL   +   +  +  
Sbjct: 235 AVGHETDITIADFVADVRAPTPSAAAELVSRNQVELIRQLHSAQQRLEMAMDYYLAGQQQ 294

Query: 306 TLNSLLKALPNSDQTLSCSRYRLD--RLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLI 363
             + L   L      L  +R +     L ++L   +   +       + +  R+    L 
Sbjct: 295 RFSRLQHRLQQQHPQLRLARQQHQLSLLNQKLTQTITRRLQTAQLRHDQLQRRLSQQDLR 354

Query: 364 HNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKL 423
             +Q+  + + + Q H++ +                                        
Sbjct: 355 PQLQRQHRSLQQTQYHLQNM---------------------------------------- 374

Query: 424 ITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKT 483
                  ++  + S     ++    +++ +   TL RG++  + ++   + +   +    
Sbjct: 375 -------MTELLNSYKQRFAVACSKMETVSPLATLARGFSISETSDGAVLKKTSQVKLGQ 427

Query: 484 RILINFFDGQANAIVINKAPPKEQPTKKCQLH 515
           ++     DG   + V +    K +   +  L 
Sbjct: 428 KLKTRLNDGWVESEVTDITKMKMKRAPRSVLK 459


>gi|319898458|ref|YP_004158551.1| exodeoxyribonuclease VII large subunit [Bartonella clarridgeiae 73]
 gi|319402422|emb|CBI75963.1| exodeoxyribonuclease VII large subunit [Bartonella clarridgeiae 73]
          Length = 475

 Score =  367 bits (942), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 212/530 (40%), Positives = 306/530 (57%), Gaps = 56/530 (10%)

Query: 1   MNPFSQKNS-LDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKD 59
           M+ F +K+   +  E+SVSE++  LK +VE    +V VRGEISGYRG+H+SGHAYF+LKD
Sbjct: 1   MDLFIEKSVVTNVAEFSVSEIAGALKRVVEEKFGYVRVRGEISGYRGVHASGHAYFALKD 60

Query: 60  NHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTA 119
           + +R++A+IW+G + K++F PEEGIE + +GK+TT+ GSSKYQIIIE+L P+G G L+T 
Sbjct: 61  DKARLEAVIWRGVIEKLQFPPEEGIEVVAVGKLTTYQGSSKYQIIIETLEPTGVGALMTL 120

Query: 120 LEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPV 179
           LE RKKKL +EG F D  K  +P++P+II VITSPTGAVIRDI+ RIS RFPL ++++PV
Sbjct: 121 LENRKKKLADEGFFDDAKKKTLPYMPRIIGVITSPTGAVIRDIIHRISDRFPLHILVWPV 180

Query: 180 KVQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANS 239
           +VQG+   +E+A AI   N L       +PD+II+ARGGGS+EDLW FNDE +V A++ S
Sbjct: 181 RVQGETSGREVAAAITGFNALPLDGVLSKPDLIIVARGGGSLEDLWGFNDEAVVHAVSAS 240

Query: 240 SIPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRL 299
           +IPIISA+GHETDWTL DY AD RAPTPTGAAE AVPVK  L++ L +L  R    + R 
Sbjct: 241 AIPIISAVGHETDWTLIDYVADWRAPTPTGAAERAVPVKFDLETRLASLSLRFRVGLARY 300

Query: 300 IKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKS 359
             +    L+S+++ LP  DQ  +  R   D +   L+  L +   +K  +F  ++ R+  
Sbjct: 301 FSFYKQKLSSVVRGLPTVDQLFALPRRSFDEISSRLQRALCVNYDKKRFYFYTLVIRLCP 360

Query: 360 DFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTH 419
             L  NI+  +Q+  E    +                                       
Sbjct: 361 RLL--NIETAQQNTKEYTVRLH-------------------------------------- 380

Query: 420 IKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNL 479
                          ++     + +  R+L++ +Y++ L+RG+       N  I +    
Sbjct: 381 ---------HAFLRSVEKQRVQIEMAFRLLKNTSYQSILERGFVLALGQENKPIKRLVQF 431

Query: 480 ATKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
               +I + FFDG+ N    N AP      K+       ++++  QG LF
Sbjct: 432 PRAVKISLRFFDGEINVSTCNSAP------KQFPKPRRLKQQRDDQGTLF 475


>gi|294501202|ref|YP_003564902.1| exodeoxyribonuclease VII, large subunit [Bacillus megaterium QM
           B1551]
 gi|294351139|gb|ADE71468.1| exodeoxyribonuclease VII, large subunit [Bacillus megaterium QM
           B1551]
          Length = 447

 Score =  367 bits (942), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 146/492 (29%), Positives = 231/492 (46%), Gaps = 58/492 (11%)

Query: 15  YSVSELSYHLKHI--VESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
            +V+ L+ ++K    V+ ++  V ++GEIS ++  HS GH YF+LKD ++RI A+++ G 
Sbjct: 8   LTVTALTRYIKRKFDVDPHMQDVWIKGEISNFK-RHSRGHMYFTLKDQNARIAAVMFAGH 66

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
             ++ F PEEG+  L+  +I+ +  S  YQ+ ++ + P G G L  A E+ KKKL +EGL
Sbjct: 67  NRQLNFQPEEGMNVLIRAEISVYEPSGNYQMYVKEMQPDGVGNLYLAYEQLKKKLEKEGL 126

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIAN 192
           F    K  +P  P  I VITSPTGA +RDI+  +  R+   +I+ P  VQG      I  
Sbjct: 127 FDPARKRKLPKYPTTIGVITSPTGAAVRDIITTLKRRYNANIIVMPALVQGVNAAPSIIK 186

Query: 193 AILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETD 252
           AI + N  KE       D++I+ RGGGSIE+LW FN+E + RAI  S+IP+ISA+GHETD
Sbjct: 187 AIEEANRRKEA------DVLIVGRGGGSIEELWAFNEESVARAIFTSNIPVISAVGHETD 240

Query: 253 WTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLK 312
           +T+AD+ ADLRAPTPTGAAE+AVP    +   L     RL   +  +++     L    K
Sbjct: 241 FTIADFVADLRAPTPTGAAELAVPHISEITERLTQRNIRLLRSMKEMLQSSSRRLERSQK 300

Query: 313 A--LPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNR 370
           +       + +     +LD+L           I  K  ++  +   +  +   H + K  
Sbjct: 301 SYAFRYPQKLVEQKEQQLDQLMERFYREGRRYIEHKRTNYEQLTAALLRNHPEHQLTKAA 360

Query: 371 QHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFI 430
           +   +                                               L   +   
Sbjct: 361 ERQQQ-----------------------------------------------LTKMLTKE 373

Query: 431 LSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINFF 490
           +   +K      +  T  L + +   T++RGY+ + D     I   + ++    + +   
Sbjct: 374 MQQLLKQKQLLFATATSKLHTLSPLKTMERGYSLVYDKEKELIKSTKQVSKGDVVNVRLT 433

Query: 491 DGQANAIVINKA 502
           DGQ    V    
Sbjct: 434 DGQLQCEVSKIE 445


>gi|332185492|ref|ZP_08387240.1| exodeoxyribonuclease VII, large subunit [Sphingomonas sp. S17]
 gi|332014470|gb|EGI56527.1| exodeoxyribonuclease VII, large subunit [Sphingomonas sp. S17]
          Length = 473

 Score =  367 bits (941), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 177/518 (34%), Positives = 255/518 (49%), Gaps = 75/518 (14%)

Query: 15  YSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLN 74
            SV ELS  LK +VE    HV +RGEISGY+   +SGH Y SLKD ++ IDA++WKG  N
Sbjct: 26  LSVGELSLKLKRMVEGEFGHVRLRGEISGYK-RATSGHVYMSLKDENAVIDAVMWKGAAN 84

Query: 75  KIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFS 134
            + F P++GIE +  G++TTFPG SKYQI++E +  +G+G L+   EK K KL  EGLF 
Sbjct: 85  TLPFQPQDGIEVIATGRLTTFPGRSKYQIVVERMELAGAGALMALFEKLKAKLAGEGLFD 144

Query: 135 DQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVKVQGDECPKEIANAI 194
              K  +PF+P +I V+TSPTGAVIRDIL R+  R P  VI++PVKVQG    +E+A A+
Sbjct: 145 RDRKRALPFMPPVIGVVTSPTGAVIRDILHRLEDRCPTHVIVWPVKVQGAGSAEEVAAAV 204

Query: 195 LQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWT 254
              + ++ G   PRPD++I+ARGGGSIEDLW FN+E++VRA+A+ +IPIISA+GHETD T
Sbjct: 205 RGFDAIQPGGPVPRPDLVIVARGGGSIEDLWSFNEEIVVRAVADCAIPIISAVGHETDTT 264

Query: 255 LADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLLKAL 314
           L DYAADLRAPTPT AAE+AVPV                                    L
Sbjct: 265 LCDYAADLRAPTPTAAAEIAVPV------------------------------------L 288

Query: 315 PNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQHIL 374
            +   T++  R R +R            + R       +   +        +   RQ   
Sbjct: 289 ADLRLTVASHRQRTERCA-------RRYVERGRERLEAMARLLPKRD--QLLGPQRQRAD 339

Query: 375 EKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEFIL-SH 433
           E    +++ +                         + R+      + +    +   +   
Sbjct: 340 EAGARLDRGL-------------------------ERRVTLARGGLDRAGAALRPAILER 374

Query: 434 KIKSCHTSVSITTRILQSFAYKNTLKRGYT-SIQDTNNNFITQKRNLATKTRILINFFDG 492
           +++     ++ T R++QS      L+RGY           ++          + + F DG
Sbjct: 375 QVERGRDRLASTWRLVQSLNPDRILERGYARITARPGGETLSSAEAARAADTLTLRFRDG 434

Query: 493 QANAIVINKAPPKEQPTK--KCQLHNNKREKQGTQGEL 528
             +  V      +  P    K +        Q +Q  L
Sbjct: 435 TVDVAVDQGGLERPAPKTYDKPKREPKADPSQPSQPTL 472


>gi|15832625|ref|NP_311398.1| exodeoxyribonuclease VII large subunit [Escherichia coli O157:H7
           str. Sakai]
 gi|168748432|ref|ZP_02773454.1| exodeoxyribonuclease VII, large subunit [Escherichia coli O157:H7
           str. EC4113]
 gi|168756281|ref|ZP_02781288.1| exodeoxyribonuclease VII, large subunit [Escherichia coli O157:H7
           str. EC4401]
 gi|168761120|ref|ZP_02786127.1| exodeoxyribonuclease VII, large subunit [Escherichia coli O157:H7
           str. EC4501]
 gi|168768601|ref|ZP_02793608.1| exodeoxyribonuclease VII, large subunit [Escherichia coli O157:H7
           str. EC4486]
 gi|168773577|ref|ZP_02798584.1| exodeoxyribonuclease VII, large subunit [Escherichia coli O157:H7
           str. EC4196]
 gi|168778475|ref|ZP_02803482.1| exodeoxyribonuclease VII, large subunit [Escherichia coli O157:H7
           str. EC4076]
 gi|168787855|ref|ZP_02812862.1| exodeoxyribonuclease VII, large subunit [Escherichia coli O157:H7
           str. EC869]
 gi|168798880|ref|ZP_02823887.1| exodeoxyribonuclease VII, large subunit [Escherichia coli O157:H7
           str. EC508]
 gi|195936651|ref|ZP_03082033.1| exodeoxyribonuclease VII large subunit [Escherichia coli O157:H7
           str. EC4024]
 gi|208809494|ref|ZP_03251831.1| exodeoxyribonuclease VII, large subunit [Escherichia coli O157:H7
           str. EC4206]
 gi|208812852|ref|ZP_03254181.1| exodeoxyribonuclease VII, large subunit [Escherichia coli O157:H7
           str. EC4045]
 gi|208821962|ref|ZP_03262282.1| exodeoxyribonuclease VII, large subunit [Escherichia coli O157:H7
           str. EC4042]
 gi|209400584|ref|YP_002271979.1| exodeoxyribonuclease VII, large subunit [Escherichia coli O157:H7
           str. EC4115]
 gi|254794455|ref|YP_003079292.1| exodeoxyribonuclease VII large subunit [Escherichia coli O157:H7
           str. TW14359]
 gi|261223059|ref|ZP_05937340.1| exodeoxyribonuclease VII large subunit [Escherichia coli O157:H7
           str. FRIK2000]
 gi|261259390|ref|ZP_05951923.1| exodeoxyribonuclease VII large subunit [Escherichia coli O157:H7
           str. FRIK966]
 gi|291283730|ref|YP_003500548.1| Exodeoxyribonuclease 7 large subunit [Escherichia coli O55:H7 str.
           CB9615]
 gi|22095662|sp|Q8XAB0|EX7L_ECO57 RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|226694648|sp|B5Z0X8|EX7L_ECO5E RecName: Full=Exodeoxyribonuclease 7 large subunit; AltName:
           Full=Exodeoxyribonuclease VII large subunit;
           Short=Exonuclease VII large subunit
 gi|13362841|dbj|BAB36794.1| exonuclease VII large subunit [Escherichia coli O157:H7 str. Sakai]
 gi|187770677|gb|EDU34521.1| exodeoxyribonuclease VII, large subunit [Escherichia coli O157:H7
           str. EC4196]
 gi|188017041|gb|EDU55163.1| exodeoxyribonuclease VII, large subunit [Escherichia coli O157:H7
           str. EC4113]
 gi|189003418|gb|EDU72404.1| exodeoxyribonuclease VII, large subunit [Escherichia coli O157:H7
           str. EC4076]
 gi|189356589|gb|EDU75008.1| exodeoxyribonuclease VII, large subunit [Escherichia coli O157:H7
           str. EC4401]
 gi|189362272|gb|EDU80691.1| exodeoxyribonuclease VII, large subunit [Escherichia coli O157:H7
           str. EC4486]
 gi|189368359|gb|EDU86775.1| exodeoxyribonuclease VII, large subunit [Escherichia coli O157:H7
           str. EC4501]
 gi|189372263|gb|EDU90679.1| exodeoxyribonuclease VII, large subunit [Escherichia coli O157:H7
           str. EC869]
 gi|189378658|gb|EDU97074.1| exodeoxyribonuclease VII, large subunit [Escherichia coli O157:H7
           str. EC508]
 gi|208729295|gb|EDZ78896.1| exodeoxyribonuclease VII, large subunit [Escherichia coli O157:H7
           str. EC4206]
 gi|208734129|gb|EDZ82816.1| exodeoxyribonuclease VII, large subunit [Escherichia coli O157:H7
           str. EC4045]
 gi|208742085|gb|EDZ89767.1| exodeoxyribonuclease VII, large subunit [Escherichia coli O157:H7
           str. EC4042]
 gi|209161984|gb|ACI39417.1| exodeoxyribonuclease VII, large subunit [Escherichia coli O157:H7
           str. EC4115]
 gi|209763428|gb|ACI80026.1| exonuclease VII large subunit [Escherichia coli]
 gi|209763430|gb|ACI80027.1| exonuclease VII large subunit [Escherichia coli]
 gi|209763432|gb|ACI80028.1| exonuclease VII large subunit [Escherichia coli]
 gi|209763434|gb|ACI80029.1| exonuclease VII large subunit [Escherichia coli]
 gi|209763436|gb|ACI80030.1| exonuclease VII large subunit [Escherichia coli]
 gi|254593855|gb|ACT73216.1| exonuclease VII, large subunit [Escherichia coli O157:H7 str.
           TW14359]
 gi|290763603|gb|ADD57564.1| Exodeoxyribonuclease 7 large subunit [Escherichia coli O55:H7 str.
           CB9615]
 gi|320188842|gb|EFW63501.1| Exodeoxyribonuclease VII large subunit [Escherichia coli O157:H7
           str. EC1212]
 gi|320640853|gb|EFX10341.1| exodeoxyribonuclease VII large subunit [Escherichia coli O157:H7
           str. G5101]
 gi|