HHsearch alignment for GI: 254780794 and conserved domain: PRK12268

>PRK12268 methionyl-tRNA synthetase; Reviewed.
Probab=96.90  E-value=0.0083  Score=38.95  Aligned_cols=88  Identities=17%  Similarity=0.275  Sum_probs=54.7

Q ss_pred             CEEEE-EE-CCCCCCCHHHHHHH-HH--HHHHHHHHCCCCEEEEEE-EHHHHC-------CCCCHHHHHH-HHHHHHHHH
Q ss_conf             87896-01-58967810557988-99--999998505995899973-115730-------7898589999-999999999
Q gi|254780794|r    6 NLFVS-GV-QPTGVLHLGNYLGM-IR--NVIRRQETCNHLGMYFIA-DLHAIT-------NNIVQENLRY-QSRLFVASF   71 (355)
Q Consensus         6 ~~vlt-G~-~PtG~~HLG~y~g~-i~--~~i~lq~~~~~~~~~~IA-D~halt-------~~~~~~~~~~-~~~~~~~~~   71 (355)
T Consensus         4 k~~iTt~~Py~nG~lHiGH~~~~~l~aDi~aRy~R~~G~~v~~~~GtD~hG~~i~~~A~k~g~~p~e~~~~~~~~~~~~~   83 (558)
T PRK12268          4 RILITSAWPYANGPLHLGHLAGSYLPADVYARYQRLKGNEVLFVSGSDEHGTPIELEAEKEGVSPQELADKYHEEHKEDF   83 (558)
T ss_pred             CEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHH
T ss_conf             18984799888898552311141989999999998379987975840647499999999859999999999999999999


Q ss_pred             HHCCCCCCCCEEEECCCHHHHHHHH
Q ss_conf             9628681112365247407889999
Q gi|254780794|r   72 LAAGVDPSRNIIFKQSDVGYHADLS   96 (355)
Q Consensus        72 lA~Gldp~k~~if~QS~v~e~~eL~   96 (355)
T Consensus        84 ~~lgis~D~---f~rT~~~~~~~~v  105 (558)
T PRK12268         84 EKLGISYDN---YTRTTSPEHHELV  105 (558)
T ss_pred             HHCCCCCCC---CCCCCCHHHHHHH
T ss_conf             981983776---8668988999999