BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780791|ref|YP_003065204.1| exodeoxyribonuclease VII large
subunit [Candidatus Liberibacter asiaticus str. psy62]
         (529 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780791|ref|YP_003065204.1| exodeoxyribonuclease VII large subunit [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 529

 Score = 1080 bits (2794), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 529/529 (100%), Positives = 529/529 (100%)

Query: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60
           MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN
Sbjct: 1   MNPFSQKNSLDHPEYSVSELSYHLKHIVESNLSHVCVRGEISGYRGIHSSGHAYFSLKDN 60

Query: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120
           HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL
Sbjct: 61  HSRIDAIIWKGTLNKIEFLPEEGIEFLVIGKITTFPGSSKYQIIIESLIPSGSGTLLTAL 120

Query: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180
           EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK
Sbjct: 121 EKRKKKLLEEGLFSDQHKNPIPFIPKIIAVITSPTGAVIRDILQRISCRFPLRVIIFPVK 180

Query: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240
           VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS
Sbjct: 181 VQGDECPKEIANAILQLNTLKEGRTCPRPDIIILARGGGSIEDLWHFNDEMIVRAIANSS 240

Query: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300
           IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI
Sbjct: 241 IPIISAIGHETDWTLADYAADLRAPTPTGAAEMAVPVKEHLQSSLINLEARLNNIIIRLI 300

Query: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360
           KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD
Sbjct: 301 KYKINTLNSLLKALPNSDQTLSCSRYRLDRLPRELEHNLEIIIFRKYRHFNHIINRIKSD 360

Query: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420
           FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI
Sbjct: 361 FLIHNIQKNRQHILEKQQHIEQIVKQHLRYIFLEKKEKIAILHMLREQTKNRIFYLHTHI 420

Query: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480
           KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA
Sbjct: 421 KKLITRIEFILSHKIKSCHTSVSITTRILQSFAYKNTLKRGYTSIQDTNNNFITQKRNLA 480

Query: 481 TKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529
           TKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF
Sbjct: 481 TKTRILINFFDGQANAIVINKAPPKEQPTKKCQLHNNKREKQGTQGELF 529


>gi|254780527|ref|YP_003064940.1| hypothetical protein CLIBASIA_02070 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 397

 Score = 27.3 bits (59), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 15/20 (75%)

Query: 356 RIKSDFLIHNIQKNRQHILE 375
           R++SDFL   IQ  RQ+IL+
Sbjct: 291 RVESDFLYKKIQSGRQNILD 310


>gi|254780157|ref|YP_003064570.1| phosphoribosylaminoimidazole carboxylase catalytic subunit protein
           [Candidatus Liberibacter asiaticus str. psy62]
          Length = 165

 Score = 26.9 bits (58), Expect = 0.77,   Method: Composition-based stats.
 Identities = 9/25 (36%), Positives = 16/25 (64%)

Query: 238 NSSIPIISAIGHETDWTLADYAADL 262
           N + P+   +G ++DW +  YAAD+
Sbjct: 2   NIAPPVAIIMGSQSDWKIMKYAADM 26


>gi|254780802|ref|YP_003065215.1| leucyl-tRNA synthetase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 869

 Score = 24.3 bits (51), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 3/48 (6%)

Query: 114 GTLLTALEKRKKKLLEEGLFSDQHKNPIPFIPKIIA---VITSPTGAV 158
           GT L+ L+K +KK +  G+      NP   IP  IA    +   TGA+
Sbjct: 294 GTSLSVLDKTEKKGIYTGIHVKHPLNPNVVIPVYIANFVFMNYGTGAI 341


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.321    0.137    0.398 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 341,878
Number of Sequences: 1233
Number of extensions: 14262
Number of successful extensions: 29
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 24
Number of HSP's gapped (non-prelim): 6
length of query: 529
length of database: 328,796
effective HSP length: 78
effective length of query: 451
effective length of database: 232,622
effective search space: 104912522
effective search space used: 104912522
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 40 (20.0 bits)