HHsearch alignment for GI: 254780793 and conserved domain: COG0728

>COG0728 MviN Uncharacterized membrane protein, putative virulence factor [General function prediction only].
Probab=100.00  E-value=0  Score=592.65  Aligned_cols=501  Identities=31%  Similarity=0.558  Sum_probs=453.3

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHH
Q ss_conf             91368899999999999999999999999995777578999999997899999997577899999999999844897899
Q gi|254780793|r    1 MKIIRNFLTVCASTLGSRFLGFIRETLVAATLGVGKVTDVFYVAFYLTFIFRRLAAEGIFHNSFIPLFSQEKENNGSESA   80 (518)
Q Consensus         1 m~~~k~~~~~~~~~~~skilG~~r~~~~a~~~G~~~~~da~~~a~~i~~~~~~l~~~G~~~~a~ip~~~~~~~~~~~~~~   80 (518)
T Consensus         7 ~sllks~~~vs~~Tl~SRi~G~vRd~~iA~~fGa~~~aDAF~vAf~iPN~lRrlfaegafs~aFVPv~~~~~~~~~~~~~   86 (518)
T COG0728           7 MSLLKSLIIVSSATLLSRILGFVRDVLIAAAFGAGAAADAFFVAFKLPNLLRRLFAEGAFSSAFVPVLAEAKKKEGEEAA   86 (518)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHCCHHHHH
T ss_conf             88999999999999999999999999999996776688999999972899999984636766666789999870605579


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHH
Q ss_conf             99999999999999999999999965343444578875410111124565544433212468887656889988422279
Q gi|254780793|r   81 QRLSSEIFSILILSLVVLTVVVELILPLLIRFIIAPGFADQSDKYFLTIQLSRVMFPSIIFISLASLVTGMLFALGRYFI  160 (518)
Q Consensus        81 ~~~~~~~~~~~~~~~~~l~~l~~~~~~~~~~~l~a~g~~~~~~~~~la~~~~~i~~p~~~~~~~~~~~~~~l~~~~~f~~  160 (518)
T Consensus        87 ~~f~~~v~~~l~~~ll~vt~L~~l~~p~iv~~~~~~g~-~~~~~~-~a~~l~~i~~Pyl~~isL~al~~aiLNs~~~F~~  164 (518)
T COG0728          87 RFFSRLVTGLLTLVLLLVTLLGILFAPWLVRLLLAPGF-DETDKF-LAVLLTRILFPYLLFISLSALFGAILNSRNRFFI  164 (518)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC-CHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEECH
T ss_conf             99999999999999999999999988999999717897-515689-9999999999999999999999999840372120


Q ss_pred             HHHHHHHHHCHHHHHHHHHHCCCCCCCCCCEEHHHHHHHHHHHHHCCCCCHHHCCCCCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             99999854010346777762356865443200012211101110002310121036544456775432410001346888
Q gi|254780793|r  161 ASIAPIVINVFPIFALTYALWHPSSPQETTYLLAWGVFLSNVVHFWIVYCCAKNDGVKLRFQYPRLTHNVKFFLKLTFPL  240 (518)
Q Consensus       161 ~a~~~vi~ni~~i~~~~~~~~~~~~~~~~~~~~a~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~l~~~~p~  240 (518)
T Consensus       165 ~a~aPvl~Nv~~I~~~l~---~~~~~~~~~~~La~gvl~Gg~~Q~l~~lp~l~~~g~~~~p~~~~~~~~lk~~~~~~~p~  241 (518)
T COG0728         165 PAFAPVLLNVSVIGLALF---LGPYFDPPLLALAWGVLIGGLLQLLVQLPALRKAGLLIKPRFGFKDPGLKRFLKLMLPA  241 (518)
T ss_pred             HHHHHHHHHHHHHHHHHH---HCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             446499999999999998---54100047899999999999999999999999836544787888715599999999999


Q ss_pred             HHHHHHCCCHHHHHCCCCC-CCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             7643201202333202556-556630577775332110000001112322100234444332236789998975411344
Q gi|254780793|r  241 MVTGGIIQISNIVGRAIAS-RETGIISAIQYAERIYSLPVGVIGGAMMIVILPALSRSLRSKNKQKSFELQNQAIECISF  319 (518)
Q Consensus       241 ~l~~~~~~i~~~i~~~~as-~~~g~vs~~~~a~~l~~l~~~i~~~ai~~~~~P~ls~~~~~~d~~~~~~~~~~~~~~~~~  319 (518)
T Consensus       242 ~l~~sisQi~lli~~~iAS~l~~Gsis~l~YA~rl~qlPlGifgvai~tvllP~lSr~~~~~~~~~~~~~l~~~i~l~ll  321 (518)
T COG0728         242 LLGVSISQINLLIDTAIASFLAEGSVSWLYYADRLYQLPLGIFGVALSTVLLPSLSRHAANGDWPEFLKLLDWGLRLTLL  321 (518)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999986013509999999999971589999999999879999975067659899999999999999


Q ss_pred             CHHHHHHHHHHCCCCCCCHHHHCCCCCHHHHHHHHHHHHHHHCHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             21589999985257231112104786445545666655542010567753123202354433101346777888689999
Q gi|254780793|r  320 FGIPSAVALFMLSKEIVQTLYERGAFSSQNTILVSSFLSIYSIGILANILSKSLSTAFYAQNDMKAPMKFTIVSIAINLT  399 (518)
Q Consensus       320 i~~p~~~~l~~~~~~ii~llf~~g~F~~~~~~~~~~~L~~~~~~~~~~~~~~i~~~~~~a~g~~~~~~~~~~~~~~vni~  399 (518)
T Consensus       322 l~lP~~~~l~~la~piv~~Lf~rG~F~~~d~~~ta~~L~~y~~gL~~~~L~~ll~~~FYAr~d~ktP~~i~ii~~~~n~~  401 (518)
T COG0728         322 LTLPASAGLLVLAEPIVSLLFERGAFTAEDVLMTAEALAAYSLGLIPFALVKLLSRVFYAREDTKTPMKIAIISLVVNIL  401 (518)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHH
T ss_conf             99999999999899999999535899857799999999999874489999999999999803877376999999999999


Q ss_pred             HHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCC--CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             98752021120049999999999999999999997115788--9889999999999999999999999998655310002
Q gi|254780793|r  400 IAIGSFPFIGGYGIALAEVSSSWVNTICLAITLLKRKQINL--PFKTIYRILSVSISAGLMGFFIILFRPYFNQFSSATT  477 (518)
Q Consensus       400 l~~~li~~~G~~G~a~at~i~~~~~~~~~~~~l~k~~~~~~--~~~~~~~~~~~~~~~~im~~~~~~~~~~~~~~~~~~~  477 (518)
T Consensus       402 l~~~l~~~~~~~giala~s~a~~~~~~ll~~~l~k~~~~~~~~~~~~~~-~~k~~l~~~i~~~~~~~~~~~~~~~~~~~~  480 (518)
T COG0728         402 LNLLLIPPLGHVGLALATSLAAWVNALLLYYLLRKRLVYLPGRGWGLFL-ILKLLLASAIMAAALLALLHLAQREWLLGG  480 (518)
T ss_pred             HHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999786135229999999999999999999999843778620035999-999999999999999999999999999868


Q ss_pred             HHH-HHHHHHHHHHHHHHHHHHHHHHHCCHH
Q ss_conf             799-999999999999999999999960078
Q gi|254780793|r  478 FFD-PFKNLVIMLSGAMLVYLFSIFLFLGKD  507 (518)
Q Consensus       478 ~~~-~~~~l~~~i~~~~~vY~~~l~l~~~~~  507 (518)
T Consensus       481 ~~~~~~~~l~~~~~~~~~~~~~~~~~~g~~~  511 (518)
T COG0728         481 LLLIRLGVLLLLVLLGAGVYFAMLLLLGFRV  511 (518)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             8999999999999999999999999988775