>cd00812 LeuRS_core This is the catalytic core domain of leucyl tRNA synthetase (LeuRS). This class I enzyme is a monomer, which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. In Aquifex aeolicus, the gene encoding LeuRS is split in two, just before the KMSKS motif. Consequently, LeuRS is a heterodimer, which likely superimposes with the LeuRS monomer found in most other organisms. LeuRS has an insertion in the core domain, which is subject to both deletions and rearrangements and thus differs between prokaryotic LeuRS and archaeal/eukaryotic LeuRS. This editing region hydrolyzes mischarged cognate tRNAs and thus prevents the incorporation of chemically similar amino acids.

Probab=95.66 E-value=0.083 Score=32.23 Aligned_cols=66 Identities=14% Similarity=0.183 Sum_probs=40.3 Q ss_pred CCCCCCHHHHHHHHHH--HHHHHHHCCCCEEEEEE-EHHHHCC-------C-----------------------CCHHHH Q ss_conf 8967810557988999--99998505995899973-1157307-------8-----------------------985899 Q gi|254780794|r 14 PTGVLHLGNYLGMIRN--VIRRQETCNHLGMYFIA-DLHAITN-------N-----------------------IVQENL 60 (355) Q Consensus 14 PtG~~HLG~y~g~i~~--~i~lq~~~~~~~~~~IA-D~halt~-------~-----------------------~~~~~~ 60 (355) T Consensus 11 ~NG~~HiGH~~~~i~aDi~~Ry~Rm~G~~V~~~~G~DeHG~pI~~~A~~~g~~~~~~~~~~~~~~~~~~~~~~~~~p~~~ 90 (376) T cd00812 11 PSGRLHVGHVRTYTIGDIIARYKRMKGYNVLFPMGFDAFGLPAENAADKIGREDEDTIEPYRDVGVPDEEIEKFADPKYW 90 (376) T ss_pred CCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHCCCHHHHHHHHHHCCHHHHHHHCCCCHHHH T ss_conf 89745468869899999999999955997046884565678999999996874776530111100018878612799999 Q ss_pred -HHHHHHHHHHHHHCCCCCC Q ss_conf -9999999999996286811 Q gi|254780794|r 61 -RYQSRLFVASFLAAGVDPS 79 (355) Q Consensus 61 -~~~~~~~~~~~lA~Gldp~ 79 (355) T Consensus 91 ~~~~~~~~~~~~~~lg~~~D 110 (376) T cd00812 91 TEYFIAKMKEQLKRMGFSID 110 (376) T ss_pred HHHHHHHHHHHHHHHCCCCC T ss_conf 99999999999998098737

HHsearch alignment for GI: 254780794 and conserved domain: cd00812