>cd00674 LysRS_core_class_I This is the catalytic core domain of lysyl tRNA synthetase (LysRS). This class I enzyme is a monomer, which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. The class I LysRS is found only in archaea and some bacteria and has evolved separately from class II LysRS, as the two do not share structural or sequence similarity.

Probab=96.17 E-value=0.0086 Score=38.84 Aligned_cols=42 Identities=21% Similarity=0.548 Sum_probs=26.5 Q ss_pred CCEEE-EEECCCCCCCHHHHHHHHH-HHH--HHHHHCCCCE-EEEEEE Q ss_conf 88789-6015896781055798899-999--9985059958-999731 Q gi|254780794|r 5 DNLFV-SGVQPTGVLHLGNYLGMIR-NVI--RRQETCNHLG-MYFIAD 47 (355) Q Consensus 5 ~~~vl-tG~~PtG~~HLG~y~g~i~-~~i--~lq~~~~~~~-~~~IAD 47 (355) T Consensus 19 ~~~v~~tG~~PSG~~HIGn~rEv~~~~~V~ral~~~g-~~~~~i~~~D 65 (354) T cd00674 19 EKYVVASGISPSGLIHIGNFREVVTADAVRRALRDLG-FEVRLIYSWD 65 (354) T ss_pred CCEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHCC-CCEEEEEEEE T ss_conf 8589947879998863205501788999999999759-9679999840

HHsearch alignment for GI: 254780794 and conserved domain: cd00674