RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddB 
           21,608 sequences; 5,994,473 total letters

Searching..................................................done

Query= gi|254780791|ref|YP_003065204.1| exodeoxyribonuclease VII large
subunit [Candidatus Liberibacter asiaticus str. psy62]
         (529 letters)



>gnl|CDD|178962 PRK00286, xseA, exodeoxyribonuclease VII large subunit; Reviewed.
          Length = 438

 Score =  479 bits (1236), Expect = e-136
 Identities = 179/490 (36%), Positives = 268/490 (54%), Gaps = 58/490 (11%)

Query: 13  PEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGT 72
              SVSEL+ ++K ++E +L  V VRGEIS +   HSSGH YF+LKD  ++I  +++KG+
Sbjct: 4   KILSVSELNRYVKSLLERDLGQVWVRGEISNFT-RHSSGHWYFTLKDEIAQIRCVMFKGS 62

Query: 73  LNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
             +++F PEEG++ LV GK++ +     YQ+I+E + P+G G L  A E+ K+KL  EGL
Sbjct: 63  ARRLKFKPEEGMKVLVRGKVSLYEPRGDYQLIVEEIEPAGIGALAAAFEQLKEKLAAEGL 122

Query: 133 FSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIA 191
           F  + K P+PF PK I VITSPTGA IRDIL  +  RFP + VII+P  VQG+     I 
Sbjct: 123 FDPERKKPLPFFPKRIGVITSPTGAAIRDILTVLRRRFPLVEVIIYPTLVQGEGAAASIV 182

Query: 192 NAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHET 251
            AI + N   E       D++I+ARGGGS+EDLW FNDE + RAIA S IP+ISA+GHET
Sbjct: 183 AAIERANARGE-------DVLIVARGGGSLEDLWAFNDEAVARAIAASRIPVISAVGHET 235

Query: 252 DWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLIKYKINTLNSLL 311
           D+T+AD+ ADLRAPTPT AAE+AVP +  L   L  L+ RL   + R ++ K   L+ L 
Sbjct: 236 DFTIADFVADLRAPTPTAAAELAVPDRAELLQRLQQLQQRLARAMRRRLEQKRQRLDQLA 295

Query: 312 KALPNSD--QTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKN 369
           + L      + L+  + RLDRL + L+  LE  +    +    +  R++       I++ 
Sbjct: 296 RRLKFQSPERLLAQQQQRLDRLQQRLQRALERRLRLAKQRLERLSQRLQQQNPQRRIERA 355

Query: 370 RQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHIKKLITRIEF 429
           +Q + + +Q + + +++ L+     K++++  L                           
Sbjct: 356 QQRLEQLEQRLRRAMRRQLKR----KRQRLEALA-------------------------- 385

Query: 430 ILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLATKTRILINF 489
                            + L++ +   TL RGY  ++D +   I   + L    R+ I  
Sbjct: 386 -----------------QQLEALSPLATLARGYAIVRDEDGKVIRSAKQLKPGDRLTIRL 428

Query: 490 FDGQANAIVI 499
            DG+  A V 
Sbjct: 429 ADGEVEAEVT 438


>gnl|CDD|161783 TIGR00237, xseA, exodeoxyribonuclease VII, large subunit.  This
           family consist of exodeoxyribonuclease VII, large
           subunit XseA which catalyses exonucleolytic cleavage in
           either the 5'->3' or 3'->5' direction to yield
           5'-phosphomononucleotides. Exonuclease VII consists of
           one large subunit and four small subunits.
          Length = 432

 Score =  275 bits (706), Expect = 1e-74
 Identities = 140/376 (37%), Positives = 216/376 (57%), Gaps = 21/376 (5%)

Query: 16  SVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHSRIDAIIWKGTLNK 75
           SVSEL+  +K ++E+    V ++GEIS +     SGH YF+LKD ++++  ++++G  N+
Sbjct: 1   SVSELNAQIKALLEATFLQVWIQGEISNFT-QPVSGHWYFTLKDENAQVRCVMFRGNNNR 59

Query: 76  IEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGLFSD 135
           ++F P+ G + LV G I+ +     YQII   + P+G G L  A E+ K+KL  EGLF  
Sbjct: 60  LKFRPQNGQQVLVRGGISVYEPRGDYQIICFEMQPAGEGLLQLAYEQLKEKLAAEGLFDQ 119

Query: 136 QHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFP-LRVIIFPVKVQGDECPKEIANAI 194
           ++K P+P  PK + VITS TGA + DIL  +  R P L+V+I+P  VQG+   + I  +I
Sbjct: 120 EYKKPLPHFPKRVGVITSQTGAALADILHILKRRDPSLKVVIYPTLVQGEGAVQSIVESI 179

Query: 195 LQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSSIPIISAIGHETDWT 254
              NT  E   C   D++I+ RGGGS+EDLW FNDE + RAI  S IPIISA+GHETD+T
Sbjct: 180 ELANTKNE---C---DVLIVGRGGGSLEDLWSFNDEKVARAIFLSKIPIISAVGHETDFT 233

Query: 255 LADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI---KYKINTLNSLL 311
           ++D+ ADLRAPTP+ AAE+  P ++ L   L     RL+     L+   K ++  L + L
Sbjct: 234 ISDFVADLRAPTPSAAAEIVSPNQDELLQRLDGFNVRLHRAFDTLLHQKKARLEQLVASL 293

Query: 312 KALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSDFLIHNIQKNRQ 371
           +     ++ L+  + + ++L +  +  L   + R  +    +  R+         Q N  
Sbjct: 294 QRQHPQNK-LALQQLQFEKLEKRKQAALNKQLERTRQKKTRLTKRLT--------QTNPS 344

Query: 372 -HILEKQQHIEQIVKQ 386
             IL  Q   EQ+ ++
Sbjct: 345 PQILRAQTRTEQLNRR 360


>gnl|CDD|169129 PRK07854, PRK07854, enoyl-CoA hydratase; Provisional.
          Length = 243

 Score = 32.3 bits (74), Expect = 0.30
 Identities = 19/69 (27%), Positives = 28/69 (40%), Gaps = 11/69 (15%)

Query: 217 GGGSIEDLWHFNDEMIVRAIANSSIPIIS-----AIGHETDWTLADYAADLRAPTPTGAA 271
           G    +D      EM+  AI  + +P+I+     AIG      +   A DLR   P   A
Sbjct: 64  GDVYADDFPDALIEML-HAIDAAPVPVIAAINGPAIGAGLQLAM---ACDLRVVAPE--A 117

Query: 272 EMAVPVKEH 280
               PV ++
Sbjct: 118 YFQFPVAKY 126


>gnl|CDD|161976 TIGR00644, recJ, single-stranded-DNA-specific exonuclease RecJ.
           All proteins in this family are 5'-3' single-strand DNA
           exonucleases. These proteins are used in some aspects of
           mismatch repair, recombination, and recombinational
           repair.
          Length = 539

 Score = 32.2 bits (74), Expect = 0.33
 Identities = 14/59 (23%), Positives = 23/59 (38%)

Query: 50  SGHAYFSLKDNHSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESL 108
             H   SLK     I+AI +     ++E      ++      I  + G    Q+II+ L
Sbjct: 481 ENHLKLSLKSGGKNIEAIAFNAGDLELELNLGRPLDVAGKLSINEWRGRETPQLIIQDL 539


>gnl|CDD|162836 TIGR02393, RpoD_Cterm, RNA polymerase sigma factor RpoD, C-terminal
           domain.  This model represents the well-conserved
           C-terminal region of the major, essential sigma factor
           of most bacteria. Members of this clade show
           considerable variability in domain architecture and
           molecular weight, as well as in nomenclature: RpoD in E.
           coli and other Proteobacteria, SigA in Bacillus subtilis
           and many other Gram-positive bacteria, HrdB in
           Streptomyces, MysA in Mycobacterium smegmatis, etc.
          Length = 238

 Score = 31.9 bits (73), Expect = 0.40
 Identities = 30/120 (25%), Positives = 44/120 (36%), Gaps = 16/120 (13%)

Query: 233 VRAIANSSIPIIS---AIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLE 289
           VR I   +   IS    IG E D  L D+  D    +P   A   + ++E L   L  L 
Sbjct: 120 VREIKKIAQEPISLETPIGEEEDSFLGDFIEDTSIESPDDYAAKEL-LREQLDEVLETLT 178

Query: 290 ARLNNIIIRLIKYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRH 349
            R   ++   ++Y +         L     TL       + + RE    +E    RK RH
Sbjct: 179 ERERKVLR--MRYGL---------LDGRPHTLEEVGKEFN-VTRERIRQIESKALRKLRH 226


>gnl|CDD|185619 PTZ00440, PTZ00440, reticulocyte binding protein 2-like protein;
           Provisional.
          Length = 2722

 Score = 31.7 bits (72), Expect = 0.44
 Identities = 17/79 (21%), Positives = 26/79 (32%)

Query: 409 TKNRIFYLHTHIKKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDT 468
           T   I ++   I  +I R  F L    K       I    +     K+ LK+ Y      
Sbjct: 293 TIYSINFIQEEIGDIIKRYNFHLKKIEKGKEYIKRIQNNNIPPQVKKDELKKKYFESAKH 352

Query: 469 NNNFITQKRNLATKTRILI 487
             +F      L+    +LI
Sbjct: 353 YASFKFSLEMLSMLDSLLI 371



 Score = 28.6 bits (64), Expect = 4.0
 Identities = 40/148 (27%), Positives = 70/148 (47%), Gaps = 18/148 (12%)

Query: 302 YKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEII--IFRKYRHFNHIINRIKS 359
                L  LL+  P  D+ L+     L  L +E   N +I+  I +   + N  IN IK+
Sbjct: 830 KNDEELKQLLQKFPTEDENLN-----LKELEKEFNENNQIVDNIIKDIENMNKNINIIKT 884

Query: 360 -DFLIHNIQKNRQ---HILEKQQHIEQIVKQHLRYI----FLEKKEKIAILHMLREQTKN 411
            +  I+    N+Q   H+L  +  ++  ++QH++ I     ++K EK+ +L+ L ++ K 
Sbjct: 885 LNIAINRSNSNKQLVEHLLNNKIDLKNKLEQHMKIINTDNIIQKNEKLNLLNNLNKE-KE 943

Query: 412 RIF--YLHTHIKKLITRIEFILSHKIKS 437
           +I      T I  L  +IE  L +  KS
Sbjct: 944 KIEKQLSDTKINNLKMQIEKTLEYYDKS 971


>gnl|CDD|177736 PLN00124, PLN00124, succinyl-CoA ligase [GDP-forming] subunit beta;
           Provisional.
          Length = 422

 Score = 31.6 bits (72), Expect = 0.47
 Identities = 12/26 (46%), Positives = 16/26 (61%)

Query: 209 PDIIILARGGGSIEDLWHFNDEMIVR 234
           P II  ++GG SIEDL     E I++
Sbjct: 156 PLIIACSKGGTSIEDLAEKFPEKIIK 181


>gnl|CDD|163265 TIGR03439, methyl_EasF, probable methyltransferase domain, EasF
           family.  This model represents an uncharacterized domain
           of about 300 amino acids with homology to
           S-adenosylmethionine-dependent methyltransferases.
           Proteins with this domain are exclusively fungal. A few,
           such as EasF from Neotyphodium lolii, are associated
           with the biosynthesis of ergot alkaloids, a class of
           fungal secondary metabolites. EasF may, in fact, be the
           AdoMet:dimethylallyltryptophan N-methyltransferase, the
           enzyme that follows tryptophan dimethylallyltransferase
           (DMATS) in ergot alkaloid biosynthesis. Several other
           members of this family, including mug158 (meiotically
           up-regulated gene 158 protein) from Schizosaccharomyces
           pombe, contain an additional uncharacterized domain
           DUF323 (pfam03781).
          Length = 319

 Score = 30.3 bits (69), Expect = 1.2
 Identities = 25/86 (29%), Positives = 33/86 (38%), Gaps = 12/86 (13%)

Query: 8   NSLDHPEY-----SVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDNHS 62
                 +Y     S SEL   L  +   N SHV      +G  G +  G A+    +N S
Sbjct: 100 RQKKSVDYYALDVSRSELQRTLAELPLGNFSHV----RCAGLLGTYDDGLAWLKRPENRS 155

Query: 63  RIDAIIWKGTLNKI-EFLPEEGIEFL 87
           R   I+W G  + I  F   E   FL
Sbjct: 156 RPTTILWLG--SSIGNFSRPEAAAFL 179


>gnl|CDD|182330 PRK10246, PRK10246, exonuclease subunit SbcC; Provisional.
          Length = 1047

 Score = 30.2 bits (68), Expect = 1.2
 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 4/40 (10%)

Query: 93  TTFPGSSKYQIIIESLIPSGSGTLLTALEKRKKKLLEEGL 132
           T+ P    YQ    +L P  + + L ALEK  KKL EEG 
Sbjct: 512 TSHPAVEAYQ----ALEPGVNQSRLDALEKEVKKLGEEGA 547


>gnl|CDD|182931 PRK11055, galM, galactose-1-epimerase; Provisional.
          Length = 342

 Score = 30.3 bits (69), Expect = 1.3
 Identities = 14/35 (40%), Positives = 17/35 (48%), Gaps = 2/35 (5%)

Query: 52  HAYFSLKDNHSRIDAIIWKGTLNKIEFLP--EEGI 84
           HAYF+L       D    K  +N  E+LP  E GI
Sbjct: 169 HAYFNLDGAEEGSDVRNHKLQINADEYLPVDEGGI 203


>gnl|CDD|180565 PRK06450, PRK06450, threonine synthase; Validated.
          Length = 338

 Score = 30.1 bits (68), Expect = 1.6
 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 11/57 (19%)

Query: 109 IPSGSGTLLTALEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVIT---SPTGAVIRDI 162
           IP  +GTLL  +    K LL+ G+ S+        +PKI+AV T   SP  A  + I
Sbjct: 201 IPVSAGTLLLGVYSGFKHLLDSGVISE--------MPKIVAVQTEQVSPLCAKFKGI 249


>gnl|CDD|169383 PRK08329, PRK08329, threonine synthase; Validated.
          Length = 347

 Score = 29.4 bits (66), Expect = 2.4
 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 8/43 (18%)

Query: 108 LIPSGSGTLLTALEKRKKKLLEEGLFSDQHKNPIPFIPKIIAV 150
            +P GSGTL   + K  K+L E G  S         +PK++AV
Sbjct: 209 FVPVGSGTLFLGIWKGFKELHEMGEISK--------MPKLVAV 243


>gnl|CDD|184703 PRK14485, PRK14485, putative bifunctional cbb3-type cytochrome c
           oxidase subunit I/II; Provisional.
          Length = 712

 Score = 29.3 bits (66), Expect = 2.5
 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 3/33 (9%)

Query: 209 PDIIILARGGGSIEDLWHFNDEMIVRAIANSSI 241
           PD   LAR GG   D WH+N     ++ +  SI
Sbjct: 591 PD---LAREGGKYPDSWHYNHMEDPQSTSPGSI 620



 Score = 27.4 bits (61), Expect = 8.8
 Identities = 8/17 (47%), Positives = 12/17 (70%)

Query: 240 SIPIISAIGHETDWTLA 256
           S+  ++AI H TDW +A
Sbjct: 327 SLKNVNAIAHYTDWIIA 343


>gnl|CDD|180179 PRK05638, PRK05638, threonine synthase; Validated.
          Length = 442

 Score = 29.4 bits (66), Expect = 2.6
 Identities = 21/56 (37%), Positives = 32/56 (57%), Gaps = 8/56 (14%)

Query: 108 LIPSGSGTLLTALEKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDIL 163
           ++P+GSG+ L ++ K  K+LLE G+        I  IPK+IAV T     +  +IL
Sbjct: 216 IVPTGSGSYLYSIYKGFKELLEIGV--------IEEIPKLIAVQTERCNPIASEIL 263


>gnl|CDD|151320 pfam10871, DUF2748, Protein of unknown function (DUF2748).  This is
           a bacterial family of proteins with unknown function.
          Length = 452

 Score = 28.4 bits (63), Expect = 4.3
 Identities = 20/75 (26%), Positives = 39/75 (52%), Gaps = 6/75 (8%)

Query: 343 IFRKYRHFNHIINRIKSDFLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAIL 402
           I++K    + +I++IK   +  N++K     + K   +E+ + + L  IF++    I I 
Sbjct: 81  IYKKIAEDDKVIHKIKQ--IFDNLKKK----IAKLLAVEKDLLEKLARIFVQSAHPIVIH 134

Query: 403 HMLREQTKNRIFYLH 417
            +L E+T+  I Y H
Sbjct: 135 WLLLEKTEVFISYSH 149


>gnl|CDD|162957 TIGR02636, galM_Leloir, galactose mutarotase.  Members of this
           protein family act as galactose mutarotase (D-galactose
           1-epimerase) and participate in the Leloir pathway for
           galactose/glucose interconversion. All members of the
           seed alignment for this model are found in gene clusters
           with other enzymes of the Leloir pathway. This enzyme
           family belongs to the aldose 1-epimerase family,
           described by pfam model pfam01263. However, the enzyme
           described as aldose 1-epimerase itself (EC 5.1.3.3) is
           called broadly specific for D-glucose, L-arabinose,
           D-xylose, D-galactose, maltose and lactose. The
           restricted genome context for genes in this family
           suggests members should act primarily on D-galactose.
          Length = 335

 Score = 28.5 bits (64), Expect = 4.4
 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 2/37 (5%)

Query: 50  SGHAYFSLKDNHSRIDAIIWKGTLNKIEFLP--EEGI 84
           + H YF+L    +  D +  +  LN   +LP  EEGI
Sbjct: 162 TNHVYFNLDGADAGSDVLSHELQLNADRYLPLDEEGI 198


>gnl|CDD|180929 PRK07324, PRK07324, transaminase; Validated.
          Length = 373

 Score = 28.4 bits (64), Expect = 5.0
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 4/53 (7%)

Query: 338 NLEII-IFRKYRHFNHIINRIKSDFLIHNIQKNRQHILEKQQHIEQIVKQHLR 389
           N E+I I RKYR +  I   +  D L     ++R  ILE+ +   +IV+ +L 
Sbjct: 237 NEEVIDILRKYRDYTMICAGVFDDMLASLALEHRDAILERNR---KIVRTNLA 286


>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional.
          Length = 754

 Score = 28.1 bits (62), Expect = 5.3
 Identities = 18/73 (24%), Positives = 33/73 (45%), Gaps = 9/73 (12%)

Query: 279 EHLQSSLINLEARLNNII---------IRLIKYKINTLNSLLKALPNSDQTLSCSRYRLD 329
           E+LQ ++  L A  N +          I+ ++  IN +  L + LP++ Q+L     ++ 
Sbjct: 216 ENLQGNIKTLYANSNQLTSIPATLPDTIQEMELSINRITELPERLPSALQSLDLFHNKIS 275

Query: 330 RLPRELEHNLEII 342
            LP  L   L  +
Sbjct: 276 CLPENLPEELRYL 288


>gnl|CDD|152953 pfam12519, DUF3722, Protein of unknown function (DUF3722).  This
           family of proteins is found in eukaryotes. Proteins in
           this family are typically between 415 and 473 amino
           acids in length.
          Length = 250

 Score = 28.4 bits (64), Expect = 5.5
 Identities = 26/121 (21%), Positives = 42/121 (34%), Gaps = 29/121 (23%)

Query: 21  SYHLKHIVESNLSHVCVRGEISGYRGIH--SSGHAYFSLKDNHSRIDAIIW--KGTLNKI 76
              L+ +VE             GYR +                SR +       G +   
Sbjct: 47  DIPLQDLVE-------------GYRQLEPPRRPDKKEEEWLAGSRREGRDSLLYGRM--- 90

Query: 77  EFLPEEGIEFLVIGKITTFPGSSKYQIIIE---SLIPSGSGTLLTALEKRKKKLLEEGLF 133
            +LP   +E + I ++     S   Q+I++   S   +  GTLL  L+    K   E L+
Sbjct: 91  -YLPSSTLEAMFIKRL-----SPTTQLILKCVSSPALANGGTLLLYLQHDTGKYSTEYLY 144

Query: 134 S 134
           S
Sbjct: 145 S 145


>gnl|CDD|148634 pfam07138, DUF1386, Protein of unknown function (DUF1386).  This
          family consists of several hypothetical
          Nucleopolyhedrovirus proteins of around 350 residues in
          length. The function of this family is unknown.
          Length = 324

 Score = 27.8 bits (62), Expect = 6.6
 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 7/41 (17%)

Query: 21 SYHLKHIVESNLSHV------CVRGEISGYRGIHSSGHAYF 55
          SYHL  IV+ +L++       CVR +I+  R + +SG   F
Sbjct: 26 SYHLYRIVQEHLTNSYVNGASCVRRDIATARRL-NSGALCF 65


>gnl|CDD|130728 TIGR01667, YCCS_YHJK, integral membrane protein, YccS/YhfK family. 
           TMHMM on members of this model shows a consensus of 11
           transmembrane helices separated into two clusters, an
           N-terminal cluster of 6 and a central cluster of 5. This
           would indicate two non-membrane domains one on each side
           of the membrane.
          Length = 701

 Score = 27.9 bits (62), Expect = 6.7
 Identities = 16/104 (15%), Positives = 43/104 (41%), Gaps = 8/104 (7%)

Query: 365 NIQKNRQHILEKQQHIEQIVKQHLRYIF--LEKKEKIAILHMLREQTKNRIFYLHTHIKK 422
           N  K +  +  +    + + K+ LRY F   +  E+ +  H   ++ +      H+    
Sbjct: 208 NQCKQQLLMRLRGNRTDPLTKRMLRYYFEAQDIHERASSSHHQYQELQELFE--HSD--- 262

Query: 423 LITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQ 466
           ++ RI+ +L  + ++C   ++    + Q + ++   +R      
Sbjct: 263 VLFRIQRLLQTQAQACQ-VLARDILLRQPYYHRLRTERALEKQI 305


  Database: CddB
    Posted date:  Feb 4, 2011  9:54 PM
  Number of letters in database: 5,994,473
  Number of sequences in database:  21,608
  
Lambda     K      H
   0.321    0.137    0.398 

Gapped
Lambda     K      H
   0.267   0.0746    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21608
Number of Hits to DB: 8,628,166
Number of extensions: 577782
Number of successful extensions: 1199
Number of sequences better than 10.0: 1
Number of HSP's gapped: 1190
Number of HSP's successfully gapped: 51
Length of query: 529
Length of database: 5,994,473
Length adjustment: 98
Effective length of query: 431
Effective length of database: 3,876,889
Effective search space: 1670939159
Effective search space used: 1670939159
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 59 (26.5 bits)