BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780794|ref|YP_003065207.1| tryptophanyl-tRNA synthetase
[Candidatus Liberibacter asiaticus str. psy62]
         (355 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780794|ref|YP_003065207.1| tryptophanyl-tRNA synthetase [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040471|gb|ACT57267.1| tryptophanyl-tRNA synthetase [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 355

 Score =  734 bits (1896), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/355 (100%), Positives = 355/355 (100%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENL 60
           MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENL
Sbjct: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENL 60

Query: 61  RYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKE 120
           RYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKE
Sbjct: 61  RYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKE 120

Query: 121 NKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEV 180
           NKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEV
Sbjct: 121 NKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEV 180

Query: 181 AQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIA 240
           AQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIA
Sbjct: 181 AQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIA 240

Query: 241 KKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLAL 300
           KKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLAL
Sbjct: 241 KKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLAL 300

Query: 301 ADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLSH 355
           ADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLSH
Sbjct: 301 ADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLSH 355


>gi|315122016|ref|YP_004062505.1| tryptophanyl-tRNA synthetase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495418|gb|ADR52017.1| tryptophanyl-tRNA synthetase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 354

 Score =  556 bits (1434), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 265/355 (74%), Positives = 313/355 (88%), Gaps = 1/355 (0%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENL 60
           M SS+NLFVSGVQPTG LHLGNYLGMIR V++RQ+TCN  G+YF+ADLHAITN +VQE+L
Sbjct: 1   MNSSENLFVSGVQPTGGLHLGNYLGMIRKVVKRQQTCNWAGIYFVADLHAITNKVVQEDL 60

Query: 61  RYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKE 120
             QSRL +ASFLAAG+DPSRNI+FKQS V  H++L+WILSC+ARMGWMNNMIQFKEKS +
Sbjct: 61  PDQSRLVIASFLAAGIDPSRNIMFKQSAVSEHSELAWILSCIARMGWMNNMIQFKEKSGK 120

Query: 121 NKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEV 180
           + E TASLGL+ YPVLMAADILLYRATHVPVGEDQ+QHLE+TRLIAQRFN EFE +IK++
Sbjct: 121 DGE-TASLGLYSYPVLMAADILLYRATHVPVGEDQKQHLELTRLIAQRFNAEFEHQIKKI 179

Query: 181 AQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIA 240
           +Q    +EQYSKGFFPIIE LI+SS SRI+SL++ASKKMSKSD ++ SRI+LLD+ D IA
Sbjct: 180 SQASQNKEQYSKGFFPIIESLIESSTSRIKSLKNASKKMSKSDPANSSRIDLLDDADTIA 239

Query: 241 KKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLAL 300
           KKIQKAKTDGDVLPSEVSGLENRLEAKNL++IFAT++ IK EE LKQFGGK FSQFKLAL
Sbjct: 240 KKIQKAKTDGDVLPSEVSGLENRLEAKNLVDIFATIKHIKPEEVLKQFGGKYFSQFKLAL 299

Query: 301 ADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLSH 355
           A+ +I EI PIS ++  LLK+KSY+D IL++GANRAR RAQ+TM++V EIVG SH
Sbjct: 300 AEVIIAEIKPISTEMHRLLKEKSYIDDILIKGANRARYRAQKTMRHVREIVGFSH 354


>gi|13474436|ref|NP_106004.1| tryptophanyl-tRNA synthetase [Mesorhizobium loti MAFF303099]
 gi|25009441|sp|Q98C31|SYW_RHILO RecName: Full=Tryptophanyl-tRNA synthetase; AltName:
           Full=Tryptophan--tRNA ligase; Short=TrpRS
 gi|14025189|dbj|BAB51790.1| trytophanyl-tRNA synthetase [Mesorhizobium loti MAFF303099]
          Length = 355

 Score =  389 bits (998), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 189/349 (54%), Positives = 254/349 (72%), Gaps = 5/349 (1%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           L  SGVQPTG LHLGNYLG I+  +  QET + +  Y + DLH++T  +V E+L  Q+R 
Sbjct: 7   LVFSGVQPTGNLHLGNYLGAIKKFVALQETSDCI--YCVVDLHSLTAQLVHEDLADQTRS 64

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A+FLA+G+DP ++I+F QS V  HA+L+WI +CVAR+GWMN M QFK+K+ +++E  A
Sbjct: 65  ITAAFLASGIDPKKHIVFNQSRVMQHAELAWIFNCVARIGWMNKMTQFKDKAGKDRE-NA 123

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           SLGL  YP LMAADILLYRATHVPVGEDQ+QHLE+TR IAQ+FN +F  +I  +      
Sbjct: 124 SLGLLAYPSLMAADILLYRATHVPVGEDQKQHLELTRDIAQKFNNDFSDRIARLGVGVEM 183

Query: 187 E--EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQ 244
           +  E+   GFFPI E +I   A+RI SLRD SKKMSKSD SD SRINL D+ D I+KKI+
Sbjct: 184 QVGEETVNGFFPITEPVIGGPAARIMSLRDGSKKMSKSDPSDLSRINLTDDADTISKKIR 243

Query: 245 KAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           KAKTD + LPSEVSGLE+R EA+NL+ I+A + ++   + LK+FGG+ FS FK ALAD  
Sbjct: 244 KAKTDPEALPSEVSGLESRPEAENLVGIYAGLAEMSKADVLKEFGGQQFSVFKPALADLA 303

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           +E++ PI+ +++ +  D++Y+D +L +G  RA   A+ TMK V +I+GL
Sbjct: 304 VEKLAPIAGEMRRIEGDRAYVDAVLRDGGERAGVLAETTMKTVRDIIGL 352


>gi|260462742|ref|ZP_05810947.1| tryptophanyl-tRNA synthetase [Mesorhizobium opportunistum WSM2075]
 gi|259031386|gb|EEW32657.1| tryptophanyl-tRNA synthetase [Mesorhizobium opportunistum WSM2075]
          Length = 355

 Score =  384 bits (987), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 187/349 (53%), Positives = 252/349 (72%), Gaps = 5/349 (1%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           L  SGVQPTG LHLGNYLG I+  +  Q+T + +  Y + DLH++T  +V ++L  Q+R 
Sbjct: 7   LVFSGVQPTGNLHLGNYLGAIKKFVALQDTSDCI--YCVVDLHSLTAQLVYDDLADQTRS 64

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A+FLA+G+DP ++I+F QS V  HA+L+WI +CVAR+GWMN M QFK+K+ +++E  A
Sbjct: 65  ITAAFLASGIDPKKHIVFNQSRVMQHAELAWIFNCVARIGWMNKMTQFKDKAGKDRE-NA 123

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           SLGL  YP LMAADILLYRATHVPVGEDQ+QHLE+TR IAQ+FN +F  +I  +      
Sbjct: 124 SLGLLAYPSLMAADILLYRATHVPVGEDQKQHLELTRDIAQKFNNDFSDRIASLGVGVEM 183

Query: 187 E--EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQ 244
           +  ++   GFFPI E +I   A+RI SLRD SKKMSKSD SD SRINL D+ D I+KKI+
Sbjct: 184 QVGDETVNGFFPITEPVIGGPAARIMSLRDGSKKMSKSDPSDLSRINLTDDADTISKKIR 243

Query: 245 KAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           KAKTD + LPSEV GLE R EA+NL+ I+A + ++   E LK+FGG+ FS FK ALAD  
Sbjct: 244 KAKTDPEALPSEVDGLETRPEAENLVGIYAGLAELSKAEVLKEFGGQQFSVFKPALADLA 303

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           +E++ PI+ +++ +  D++Y+D +L +G  RA   A+ TMK V +IVGL
Sbjct: 304 VEKLAPIASEMRRIQGDRAYVDAVLRDGGERAGVLAETTMKTVRDIVGL 352


>gi|319779937|ref|YP_004139413.1| tryptophanyl-tRNA synthetase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317165825|gb|ADV09363.1| tryptophanyl-tRNA synthetase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 355

 Score =  377 bits (969), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 184/355 (51%), Positives = 252/355 (70%), Gaps = 5/355 (1%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENL 60
           M +   L  SGVQPTG LHLGNYLG I+  +  Q+T + +  Y + DLH++T  +V E+L
Sbjct: 1   MTAFKPLVFSGVQPTGNLHLGNYLGAIKKFVALQDTSDCI--YCVVDLHSLTAQLVYEDL 58

Query: 61  RYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKE 120
             Q+R   A+FLA+G+DP ++I+F QS V  HA+L+WI +CVAR+GWMN M QFK+K+ +
Sbjct: 59  ADQTRSITAAFLASGIDPKKHIVFNQSRVMQHAELAWIFNCVARIGWMNRMTQFKDKAGK 118

Query: 121 NKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEV 180
           ++E  ASLGL  YP LMAADILLYRATHVPVGEDQ+QHLE+TR IAQ+FN +F  +I  +
Sbjct: 119 DRE-NASLGLLAYPSLMAADILLYRATHVPVGEDQKQHLELTRDIAQKFNNDFSDRIAAL 177

Query: 181 AQKYAQE--EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDI 238
                 +  E+   G+FP+ E +I   A+RI SLRD SKKMSKSD SD SRINL D+ D 
Sbjct: 178 GVGVEMQVGEETVNGYFPLTEPVIGGPAARIMSLRDGSKKMSKSDPSDLSRINLTDDADD 237

Query: 239 IAKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKL 298
           I+KKI+KAKTD + LPSE+ GL  R EA+NL+ I+A + ++   + LKQF G+ FS FK 
Sbjct: 238 ISKKIRKAKTDPEALPSELDGLAGRPEAENLVGIYAGLAEMSKADVLKQFAGQQFSVFKP 297

Query: 299 ALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           ALAD  +E++ PI+ +++ +  D++Y+D +L +G  RA   A+ TMK V +I+GL
Sbjct: 298 ALADLAVEKLAPIASEMRRISDDRAYVDAVLKDGGERAGVLAEATMKTVRDIIGL 352


>gi|90420548|ref|ZP_01228455.1| tryptophanyl-tRNA synthetase [Aurantimonas manganoxydans SI85-9A1]
 gi|90335276|gb|EAS49029.1| tryptophanyl-tRNA synthetase [Aurantimonas manganoxydans SI85-9A1]
          Length = 355

 Score =  377 bits (969), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 184/346 (53%), Positives = 245/346 (70%), Gaps = 5/346 (1%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQPTG LHLGNYLG IR  +  QE+  H  +Y + DLH+IT  +V ++LR Q+R   A
Sbjct: 10  SGVQPTGNLHLGNYLGAIRKFVALQES--HDCIYCVVDLHSITVQLVHDDLRGQTRSITA 67

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           +FLAAG+DP ++I+F QS V  HA+L+W+ +CVAR+GWMN M QFKEK+ +++E  ASLG
Sbjct: 68  AFLAAGIDPKQHIVFNQSRVPGHAELAWVFNCVARIGWMNRMTQFKEKAGKDRE-NASLG 126

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKE--VAQKYAQE 187
           L  YP LMAADILLYRATHVPVG+DQ+QHLE+TR IA +FN +F  KI    V Q     
Sbjct: 127 LLAYPSLMAADILLYRATHVPVGDDQKQHLELTRDIAAKFNNDFSDKIAAAGVGQPIQMG 186

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
           ++   G+FPI E LI+  A+R+ SL+D SKKMSKSD SD SRINL D+ D I++KI+KA+
Sbjct: 187 DETVNGYFPITEPLIEGPATRVMSLKDGSKKMSKSDPSDLSRINLTDDADAISRKIRKAR 246

Query: 248 TDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
           TD D LPSEV GL  R EA NLI I+A + +    E L +FGG+ FS+FK A+A+  +E+
Sbjct: 247 TDPDALPSEVDGLTGRPEADNLIGIYAALAERSKAEILAEFGGRQFSEFKPAMAELAVEK 306

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + P+S +++ LL    ++D +L +G  RA   A  TM  V +I+GL
Sbjct: 307 LAPVSGEMRRLLAAPDHIDAVLKDGGERAGAIAAATMNDVKDIIGL 352


>gi|110636359|ref|YP_676567.1| tryptophanyl-tRNA synthetase [Mesorhizobium sp. BNC1]
 gi|110287343|gb|ABG65402.1| tryptophanyl-tRNA synthetase [Chelativorans sp. BNC1]
          Length = 355

 Score =  376 bits (966), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 183/351 (52%), Positives = 248/351 (70%), Gaps = 9/351 (2%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           L  SGVQPTG LHLGNYLG ++  +  Q++  +  +Y + D+H++T  +V ++L  Q+R 
Sbjct: 7   LVFSGVQPTGNLHLGNYLGALQKFVALQDS--YECIYCVVDMHSLTATLVHDDLIDQTRG 64

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A++LA G+DP +NIIF Q+ V  HA+L+WI +CVAR+GWMN M QFK+K+ +++E  A
Sbjct: 65  IAAAYLACGLDPKKNIIFNQARVPQHAELAWIFNCVARIGWMNRMTQFKDKAGKDRE-NA 123

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           SLGL  YP LMAADILLYRATHVPVGEDQ+QHLE+TR IAQ+FN +F  KI  +   Y  
Sbjct: 124 SLGLLAYPSLMAADILLYRATHVPVGEDQKQHLELTRDIAQKFNNDFSEKIANLG--YGV 181

Query: 187 E----EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKK 242
           E    E+   GFFP+ E LI+  A R+ SLRD SKKMSKSD SD SRINLLD+ D IA+K
Sbjct: 182 EMTVGEEKVNGFFPLTEPLIEGPAPRVMSLRDGSKKMSKSDPSDLSRINLLDDADTIARK 241

Query: 243 IQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALAD 302
           I+KAKTD + LP +V G   R EA NL+ I+A +  +  E  + +FGG+ FS FK ALAD
Sbjct: 242 IRKAKTDPEPLPGDVEGFAGRPEADNLVGIYAALAGMPRENVIAEFGGRQFSDFKPALAD 301

Query: 303 AVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
             +E++ PI  +++ L  D +Y+D +L +G  RA  +A+ TMK+V+EI+GL
Sbjct: 302 LAVEKLAPIGGEMRRLKADPAYIDNVLRDGGERASVKAEATMKHVHEIIGL 352


>gi|222084686|ref|YP_002543215.1| tryptophanyl-tRNA synthetase protein [Agrobacterium radiobacter
           K84]
 gi|221722134|gb|ACM25290.1| tryptophanyl-tRNA synthetase protein [Agrobacterium radiobacter
           K84]
          Length = 354

 Score =  376 bits (965), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 182/349 (52%), Positives = 247/349 (70%), Gaps = 5/349 (1%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           L  SGVQPTG LHLGNYLG IR  +  QE  N+  MY + D+HA+T  +V E++R Q+R 
Sbjct: 7   LVFSGVQPTGNLHLGNYLGAIRKFVALQE--NNDCMYCVVDMHALTAQLVHEDMRSQTRS 64

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A+FLAAG+DP ++I+F QS V  HA+L+WI +CVAR+GWMN M QFK+K+ +++E+ A
Sbjct: 65  ITAAFLAAGIDPEKHIVFNQSTVPQHAELAWIFNCVARIGWMNRMTQFKDKAGKDREQ-A 123

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQ--KY 184
           SLGL+ YP LMAADILLYRATHVPVG+DQ+QHLE+TR IA +FN +F   I+        
Sbjct: 124 SLGLYAYPSLMAADILLYRATHVPVGDDQKQHLELTRDIAMKFNLDFMEHIRRSGYGIDI 183

Query: 185 AQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQ 244
              ++    +FP++E LID  A R+ SLRD +KKMSKSD+SD SRINLLD+ + I+KKI+
Sbjct: 184 TVGDEPVHAYFPMVEPLIDGPAPRVMSLRDGTKKMSKSDASDLSRINLLDDEENISKKIR 243

Query: 245 KAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           KAKTD D LPSE++GL  R EA NL+ I+A +      + L +FGG+ FS FK AL D  
Sbjct: 244 KAKTDPDGLPSEIAGLAGRPEADNLVGIYAALADTSKADVLSEFGGQQFSVFKPALVDLA 303

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           ++ + PI+ +++ L+ D  ++D +L +G  RAR RA+ TM  V +IVG 
Sbjct: 304 VQVLSPITGEMRRLMADPGHIDAVLRDGGARARARAEVTMNQVRDIVGF 352


>gi|222147344|ref|YP_002548301.1| tryptophanyl-tRNA synthetase [Agrobacterium vitis S4]
 gi|221734334|gb|ACM35297.1| tryptophan-tRNA ligase [Agrobacterium vitis S4]
          Length = 354

 Score =  374 bits (961), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 181/349 (51%), Positives = 246/349 (70%), Gaps = 5/349 (1%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           L  SGVQPTG LHLGNYLG IR  +  QE  N+  MY + DLHA+T  +V E++R Q R 
Sbjct: 7   LVFSGVQPTGNLHLGNYLGAIRKFVALQE--NNDCMYCVVDLHALTAQLVHEDMRGQIRS 64

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A+FLAAG+DP ++I+F QS V  HA+L+WI +CVAR+GWMN M QFK+K+ +++E+ A
Sbjct: 65  ITAAFLAAGIDPVKHIVFNQSQVPQHAELAWIFNCVARIGWMNRMTQFKDKAGKDREQ-A 123

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQ--KY 184
           SLGLF YP LMAADIL+YRATHVPVG+DQ+QHLE+TR IA +FN +F ++I+        
Sbjct: 124 SLGLFAYPSLMAADILVYRATHVPVGDDQKQHLELTRDIAMKFNLDFAQQIRPTGLGIDI 183

Query: 185 AQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQ 244
               +    +FP++E LID  A R+ SL+D +KKMSKSD SD SRINL+D+ + IAKKI+
Sbjct: 184 TVGNEPVHAYFPMVEPLIDGPAPRVMSLKDGTKKMSKSDPSDLSRINLMDDAEAIAKKIR 243

Query: 245 KAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           KAKTD D LPSE  GL  R EA NL+ I+A +      E L +FGG+ FS FK AL +  
Sbjct: 244 KAKTDPDALPSETDGLAGRPEADNLVGIYAALADKTKAEVLAEFGGQQFSVFKPALIELA 303

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           +E + PI+ +++ L+ D +++D +L +G  RAR RA++TM  + +I+G 
Sbjct: 304 VEVLSPITGEMRRLMGDPAHIDAVLRDGGERARVRAEKTMTEIRDIIGF 352


>gi|150395262|ref|YP_001325729.1| tryptophanyl-tRNA synthetase [Sinorhizobium medicae WSM419]
 gi|150026777|gb|ABR58894.1| tryptophanyl-tRNA synthetase [Sinorhizobium medicae WSM419]
          Length = 354

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 185/351 (52%), Positives = 249/351 (70%), Gaps = 9/351 (2%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           L  SGVQPTG LHLGNYLG IR  +  Q+  N+  +Y + DLH+IT  +V E+LR Q R 
Sbjct: 7   LVFSGVQPTGNLHLGNYLGAIRKFVALQD--NNDCIYCVVDLHSITAQLVHEDLRGQIRS 64

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A+F+A+G+DP ++I+F QS V  HA+L+WI +CVAR+GWMN M QFK+K+ +++E  A
Sbjct: 65  IAAAFIASGIDPEKHIVFNQSAVPQHAELAWIFNCVARIGWMNRMTQFKDKAGKDRE-NA 123

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           SLGL  YP LMAADIL+YRATHVPVG+DQ+QHLE+TR IAQ+FN +F   I+  A+ Y  
Sbjct: 124 SLGLLAYPSLMAADILVYRATHVPVGDDQKQHLELTRDIAQKFNIDFMAHIR--ARGYGV 181

Query: 187 E----EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKK 242
           +    E+    +FP +E LI   A R+ SLRD +KKMSKSD SD SRINL+D+ D I KK
Sbjct: 182 DIVVGEEPIHAYFPPVEPLIGGPAPRVMSLRDGTKKMSKSDPSDLSRINLMDDADTILKK 241

Query: 243 IQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALAD 302
           I+KAKTD D LPSE  GL+ R EA+NL+ I+A +     +E L +FGG+ FS FK ALAD
Sbjct: 242 IRKAKTDPDALPSEADGLKGRPEAENLVGIYAALSDRSKDEVLAEFGGQQFSAFKPALAD 301

Query: 303 AVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
             +  + PI+ +++ L+ D +++D IL +G  RAR RA++TM+ V EI+G 
Sbjct: 302 LAVTVLSPITGEMRRLMGDTAHIDAILRKGGERARERAEKTMREVREIIGF 352


>gi|227820622|ref|YP_002824592.1| tryptophanyl-tRNA synthetase [Sinorhizobium fredii NGR234]
 gi|227339621|gb|ACP23839.1| tryptophanyl-tRNA synthetase [Sinorhizobium fredii NGR234]
          Length = 354

 Score =  371 bits (953), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 183/349 (52%), Positives = 245/349 (70%), Gaps = 5/349 (1%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           L  SGVQPTG LHLGNYLG IR  +  QE  N+  +Y + DLH+IT  +V E+L  Q R 
Sbjct: 7   LVFSGVQPTGNLHLGNYLGAIRKFVALQE--NNDCIYCVVDLHSITAQLVHEDLPGQIRS 64

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A+F+A+G+DP ++I+F QS V  HA+L+WI +CVAR+GWMN M QFK+K+ +++E  A
Sbjct: 65  IAAAFVASGIDPEKHIVFNQSAVPQHAELAWIFNCVARIGWMNRMTQFKDKAGKDRE-NA 123

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKE--VAQKY 184
           SLGL  YP LMAADIL+YRATHVPVG+DQ+QHLE+TR IAQ+FN +F   I+        
Sbjct: 124 SLGLLAYPSLMAADILVYRATHVPVGDDQKQHLELTRDIAQKFNIDFMEHIRARGCGVDI 183

Query: 185 AQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQ 244
              E+    +FP +E LI   A R+ SLRD +KKMSKSD SD SRINL+D+ + IAKKI+
Sbjct: 184 VVGEEPIHAYFPPVEPLIGGPAPRVMSLRDGTKKMSKSDPSDLSRINLMDDAETIAKKIR 243

Query: 245 KAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           KAKTD D LPSEV GL+ R EA+NL+ I+A +     +E L +FGG+ FS FK AL D  
Sbjct: 244 KAKTDPDALPSEVEGLQGRPEAENLVGIYAALSDRTKQEVLAEFGGQQFSVFKPALIDLA 303

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           ++ + PI+ +++ L+ D +++D IL  G  RAR RA++TM+ V EI+G 
Sbjct: 304 VDVLSPITGEMRRLMDDTAHIDAILRSGGERARARAEKTMREVREIIGF 352


>gi|15964152|ref|NP_384505.1| tryptophanyl-tRNA synthetase [Sinorhizobium meliloti 1021]
 gi|307301297|ref|ZP_07581059.1| tryptophanyl-tRNA synthetase [Sinorhizobium meliloti BL225C]
 gi|307317968|ref|ZP_07597405.1| tryptophanyl-tRNA synthetase [Sinorhizobium meliloti AK83]
 gi|25009440|sp|Q92SI9|SYW_RHIME RecName: Full=Tryptophanyl-tRNA synthetase; AltName:
           Full=Tryptophan--tRNA ligase; Short=TrpRS
 gi|15073328|emb|CAC41836.1| Probable tryptophanyl-tRNA synthetase [Sinorhizobium meliloti 1021]
 gi|306896370|gb|EFN27119.1| tryptophanyl-tRNA synthetase [Sinorhizobium meliloti AK83]
 gi|306903753|gb|EFN34340.1| tryptophanyl-tRNA synthetase [Sinorhizobium meliloti BL225C]
          Length = 354

 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 184/349 (52%), Positives = 244/349 (69%), Gaps = 5/349 (1%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           L  SGVQPTG LHLGNYLG IR  +  QE  N+  +Y + DLH+IT  +V E+L  Q R 
Sbjct: 7   LVFSGVQPTGNLHLGNYLGAIRKFVALQE--NNDCIYCVVDLHSITAQLVHEDLPGQIRS 64

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A+F+A+G+DP ++I+F QS V  HA+L+WI +CVAR+GWMN M QFK+K+ +++E  A
Sbjct: 65  IAAAFIASGIDPEKHIVFNQSAVPQHAELAWIFNCVARIGWMNRMTQFKDKAGKDRE-NA 123

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKE--VAQKY 184
           SLGL  YP LMAADIL+YRATHVPVG+DQ+QHLE+TR IAQ+FN +F   I+        
Sbjct: 124 SLGLLAYPSLMAADILVYRATHVPVGDDQKQHLELTRDIAQKFNIDFMEHIRRGGYGVDI 183

Query: 185 AQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQ 244
              E+    +FP +E LI   A R+ SLRD +KKMSKSD SD SRINL+D+ D I KKI+
Sbjct: 184 VVGEEPIHAYFPPVEPLIGGPAPRVMSLRDGTKKMSKSDPSDLSRINLMDDADTILKKIR 243

Query: 245 KAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           KAKTD D LPSE  GL++R EA+NL+ I+A +     EE L +FGG+ FS FK ALAD  
Sbjct: 244 KAKTDPDALPSEADGLKDRPEAENLVGIYAALADRSKEEVLAEFGGQQFSTFKPALADLA 303

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           +  + PI+ +++ L+ D +++D IL +G  RAR RA+ TM+ V EI+G 
Sbjct: 304 VSVLSPITGEMRRLMGDTAHIDAILRKGGERARERAETTMREVREIIGF 352


>gi|49476030|ref|YP_034071.1| tryptophanyl-tRNA synthetase [Bartonella henselae str. Houston-1]
 gi|49238838|emb|CAF28120.1| Tryptophanyl-tRNA synthetase [Bartonella henselae str. Houston-1]
          Length = 356

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 183/351 (52%), Positives = 251/351 (71%), Gaps = 5/351 (1%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           L  SGVQP+G LHLGNYLG I++ +  Q + N L  Y + D+HA+T N     LR  +R 
Sbjct: 7   LVFSGVQPSGHLHLGNYLGAIKHWVELQTSYNCL--YCVVDMHALTVNPDPLALRESTRA 64

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A+FLAAG+DP ++IIF QS V  HA+L+WIL+C+AR+GW+  M QFK+K+ +++E+ A
Sbjct: 65  VTAAFLAAGIDPKKHIIFNQSQVFQHAELAWILNCIARIGWLQRMTQFKDKAGKDREK-A 123

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           SLGLF YP LMAADILLYRATHVPVGEDQ+QH+E+TR IAQ+FN ++ ++I ++      
Sbjct: 124 SLGLFAYPSLMAADILLYRATHVPVGEDQKQHVELTRDIAQKFNNDYAQRIVDLNFSVTM 183

Query: 187 E--EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQ 244
           +  E+  + FFP+ + LI  +A R+ SLRD +KKMSKSD SDFSRINL D+ D+IAKKI+
Sbjct: 184 QMGEEKKQVFFPLPKALIGDTAMRVMSLRDGTKKMSKSDPSDFSRINLTDDADLIAKKIR 243

Query: 245 KAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           KAKTD   LP  ++ LE R E  NL+ I+A   QI  E+AL +F G+ FS FK  LAD  
Sbjct: 244 KAKTDSAPLPDTLAALEERPEIDNLLGIYAAFAQISKEKALSEFSGQQFSLFKTTLADLA 303

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLSH 355
           +E++ PI+Q+++ L ++ SY+D++L +GA RA   A++ MK V EIVG  H
Sbjct: 304 VEKLAPITQELRRLHQESSYIDSVLHDGAQRASALAEKNMKKVREIVGFLH 354


>gi|56368464|emb|CAD89515.1| tryptophanyl-tRNA synthetase [Bartonella henselae]
          Length = 356

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 183/351 (52%), Positives = 251/351 (71%), Gaps = 5/351 (1%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           L  SGVQP+G LHLGNYLG I++ +  Q + N L  Y + D+HA+T N     LR  +R 
Sbjct: 7   LVFSGVQPSGHLHLGNYLGAIKHWVELQTSYNCL--YCVVDMHALTVNPDPLALRESTRA 64

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A+FLAAG+DP ++IIF QS V  HA+L+WIL+C+AR+GW+  M QFK+K+ +++E+ A
Sbjct: 65  VTAAFLAAGIDPKKHIIFNQSQVFQHAELAWILNCIARIGWLQRMTQFKDKAGKDREK-A 123

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           SLGLF YP LMAADILLYRATHVPVGEDQ+QH+E+TR IAQ+FN ++ ++I ++      
Sbjct: 124 SLGLFAYPSLMAADILLYRATHVPVGEDQKQHVELTRDIAQKFNNDYAQRIVDLNFSVTM 183

Query: 187 E--EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQ 244
           +  E+  + FFP+ + LI  +A R+ SLRD +KKMSKSD SDFSRINL D+ D+IAKKI+
Sbjct: 184 QMGEEKKQVFFPLPKALIGETAMRVMSLRDGTKKMSKSDPSDFSRINLTDDADLIAKKIR 243

Query: 245 KAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           KAKTD   LP  ++ LE R E  NL+ I+A   QI  E+AL +F G+ FS FK  LAD  
Sbjct: 244 KAKTDSAPLPDTLAALEERPEIDNLLGIYAAFAQISKEKALSEFSGQQFSLFKTTLADLA 303

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLSH 355
           +E++ PI+Q+++ L ++ SY+D++L +GA RA   A++ MK V EIVG  H
Sbjct: 304 VEKLAPITQELRRLHQESSYIDSVLHDGAQRASALAEKNMKKVREIVGFLH 354


>gi|188579638|ref|YP_001923083.1| tryptophanyl-tRNA synthetase [Methylobacterium populi BJ001]
 gi|179343136|gb|ACB78548.1| tryptophanyl-tRNA synthetase [Methylobacterium populi BJ001]
          Length = 353

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 185/353 (52%), Positives = 243/353 (68%), Gaps = 10/353 (2%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENL 60
           M +   L  SGVQPTG LHLGNYLG I+  +  QE      +Y + DLHAIT     + L
Sbjct: 1   MAAFTELVFSGVQPTGNLHLGNYLGAIKRFVEMQERDAQC-LYCVVDLHAITLWQDPQAL 59

Query: 61  RYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKE 120
           + Q R   A+FLAAG+DP R+I+F QS V  HA+L+WI +CVAR+GW+N M QFK+K+ +
Sbjct: 60  KGQIREVTAAFLAAGIDPKRSIVFNQSQVPQHAELAWIFNCVARLGWLNRMTQFKDKAGK 119

Query: 121 NKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEV 180
           ++E  AS+GL+ YPVLMAADIL YRATHVPVGEDQ+QHLE+TR IAQ+FN +F   I  +
Sbjct: 120 DRE-NASIGLYDYPVLMAADILAYRATHVPVGEDQKQHLELTRDIAQKFNNDFAGSI--L 176

Query: 181 AQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIA 240
           A  + ++      FFP+ E LI   A+R+ SLRD +KKMSKSD S++SRINL D+ D IA
Sbjct: 177 AHGHGEQ------FFPLTEPLIGGPAARVMSLRDGTKKMSKSDPSEYSRINLTDDADAIA 230

Query: 241 KKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLAL 300
           +K++KAKTD + LPSE +GL  R EA NL+ IFA +R I  +E LK FGG  FS FK AL
Sbjct: 231 QKVRKAKTDPEPLPSEAAGLAGRPEADNLVGIFAALRGITRDEVLKDFGGAQFSSFKPAL 290

Query: 301 ADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            D  +E + PI  +++ L+ D +Y+DT+L +GA RA   A  T+  V +IVG 
Sbjct: 291 VDLAVEMLAPIGAEMKRLVADPAYIDTVLADGAERAGAIAAPTLDAVKDIVGF 343


>gi|49474594|ref|YP_032636.1| tryptophanyl-tRNA synthetase [Bartonella quintana str. Toulouse]
 gi|49240098|emb|CAF26537.1| Tryptophanyl-tRNA synthetase [Bartonella quintana str. Toulouse]
          Length = 356

 Score =  367 bits (941), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 185/353 (52%), Positives = 249/353 (70%), Gaps = 9/353 (2%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           L  SGVQPTG LHLGNYLG I++ +  Q + N L  Y + D+HA+T N     LR  +R 
Sbjct: 7   LVFSGVQPTGNLHLGNYLGAIKHWVELQMSYNCL--YCVVDMHALTLNPDPLILRESTRA 64

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A+FLAAG+DP + IIF QS V  HA+L+WIL+C+AR+GW+  M QFK+K+ +++E+ A
Sbjct: 65  VTAAFLAAGIDPQKQIIFNQSQVFQHAELAWILNCIARIGWLQRMTQFKDKAGKDREQ-A 123

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKE----VAQ 182
           SLGLF YP LMAADILLYRATHVPVG+DQ+QH+E+TR IAQ+FN ++  +I +    V  
Sbjct: 124 SLGLFAYPSLMAADILLYRATHVPVGDDQKQHVELTRDIAQKFNNDYAHRIADLNFGVCV 183

Query: 183 KYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKK 242
           +  +E++ S  FFPI E LI  +A R+ SLRD +KKMSKSD SDFSRINL D+ D+IAKK
Sbjct: 184 QMGEEKRQS--FFPIPEALIGKTAMRVMSLRDGTKKMSKSDPSDFSRINLTDDADLIAKK 241

Query: 243 IQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALAD 302
           I+KAKTD    P  ++ L+ R E  NL+ I+A   QI  E+AL +F GK FS FK ALAD
Sbjct: 242 IRKAKTDSGAFPDTLTALKGRPEIDNLLGIYAAFAQISKEKALLEFSGKQFSLFKTALAD 301

Query: 303 AVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLSH 355
             + ++ PI+Q+++ L ++ SY+D++L  GA RA   A++ MK + EIVG  H
Sbjct: 302 LAVHKLAPITQELRRLHQENSYIDSVLHNGAERASALAEKNMKKIREIVGFLH 354


>gi|163849746|ref|YP_001637789.1| tryptophanyl-tRNA synthetase [Methylobacterium extorquens PA1]
 gi|218528387|ref|YP_002419203.1| tryptophanyl-tRNA synthetase [Methylobacterium chloromethanicum
           CM4]
 gi|163661351|gb|ABY28718.1| tryptophanyl-tRNA synthetase [Methylobacterium extorquens PA1]
 gi|218520690|gb|ACK81275.1| tryptophanyl-tRNA synthetase [Methylobacterium chloromethanicum
           CM4]
          Length = 353

 Score =  366 bits (940), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 185/356 (51%), Positives = 243/356 (68%), Gaps = 16/356 (4%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIR---RQETCNHLGMYFIADLHAITNNIVQ 57
           M +   L  SGVQPTG LHLGNYLG I+  +    R   C    +Y + DLHAIT     
Sbjct: 1   MAAFTELVFSGVQPTGNLHLGNYLGAIKRFVEMQARDAQC----LYCVVDLHAITMWQDP 56

Query: 58  ENLRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEK 117
           E L+ Q R   A+FLAAG+DP R+I+F QS V  HA+L+WI +CVAR+GW+N M QFK+K
Sbjct: 57  EALKGQIREVTAAFLAAGIDPKRSIVFNQSQVPQHAELAWIFNCVARLGWLNRMTQFKDK 116

Query: 118 SKENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKI 177
           + +++E  AS+GL+ YPVLMAADIL YRATHVPVGEDQ+QHLE+TR IAQ+FN +F   I
Sbjct: 117 AGKDRE-NASIGLYDYPVLMAADILAYRATHVPVGEDQKQHLELTRDIAQKFNNDFAGSI 175

Query: 178 KEVAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPD 237
             +A  + ++      FFPI E LI   A+R+ SLRD +KKMSKSD S++SRI L D+ D
Sbjct: 176 --LAHGHGEQ------FFPITEPLIGGPAARVMSLRDGTKKMSKSDPSEYSRIALTDDAD 227

Query: 238 IIAKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFK 297
            IA+K++KAKTD + LPSEV+GL  R EA NL+ IFA +R I  +E L  FGG  FS FK
Sbjct: 228 AIAQKVRKAKTDPEPLPSEVAGLAGRPEADNLVGIFAALRGITRDEVLADFGGAQFSSFK 287

Query: 298 LALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            AL D  +E + PI  +++ L+ D +Y+D++L +GA+RA   A  T+  V +IVG 
Sbjct: 288 PALVDLAVETLAPIGAEMKRLVADPAYIDSVLGDGASRAEAIAAPTLDAVKDIVGF 343


>gi|254558807|ref|YP_003065902.1| Tryptophanyl tRNA synthetase [Methylobacterium extorquens DM4]
 gi|254266085|emb|CAX21837.1| Tryptophanyl tRNA synthetase [Methylobacterium extorquens DM4]
          Length = 353

 Score =  366 bits (940), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 185/356 (51%), Positives = 242/356 (67%), Gaps = 16/356 (4%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIR---RQETCNHLGMYFIADLHAITNNIVQ 57
           M +   L  SGVQPTG LHLGNYLG I+  +    R   C    +Y + DLHAIT     
Sbjct: 1   MAAFTELVFSGVQPTGNLHLGNYLGAIKRFVEMQARDAQC----LYCVVDLHAITMWQDP 56

Query: 58  ENLRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEK 117
           E L+ Q R   A+FLAAG+DP R+I+F QS V  HA+L+WI +CVAR+GW+N M QFK+K
Sbjct: 57  EALKGQIREVTAAFLAAGIDPKRSIVFNQSQVPQHAELAWIFNCVARLGWLNRMTQFKDK 116

Query: 118 SKENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKI 177
           + +++E  AS+GL+ YPVLMAADIL YRATHVPVGEDQ+QHLE+TR IAQ+FN +F   I
Sbjct: 117 AGKDRE-NASIGLYDYPVLMAADILAYRATHVPVGEDQKQHLELTRDIAQKFNNDFAGSI 175

Query: 178 KEVAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPD 237
             +A  + ++      FFPI E LI   A+R+ SLRD +KKMSKSD S++SRI L D+ D
Sbjct: 176 --LAHGHGEQ------FFPITEPLIGGPAARVMSLRDGTKKMSKSDPSEYSRIALTDDAD 227

Query: 238 IIAKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFK 297
            IA+K++KAKTD + LPSEV+GL  R EA NL+ IFA +R I  +E L  FGG  FS FK
Sbjct: 228 AIAQKVRKAKTDPEPLPSEVAGLAGRPEADNLVGIFAALRGITRDEVLADFGGAQFSSFK 287

Query: 298 LALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            AL D  +E + PI  +++ L+ D +Y+D++L +GA RA   A  T+  V +IVG 
Sbjct: 288 PALVDLAVETLAPIGAEMKRLVADPAYIDSVLGDGAGRAEAIAAPTLDAVKDIVGF 343


>gi|240850978|ref|YP_002972378.1| tryptophanyl-tRNA synthetase [Bartonella grahamii as4aup]
 gi|240268101|gb|ACS51689.1| tryptophanyl-tRNA synthetase [Bartonella grahamii as4aup]
          Length = 356

 Score =  366 bits (940), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 176/351 (50%), Positives = 249/351 (70%), Gaps = 5/351 (1%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           L  SGVQP+G LHLGNYLG I+  +  Q +  H  +Y + D+HA+T N     LR  +R 
Sbjct: 7   LVFSGVQPSGHLHLGNYLGAIQRWVELQNS--HHCLYCVVDMHALTVNPDPLTLRESTRT 64

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A+FLA G+DP ++IIF QS V  HA+L+WI +CVAR+GW+  M QFK+K+ +++E+ A
Sbjct: 65  VTAAFLACGIDPQKHIIFNQSRVFQHAELAWIFNCVARIGWLQRMTQFKDKAGKDREK-A 123

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEV--AQKY 184
           SLGLF YP LMAADIL+YRATHVPVGEDQ+QH+E+TR IAQ+FN ++ ++I E+      
Sbjct: 124 SLGLFAYPTLMAADILVYRATHVPVGEDQKQHVELTRDIAQKFNNDYAQRIAELNFGISM 183

Query: 185 AQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQ 244
             +E+  +GFFP+ E LI ++A+R+ SLRD +KKMSKSD SDFSRINL D+ D+IAKKI+
Sbjct: 184 QTDEEKKQGFFPLPEALIGTTATRVMSLRDGTKKMSKSDPSDFSRINLTDDADLIAKKIR 243

Query: 245 KAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           KAKTD   LP  ++ L+ R E  NL+ I+A   ++  E+ L +F G+ FS FK ALAD  
Sbjct: 244 KAKTDSAPLPDTLTALKERPEVDNLLGIYAAFAKVSKEKILLEFSGQQFSHFKTALADLA 303

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLSH 355
           + ++ PI+++++ L ++  Y+D++L +GA RA   A+E MK + EI+G  H
Sbjct: 304 VHKLAPITEELRRLNQESGYIDSVLHDGAKRASMLAEENMKKIREIIGFLH 354


>gi|92115645|ref|YP_575374.1| tryptophanyl-tRNA synthetase [Nitrobacter hamburgensis X14]
 gi|91798539|gb|ABE60914.1| tryptophanyl-tRNA synthetase [Nitrobacter hamburgensis X14]
          Length = 347

 Score =  365 bits (938), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 181/348 (52%), Positives = 241/348 (69%), Gaps = 15/348 (4%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIV----QENLRYQSR 65
           SGVQPTG LHLGNYLG I N ++ Q   +H  +Y + DLHAIT  +      + LR  +R
Sbjct: 7   SGVQPTGNLHLGNYLGAIVNFVKLQ--ADHQCLYCVVDLHAITVPVAVWGGPDELRRNTR 64

Query: 66  LFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEET 125
              A+F+A+G+DP ++IIF QS V  HA+L+W+ +CVAR+GW+N M QFKEK+ +++E  
Sbjct: 65  EVTAAFIASGIDPKQHIIFNQSQVAGHAELTWVFNCVARLGWLNRMTQFKEKAGKDRE-N 123

Query: 126 ASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYA 185
           AS+GL+ YPVLMA+DILLYRATHVPVGEDQ+QHLE++R IAQ+FN +F   I        
Sbjct: 124 ASIGLYDYPVLMASDILLYRATHVPVGEDQKQHLELSRDIAQKFNNDFSASIAG------ 177

Query: 186 QEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQK 245
               +  GFFP+ E +I   A+R+ SLRD +KKMSKSD SD+SRINL D+ D IA+KI+K
Sbjct: 178 --NGHGDGFFPLPEPVITGPATRVMSLRDGTKKMSKSDPSDYSRINLTDDADTIAQKIRK 235

Query: 246 AKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVI 305
           AKTD + LPSE  GLE+R EA NL+ I+A +      E L QFGG  FS FK  L D  +
Sbjct: 236 AKTDPEPLPSEEKGLESRPEADNLVGIYAALSGKPKPEVLAQFGGAQFSGFKSNLVDLAV 295

Query: 306 EEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            ++ PI+ +++ L  D +Y++ IL+EGA+RAR  A ETM  V +IVG 
Sbjct: 296 AKLSPIAAEMKRLTDDPAYVEGILIEGADRARAIASETMNAVKDIVGF 343


>gi|158425925|ref|YP_001527217.1| tryptophanyl-tRNA synthetase [Azorhizobium caulinodans ORS 571]
 gi|158332814|dbj|BAF90299.1| tryptophanyl-tRNA synthetase [Azorhizobium caulinodans ORS 571]
          Length = 357

 Score =  365 bits (936), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 181/344 (52%), Positives = 238/344 (69%), Gaps = 11/344 (3%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQPTG LHLGNYLG I+  +  QE+  H  +Y + DLHAIT       L+   R   A
Sbjct: 22  SGVQPTGNLHLGNYLGAIKRFVALQES--HECIYCVVDLHAITVWQDPAELKRHIREVTA 79

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           +F+A G+DP R+I+F QS V  HA+L+W+ +CVARMGW+N M QFKEK+ +++E   SLG
Sbjct: 80  AFIACGIDPKRHIVFNQSQVSGHAELAWVFNCVARMGWLNRMTQFKEKAGKDRENV-SLG 138

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LMAADILLYRATHVPVGEDQ+QHLE+TR IAQ+FNT+F   I E          
Sbjct: 139 LFAYPSLMAADILLYRATHVPVGEDQKQHLELTRDIAQKFNTDFGPSIAE--------NG 190

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
           + +G+FP+ E LI   A+R+ SLRD SKKMSKSD+SD SRINL D+ D IA K++KAKTD
Sbjct: 191 FGEGYFPLTEPLIAGPATRVMSLRDGSKKMSKSDASDMSRINLTDDADAIASKVRKAKTD 250

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            + LPSE  GL+ R EA NL+ I+A +     +  L ++GG  FS FK+AL D  + ++ 
Sbjct: 251 PEPLPSEEEGLKARPEADNLVGIYAALSDTTKQAVLTEYGGGQFSTFKMALVDLAVAKLG 310

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PI  ++Q L+ D S +D IL +GA+RAR  A +T++ V +IVG+
Sbjct: 311 PIGGEMQRLMGDVSAIDAILKDGADRARVIADQTIRDVKDIVGM 354


>gi|170751702|ref|YP_001757962.1| tryptophanyl-tRNA synthetase [Methylobacterium radiotolerans JCM
           2831]
 gi|170658224|gb|ACB27279.1| tryptophanyl-tRNA synthetase [Methylobacterium radiotolerans JCM
           2831]
          Length = 354

 Score =  364 bits (935), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 181/353 (51%), Positives = 238/353 (67%), Gaps = 10/353 (2%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENL 60
           M +   L  SGVQPTG LHLGNYLG ++  +  Q+      +Y + DLHAIT     E L
Sbjct: 1   MAAFTELVFSGVQPTGNLHLGNYLGAVKRFVEMQDRDAQC-LYCVVDLHAITVWQDPEAL 59

Query: 61  RYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKE 120
           R Q R   A+FLAAG+DP R+I+F QS V  HA+L+W+ +CVAR+GW+N M QFKEK+ +
Sbjct: 60  RGQIREVTAAFLAAGIDPKRSIVFNQSQVPQHAELAWVFNCVARLGWLNRMTQFKEKAGK 119

Query: 121 NKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEV 180
           ++E  AS+GL+ YPVLMAADIL YRATHVPVGEDQ+QHLE+TR IAQ+FNT+F   I   
Sbjct: 120 DRE-NASIGLYDYPVLMAADILAYRATHVPVGEDQKQHLELTRDIAQKFNTDFSGSITA- 177

Query: 181 AQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIA 240
                    +   FFPI E LI   A+R+ SLRD +KKMSKSD SD +RINL D+ D IA
Sbjct: 178 -------HGHGDAFFPITEPLIGGPAARVMSLRDGTKKMSKSDPSDNARINLTDDADAIA 230

Query: 241 KKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLAL 300
           +KI++AKTD + LPSEV+GL+ R EA NL+ I+A +  I  E+ L+ FGG  FS FK AL
Sbjct: 231 QKIRRAKTDPEPLPSEVAGLKERPEADNLVGIYAALAGITREDVLRDFGGAQFSTFKPAL 290

Query: 301 ADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           AD  +  + PI+ +++ L  D  ++D +L +G  RA   A +T+  V +IVG 
Sbjct: 291 ADLAVTSLAPIAGEMRRLTADPGHIDAVLADGGARAETIAAQTLDAVKDIVGF 343


>gi|312113943|ref|YP_004011539.1| tryptophanyl-tRNA synthetase [Rhodomicrobium vannielii ATCC 17100]
 gi|311219072|gb|ADP70440.1| tryptophanyl-tRNA synthetase [Rhodomicrobium vannielii ATCC 17100]
          Length = 365

 Score =  364 bits (935), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 176/347 (50%), Positives = 243/347 (70%), Gaps = 11/347 (3%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           L  SGVQPTG LHLGNYLG I+N +  Q+  + +  Y + DLHAIT      +L+  +R 
Sbjct: 24  LVFSGVQPTGNLHLGNYLGAIKNFVALQDRTDCI--YCVVDLHAITVAQNPADLKRSTRE 81

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A+F+AAGVDP R+IIF QS V  HA+L+W+L+CVAR+GW+N M QFK+K+ +++E  A
Sbjct: 82  VTAAFIAAGVDPKRHIIFNQSQVSAHAELAWVLNCVARIGWLNRMTQFKDKAGKDRE-NA 140

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           S+GL++YPVLMAADIL YRATHVPVGEDQ+QHLE++R IAQ+FN +F   I         
Sbjct: 141 SVGLYVYPVLMAADILAYRATHVPVGEDQKQHLELSRDIAQKFNKDFAETI--------A 192

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
            E ++ GFFP  E +I   A+R+ SLRD +KKMSKSD SD SRIN+ D+ D IAKKI+KA
Sbjct: 193 AEGFNDGFFPQPEPIISGPATRVMSLRDGTKKMSKSDPSDLSRINVADDADTIAKKIRKA 252

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
           KTD + LP++  G E R EA+NL+ I++ +    +E+ L ++GG  FS FK ALAD  + 
Sbjct: 253 KTDPEPLPTDPKGFEGRPEAENLVGIYSALSGESVEKILAEYGGSQFSAFKNALADLAVA 312

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           ++ PI  +++ +  D +Y+D +L +GA+RA   A ET+++V  IVG 
Sbjct: 313 KLGPIGDEMKRISTDAAYIDAVLADGADRADVIASETLRHVRNIVGF 359


>gi|319409217|emb|CBI82861.1| Tryptophanyl-tRNA synthetase [Bartonella schoenbuchensis R1]
          Length = 368

 Score =  364 bits (934), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 182/371 (49%), Positives = 250/371 (67%), Gaps = 21/371 (5%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQE--TCNHLGMYFIADLHAITNNIVQE 58
           M +  +L  SGVQP+G LHLGNYLG I+  +  Q   TC    +Y + D+HA+T N    
Sbjct: 1   MDTCASLVFSGVQPSGNLHLGNYLGAIKRWVELQASYTC----LYCVVDMHALTVNPDPL 56

Query: 59  NLRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKS 118
            L   +R   A+FLAAG+DP ++I+F QS V  HA+L+WI +C+AR+GW+  M QFK+K+
Sbjct: 57  TLESSTRAVTAAFLAAGIDPQKHIVFNQSRVFQHAELAWIFNCIARIGWLQRMTQFKDKA 116

Query: 119 KENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIK 178
            +N+++ AS+GLF YP LMAADILLYRATHVPVGEDQ+QH+E+TR IAQ+FN ++  +I 
Sbjct: 117 GKNRKQ-ASVGLFAYPSLMAADILLYRATHVPVGEDQKQHIELTRDIAQKFNHDYAERIA 175

Query: 179 EV--------------AQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDS 224
            +               +   + E   +GFFPI E L+  +  RI SLRD +KKMSKSD 
Sbjct: 176 HLNVGIPIQEGEPIKEGEPIKEGENKEQGFFPIPEALLGDTGMRIMSLRDGTKKMSKSDP 235

Query: 225 SDFSRINLLDNPDIIAKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEA 284
           SDFSRINL D+ D+I +KI+KAKTD   LP E++ LE R E  NL+ I+A   QI  E+A
Sbjct: 236 SDFSRINLTDDADLIIQKIRKAKTDSAPLPDELTALEGRPEVDNLLGIYAAFAQISKEKA 295

Query: 285 LKQFGGKNFSQFKLALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETM 344
           L +F G+ FS FK  LAD V+ ++ PI+Q+++ L +D +Y+D++L +GA RA   A+ TM
Sbjct: 296 LLEFSGQQFSLFKATLADLVVHKLAPITQELRRLHQDNAYIDSVLRDGAERASLLAENTM 355

Query: 345 KYVNEIVGLSH 355
           K+V EIVG  H
Sbjct: 356 KHVREIVGFLH 366


>gi|240136954|ref|YP_002961423.1| Tryptophanyl tRNA synthetase [Methylobacterium extorquens AM1]
 gi|19338613|gb|AAL86730.1|AF416776_8 tryptophanyl-tRNA synthetase [Methylobacterium extorquens AM1]
 gi|240006920|gb|ACS38146.1| Tryptophanyl tRNA synthetase [Methylobacterium extorquens AM1]
          Length = 353

 Score =  364 bits (934), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 184/356 (51%), Positives = 242/356 (67%), Gaps = 16/356 (4%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIR---RQETCNHLGMYFIADLHAITNNIVQ 57
           M +   L  SGVQPTG LHLGNYLG I+  +    R   C    +Y + DLHAIT     
Sbjct: 1   MAAFTELVFSGVQPTGNLHLGNYLGAIKRFVEMQARDAQC----LYCVVDLHAITMWQDP 56

Query: 58  ENLRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEK 117
           E L+ Q R   A+FLAAG+DP R+I+F QS V  HA+L+WI +CVAR+GW+N M QFK+K
Sbjct: 57  EALKGQIREVTAAFLAAGIDPKRSIVFNQSQVPQHAELAWIFNCVARLGWLNRMTQFKDK 116

Query: 118 SKENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKI 177
           + +++E  AS+GL+ YPVLMAADIL YRATHVPVGEDQ+QHLE+TR IAQ+FN +F   I
Sbjct: 117 AGKDRE-NASIGLYDYPVLMAADILAYRATHVPVGEDQKQHLELTRDIAQKFNNDFAGSI 175

Query: 178 KEVAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPD 237
             +A  + ++      F PI E LI   A+R+ SLRD +KKMSKSD S++SRI L D+ D
Sbjct: 176 --LAHGHGEQ------FLPITEPLIGGPAARVMSLRDGTKKMSKSDPSEYSRIALTDDAD 227

Query: 238 IIAKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFK 297
            IA+K++KAKTD + LPSEV+GL  R EA NL+ IFA +R I  +E L  FGG  FS FK
Sbjct: 228 AIAQKVRKAKTDPEPLPSEVAGLAGRPEADNLVGIFAALRGITRDEVLADFGGAQFSSFK 287

Query: 298 LALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            AL D  +E + PI  +++ L+ D +Y+D++L +GA+RA   A  T+  V +IVG 
Sbjct: 288 PALVDLAVETLAPIGSEMKRLVADPAYIDSVLGDGASRAEAIAAPTLDAVKDIVGF 343


>gi|163868794|ref|YP_001610018.1| tryptophanyl-tRNA synthetase [Bartonella tribocorum CIP 105476]
 gi|161018465|emb|CAK02023.1| Tryptophanyl-tRNA synthetase [Bartonella tribocorum CIP 105476]
          Length = 356

 Score =  363 bits (933), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 175/349 (50%), Positives = 249/349 (71%), Gaps = 5/349 (1%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           L  SGVQP+G LHLGNYLG +++ +  Q +  H  +Y + D+HA+T N     LR  +R 
Sbjct: 7   LVFSGVQPSGHLHLGNYLGALQHWVELQNS--HHCLYCVVDMHALTVNPDPLILRESTRT 64

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A+FLAAG+DP ++IIF QS V  HA+L+WI +CVAR+GW+  M QFK+K+ +++E+ A
Sbjct: 65  VTAAFLAAGIDPQKHIIFNQSRVFQHAELAWIFNCVARIGWLQRMTQFKDKAGKDREK-A 123

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEV--AQKY 184
           SLGLF YP LMAADIL+YRATHVPVGEDQ+QH+E+TR IAQ+FN ++ ++I ++      
Sbjct: 124 SLGLFAYPTLMAADILVYRATHVPVGEDQKQHVELTRDIAQKFNNDYAQRIADLNFGVSM 183

Query: 185 AQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQ 244
             +E+  +GFFP+ E LI ++A+R+ SLRD +KKMSKSD SDFSRINL D+ D+IAKKI+
Sbjct: 184 QTDEEKRQGFFPLPEALIGTTATRVMSLRDGTKKMSKSDPSDFSRINLTDDADLIAKKIR 243

Query: 245 KAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           KAKTD   LP  ++ L+ R E  NL+ I+A   ++  E+ L +F G  FS FK ALAD  
Sbjct: 244 KAKTDSAPLPDTLAALKERPEVDNLLGIYAAFAKVSKEKVLLEFSGHQFSHFKTALADLA 303

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + ++ PI+++++ L ++  Y+D++L +GA RA   A+E MK + EIVG 
Sbjct: 304 VHKLAPITEELRRLHQESGYIDSVLHDGAKRASMLAEENMKKIREIVGF 352


>gi|209883679|ref|YP_002287536.1| tryptophanyl-tRNA synthetase [Oligotropha carboxidovorans OM5]
 gi|209871875|gb|ACI91671.1| tryptophanyl-tRNA synthetase [Oligotropha carboxidovorans OM5]
          Length = 345

 Score =  363 bits (933), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 180/344 (52%), Positives = 239/344 (69%), Gaps = 11/344 (3%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQPTG LHLGNYLG I N ++ QET  H  +Y + DLHAIT     + L +  R   A
Sbjct: 9   SGVQPTGNLHLGNYLGAIANFVKLQET--HNCIYCVVDLHAITVWQNPDELTHNIREVTA 66

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           +FLA+G+DP ++I+F QS V  HA+L+W+L+CVAR+GW+N M QFKEK+ +++E  AS+G
Sbjct: 67  AFLASGIDPDKHIVFNQSQVAEHAELAWVLNCVARLGWLNRMTQFKEKAGKDRE-NASVG 125

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L+ YP LMAADIL+YRATHVPVGEDQ+QHLE+ R IAQ+FN +F   I          + 
Sbjct: 126 LYAYPNLMAADILVYRATHVPVGEDQKQHLELARDIAQKFNNDFSESIAA--------KG 177

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
           Y   FFP  E LI   A+R+ SLRD SKKMSKSD SD+SRINL D+ D IA+K++KAKTD
Sbjct: 178 YDAKFFPQPEPLITGPATRVMSLRDGSKKMSKSDPSDYSRINLTDDADAIAQKVRKAKTD 237

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            + LPSE  GL+ R EA NL+ I+A +      + L++FGG  FS FK  L D  ++++ 
Sbjct: 238 PEPLPSEEDGLKARPEADNLVGIYAALAGRTKADVLREFGGGQFSTFKSTLVDLSVDKLG 297

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PI  +++ L++D +++D +LV+GA RAR  A ETMK V  IVG 
Sbjct: 298 PIGNEMKRLMQDPAHVDAVLVKGAGRARAIASETMKAVKNIVGF 341


>gi|90421983|ref|YP_530353.1| tryptophanyl-tRNA synthetase [Rhodopseudomonas palustris BisB18]
 gi|90103997|gb|ABD86034.1| tryptophanyl-tRNA synthetase [Rhodopseudomonas palustris BisB18]
          Length = 349

 Score =  363 bits (933), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 180/348 (51%), Positives = 243/348 (69%), Gaps = 15/348 (4%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIV----QENLRYQSR 65
           SGVQPTG LHLGNYLG I N ++ Q+T  H  +Y + DLHA+T  I      + LR  +R
Sbjct: 8   SGVQPTGNLHLGNYLGAIVNFVKLQDT--HNCIYCVVDLHAMTMPISVWGGPDELRRHTR 65

Query: 66  LFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEET 125
              ++F+A+G+DP + IIF QS V  HA+L+W+ +CVAR+GW+N MIQFKEK+ +++E  
Sbjct: 66  EVTSAFIASGIDPKKQIIFNQSQVSEHAELAWVFNCVARLGWLNRMIQFKEKAGKDRE-N 124

Query: 126 ASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYA 185
           AS+GL+ YPVLMA+DIL+YRATHVPVGEDQ+QH+E+TR IAQ+FN +F   I   AQ Y 
Sbjct: 125 ASVGLYDYPVLMASDILVYRATHVPVGEDQKQHMELTRDIAQKFNNDFSASI--AAQGYG 182

Query: 186 QEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQK 245
           +       +FP+ E +I   A+R+ SLRD +KKMSKSD SD+SRINL D+ D IA+KI+K
Sbjct: 183 E------AYFPLPEPVITGPATRVMSLRDGTKKMSKSDPSDYSRINLTDDADAIAQKIRK 236

Query: 246 AKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVI 305
           AKTD + LPSE  GLE R EA NL+ I+A +      E L +FGG  FS FK  L D  +
Sbjct: 237 AKTDPEPLPSEEKGLEPRPEADNLVGIYAALAGKPKSEVLAEFGGAQFSGFKSNLVDLAV 296

Query: 306 EEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            ++ P++ +++ L  D +Y+D +L +GA+RAR  A ETM  V +IVGL
Sbjct: 297 SKLAPLAAEMKRLTADTTYVDQVLADGADRARVIAAETMNAVKDIVGL 344


>gi|256112646|ref|ZP_05453567.1| tryptophanyl-tRNA synthetase [Brucella melitensis bv. 3 str. Ether]
 gi|265994087|ref|ZP_06106644.1| tryptophanyl-tRNA synthetase [Brucella melitensis bv. 3 str. Ether]
 gi|262765068|gb|EEZ10989.1| tryptophanyl-tRNA synthetase [Brucella melitensis bv. 3 str. Ether]
          Length = 355

 Score =  362 bits (929), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 180/351 (51%), Positives = 245/351 (69%), Gaps = 11/351 (3%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQET--CNHLGMYFIADLHAITNNIVQENLRYQS 64
           L  SGVQPTG LHLGNYLG I+  +  Q+T  C    +Y + D+HA+T +     L   +
Sbjct: 7   LVFSGVQPTGNLHLGNYLGAIKRWVEVQKTEEC----IYCVVDMHALTVSPDSVELMQST 62

Query: 65  RLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEE 124
           R   A+FLAAG+DP ++I+F QS V  HA+L+W+ +CVAR+GWM+ M QFK+K+ +++E 
Sbjct: 63  REVTAAFLAAGIDPKKSIVFNQSRVMQHAELAWVFNCVARIGWMSRMTQFKDKAGKDRE- 121

Query: 125 TASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVA--- 181
            ASLGLF YP LMAADILLYRAT VPVGEDQ+QHLE+TR IAQ+FN ++  +I  +    
Sbjct: 122 NASLGLFAYPSLMAADILLYRATAVPVGEDQKQHLELTRDIAQKFNNDYSDRIASLGVGV 181

Query: 182 QKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAK 241
                +EQ S GFFP+ E +I   A RI SLRD +KKMSKSD SD SRINL+D+ D I K
Sbjct: 182 DMKVGDEQVS-GFFPLTEPMISGPAMRIMSLRDGTKKMSKSDPSDLSRINLIDDEDTITK 240

Query: 242 KIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALA 301
           KI+KAKTD D LPSEV GLE R EA NL+ I+A +     E+ LK+FGG+ FS  K +LA
Sbjct: 241 KIRKAKTDSDGLPSEVDGLEGRPEADNLVGIYAALSSTTKEDVLKEFGGRQFSDLKASLA 300

Query: 302 DAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVG 352
           D  +  + PI+ +++ L+ D +++D++L +G  +A   A++TM++V +IVG
Sbjct: 301 DLAVARLSPITHEMRRLVADPAHIDSVLRDGGEQAGAIAEQTMRHVRDIVG 351


>gi|260567219|ref|ZP_05837689.1| tryptophanyl-tRNA synthetase [Brucella suis bv. 4 str. 40]
 gi|260156737|gb|EEW91817.1| tryptophanyl-tRNA synthetase [Brucella suis bv. 4 str. 40]
          Length = 355

 Score =  362 bits (929), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 180/351 (51%), Positives = 245/351 (69%), Gaps = 11/351 (3%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQET--CNHLGMYFIADLHAITNNIVQENLRYQS 64
           L  SGVQPTG LHLGNYLG I+  +  Q+T  C    +Y + D+HA+T +     L   +
Sbjct: 7   LVFSGVQPTGNLHLGNYLGAIKRWVEVQKTEEC----IYCVVDMHALTVSPDPVELMQST 62

Query: 65  RLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEE 124
           R   A+FLAAG+DP ++I+F QS V  HA+L+W+ +CVAR+GWM+ M QFK+K+ +++E 
Sbjct: 63  REITAAFLAAGIDPKKSIVFNQSRVMQHAELAWVFNCVARIGWMSRMTQFKDKAGKDRE- 121

Query: 125 TASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVA--- 181
            ASLGLF YP LMAADILLYRAT VPVGEDQ+QHLE+TR IAQ+FN ++  +I  +    
Sbjct: 122 NASLGLFAYPSLMAADILLYRATAVPVGEDQKQHLELTRDIAQKFNNDYSDRIASLGVGV 181

Query: 182 QKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAK 241
                +EQ S GFFP+ E +I   A RI SLRD +KKMSKSD SD SRINL+D+ D I K
Sbjct: 182 DMKVGDEQVS-GFFPLTEPMISGPAMRIMSLRDGTKKMSKSDPSDLSRINLIDDEDTITK 240

Query: 242 KIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALA 301
           KI+KAKTD D LPSEV GLE R EA NL+ I+A +     E+ LK+FGG+ FS  K +LA
Sbjct: 241 KIRKAKTDSDGLPSEVDGLEGRPEADNLVGIYAALSSTTKEDVLKEFGGRQFSDLKASLA 300

Query: 302 DAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVG 352
           D  +  + PI+ +++ L+ D +++D++L +G  +A   A++TM++V +IVG
Sbjct: 301 DLAVARLSPITHEMRRLVADPAHIDSVLRDGGEQAGAIAEQTMRHVRDIVG 351


>gi|306842570|ref|ZP_07475221.1| tryptophanyl-tRNA synthetase [Brucella sp. BO2]
 gi|306287426|gb|EFM58906.1| tryptophanyl-tRNA synthetase [Brucella sp. BO2]
          Length = 385

 Score =  362 bits (929), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 180/351 (51%), Positives = 245/351 (69%), Gaps = 11/351 (3%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQET--CNHLGMYFIADLHAITNNIVQENLRYQS 64
           L  SGVQPTG LHLGNYLG I+  +  Q+T  C    +Y + D+HA+T +     L   +
Sbjct: 37  LVFSGVQPTGNLHLGNYLGAIKRWVEVQKTEEC----IYCVVDMHALTVSPDPVELMQST 92

Query: 65  RLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEE 124
           R   A+FLAAG+DP ++I+F QS V  HA+L+W+ +CVAR+GWM+ M QFK+K+ +++E 
Sbjct: 93  REVTAAFLAAGIDPKKSIVFNQSRVMQHAELAWVFNCVARIGWMSRMTQFKDKAGKDRE- 151

Query: 125 TASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVA--- 181
            ASLGLF YP LMAADILLYRAT VPVGEDQ+QHLE+TR IAQ+FN ++  +I  +    
Sbjct: 152 NASLGLFAYPSLMAADILLYRATAVPVGEDQKQHLELTRDIAQKFNNDYSDRIASLGVGI 211

Query: 182 QKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAK 241
                +EQ S GFFP+ E +I   A RI SLRD +KKMSKSD SD SRINL+D+ D I K
Sbjct: 212 DMKVGDEQVS-GFFPLTEPMISGPAMRIMSLRDGTKKMSKSDPSDLSRINLIDDEDTITK 270

Query: 242 KIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALA 301
           KI+KAKTD D LPSEV GLE R EA NL+ I+A +     E+ LK+FGG+ FS  K +LA
Sbjct: 271 KIRKAKTDSDGLPSEVGGLEGRPEADNLVGIYAALSSTTKEDVLKEFGGRQFSDLKASLA 330

Query: 302 DAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVG 352
           D  +  + PI+ +++ L+ D +++D++L +G  +A   A++TM++V +IVG
Sbjct: 331 DLAVARLSPITHEMRRLVADPAHIDSVLRDGGEQAGAIAEQTMRHVRDIVG 381


>gi|306844411|ref|ZP_07477001.1| tryptophanyl-tRNA synthetase [Brucella sp. BO1]
 gi|306275224|gb|EFM56974.1| tryptophanyl-tRNA synthetase [Brucella sp. BO1]
          Length = 355

 Score =  362 bits (929), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 180/351 (51%), Positives = 245/351 (69%), Gaps = 11/351 (3%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQET--CNHLGMYFIADLHAITNNIVQENLRYQS 64
           L  SGVQPTG LHLGNYLG I+  +  Q+T  C    +Y + D+HA+T +     L   +
Sbjct: 7   LVFSGVQPTGNLHLGNYLGAIKRWVEVQKTEEC----IYCVVDMHALTVSPDPVELMQST 62

Query: 65  RLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEE 124
           R   A+FLAAG+DP ++I+F QS V  HA+L+W+ +CVAR+GWM+ M QFK+K+ +++E 
Sbjct: 63  REVTAAFLAAGIDPKKSIVFNQSRVMQHAELAWVFNCVARIGWMSRMTQFKDKAGKDRE- 121

Query: 125 TASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVA--- 181
            ASLGLF YP LMAADILLYRAT VPVGEDQ+QHLE+TR IAQ+FN ++  +I  +    
Sbjct: 122 NASLGLFAYPSLMAADILLYRATAVPVGEDQKQHLELTRDIAQKFNNDYSDRIASLGVGV 181

Query: 182 QKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAK 241
                +EQ S GFFP+ E +I   A RI SLRD +KKMSKSD SD SRINL+D+ D I K
Sbjct: 182 DMKVGDEQVS-GFFPLTEPMISGPAMRIMSLRDGTKKMSKSDPSDLSRINLIDDEDTITK 240

Query: 242 KIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALA 301
           KI+KAKTD D LPSEV GLE R EA NL+ I+A +     E+ LK+FGG+ FS  K +LA
Sbjct: 241 KIRKAKTDSDGLPSEVGGLEGRPEADNLVGIYAALSSTTKEDVLKEFGGRQFSDLKASLA 300

Query: 302 DAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVG 352
           D  +  + PI+ +++ L+ D +++D++L +G  +A   A++TM++V +IVG
Sbjct: 301 DLAVARLSPITHEMRRLVADPAHIDSVLRDGGEQAGAIAEQTMRHVRDIVG 351


>gi|153007500|ref|YP_001368715.1| tryptophanyl-tRNA synthetase [Ochrobactrum anthropi ATCC 49188]
 gi|151559388|gb|ABS12886.1| tryptophanyl-tRNA synthetase [Ochrobactrum anthropi ATCC 49188]
          Length = 355

 Score =  362 bits (929), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 179/351 (50%), Positives = 246/351 (70%), Gaps = 11/351 (3%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQET--CNHLGMYFIADLHAITNNIVQENLRYQS 64
           L  SGVQPTG LHLGNYLG I+  +  QET  C    +Y + D+HA+T +     L   +
Sbjct: 7   LVFSGVQPTGNLHLGNYLGAIKRWVEVQETQEC----IYCVVDMHALTISPDPAELMQST 62

Query: 65  RLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEE 124
           R   A+FLAAG+DP R+I+F QS V  HA+L+W+ +C+AR+GWM+ M QFK+K+ +++E 
Sbjct: 63  REVTAAFLAAGIDPKRSIVFNQSRVMQHAELAWVFNCIARIGWMSRMTQFKDKAGKDRE- 121

Query: 125 TASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVA--- 181
            ASLGLF YP LMAADILLYRAT VPVGEDQ+QHLE+TR IAQ+FN ++  +I  +    
Sbjct: 122 NASLGLFAYPSLMAADILLYRATAVPVGEDQKQHLELTRDIAQKFNNDYSDRIASLGVGV 181

Query: 182 QKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAK 241
                +EQ S GFFP+ E +I   A RI SLRD +KKMSKSD SD SRINL+D+ + I K
Sbjct: 182 DMQVGDEQVS-GFFPMTEPMISGPAMRIMSLRDGTKKMSKSDPSDLSRINLIDDEETITK 240

Query: 242 KIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALA 301
           KI+KAKTD D LP+E+ GL  R EA NL+ I+A +     E+ L +FGG+ FS+FK +LA
Sbjct: 241 KIRKAKTDSDGLPTELDGLAGRPEADNLVGIYAALSSQSKEDVLNEFGGRQFSEFKASLA 300

Query: 302 DAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVG 352
           D  + ++ PI+ +++ L+ D +Y+D++L +G  RA   A++TM++V +IVG
Sbjct: 301 DLAVAKLSPITHEMRRLVADPAYIDSVLRDGGERAGVIAEQTMRHVRDIVG 351


>gi|225851677|ref|YP_002731910.1| tryptophanyl-tRNA synthetase [Brucella melitensis ATCC 23457]
 gi|17983840|gb|AAL52987.1| tryptophanyl-tRNA synthetase [Brucella melitensis bv. 1 str. 16M]
 gi|225640042|gb|ACN99955.1| tryptophanyl-tRNA synthetase [Brucella melitensis ATCC 23457]
 gi|326408163|gb|ADZ65228.1| tryptophanyl-tRNA synthetase [Brucella melitensis M28]
          Length = 385

 Score =  362 bits (929), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 180/351 (51%), Positives = 245/351 (69%), Gaps = 11/351 (3%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQET--CNHLGMYFIADLHAITNNIVQENLRYQS 64
           L  SGVQPTG LHLGNYLG I+  +  Q+T  C    +Y + D+HA+T +     L   +
Sbjct: 37  LVFSGVQPTGNLHLGNYLGAIKRWVEVQKTEEC----IYCVVDMHALTVSPDPVELMQST 92

Query: 65  RLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEE 124
           R   A+FLAAG+DP ++I+F QS V  HA+L+W+ +CVAR+GWM+ M QFK+K+ +++E 
Sbjct: 93  REVTAAFLAAGIDPKKSIVFNQSRVMQHAELAWVFNCVARIGWMSRMTQFKDKAGKDRE- 151

Query: 125 TASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVA--- 181
            ASLGLF YP LMAADILLYRAT VPVGEDQ+QHLE+TR IAQ+FN ++  +I  +    
Sbjct: 152 NASLGLFAYPSLMAADILLYRATAVPVGEDQKQHLELTRDIAQKFNNDYSDRIASLGVGV 211

Query: 182 QKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAK 241
                +EQ S GFFP+ E +I   A RI SLRD +KKMSKSD SD SRINL+D+ D I K
Sbjct: 212 DMKVGDEQVS-GFFPLTEPMISGPAMRIMSLRDGTKKMSKSDPSDLSRINLIDDEDTITK 270

Query: 242 KIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALA 301
           KI+KAKTD D LPSEV GLE R EA NL+ I+A +     E+ LK+FGG+ FS  K +LA
Sbjct: 271 KIRKAKTDSDGLPSEVDGLEGRPEADNLVGIYAALSSTTKEDVLKEFGGRQFSDLKASLA 330

Query: 302 DAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVG 352
           D  +  + PI+ +++ L+ D +++D++L +G  +A   A++TM++V +IVG
Sbjct: 331 DLAVARLSPITHEMRRLVADPAHIDSVLRDGGEQAGAIAEQTMRHVRDIVG 381


>gi|161611216|ref|YP_220913.2| tryptophanyl-tRNA synthetase [Brucella abortus bv. 1 str. 9-941]
 gi|162002879|ref|YP_413633.2| tryptophanyl-tRNA synthetase [Brucella melitensis biovar Abortus
           2308]
 gi|189023395|ref|YP_001934163.1| tryptophanyl-tRNA synthetase [Brucella abortus S19]
 gi|254731479|ref|ZP_05190057.1| tryptophanyl-tRNA synthetase [Brucella abortus bv. 4 str. 292]
 gi|260546417|ref|ZP_05822157.1| tryptophanyl-tRNA synthetase [Brucella abortus NCTC 8038]
 gi|260755998|ref|ZP_05868346.1| tryptophanyl-tRNA synthetase [Brucella abortus bv. 6 str. 870]
 gi|260759222|ref|ZP_05871570.1| tryptophanyl-tRNA synthetase [Brucella abortus bv. 4 str. 292]
 gi|260760944|ref|ZP_05873287.1| tryptophanyl-tRNA synthetase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260885018|ref|ZP_05896632.1| tryptophanyl-tRNA synthetase [Brucella abortus bv. 9 str. C68]
 gi|261215274|ref|ZP_05929555.1| tryptophanyl-tRNA synthetase [Brucella abortus bv. 3 str. Tulya]
 gi|189018967|gb|ACD71689.1| tryptophanyl-tRNA synthetase [Brucella abortus S19]
 gi|260096524|gb|EEW80400.1| tryptophanyl-tRNA synthetase [Brucella abortus NCTC 8038]
 gi|260669540|gb|EEX56480.1| tryptophanyl-tRNA synthetase [Brucella abortus bv. 4 str. 292]
 gi|260671376|gb|EEX58197.1| tryptophanyl-tRNA synthetase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260676106|gb|EEX62927.1| tryptophanyl-tRNA synthetase [Brucella abortus bv. 6 str. 870]
 gi|260874546|gb|EEX81615.1| tryptophanyl-tRNA synthetase [Brucella abortus bv. 9 str. C68]
 gi|260916881|gb|EEX83742.1| tryptophanyl-tRNA synthetase [Brucella abortus bv. 3 str. Tulya]
          Length = 355

 Score =  362 bits (929), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 180/351 (51%), Positives = 245/351 (69%), Gaps = 11/351 (3%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQET--CNHLGMYFIADLHAITNNIVQENLRYQS 64
           L  SGVQPTG LHLGNYLG I+  +  Q+T  C    +Y + D+HA+T +     L   +
Sbjct: 7   LVFSGVQPTGNLHLGNYLGAIKRWVEVQKTEEC----IYCVVDMHALTVSPDPVELMQST 62

Query: 65  RLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEE 124
           R   A+FLAAG+DP ++I+F QS V  HA+L+W+ +CVAR+GWM+ M QFK+K+ +++E 
Sbjct: 63  REVTAAFLAAGIDPKKSIVFNQSRVMQHAELAWVFNCVARIGWMSRMTQFKDKAGKDRE- 121

Query: 125 TASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVA--- 181
            ASLGLF YP LMAADILLYRAT VPVGEDQ+QHLE+TR IAQ+FN ++  +I  +    
Sbjct: 122 NASLGLFAYPSLMAADILLYRATAVPVGEDQKQHLELTRDIAQKFNNDYSDRIASLGVGV 181

Query: 182 QKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAK 241
                +EQ S GFFP+ E +I   A RI SLRD +KKMSKSD SD SRINL+D+ D I K
Sbjct: 182 DMIVGDEQVS-GFFPLTEPMISGPAMRIMSLRDGAKKMSKSDPSDLSRINLIDDEDTITK 240

Query: 242 KIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALA 301
           KI+KAKTD D LPSEV GLE R EA NL+ I+A +     E+ LK+FGG+ FS  K +LA
Sbjct: 241 KIRKAKTDSDGLPSEVDGLEGRPEADNLVGIYAALSSTTKEDVLKEFGGRQFSDLKASLA 300

Query: 302 DAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVG 352
           D  +  + PI+ +++ L+ D +++D++L +G  +A   A++TM++V +IVG
Sbjct: 301 DLAVARLSPITHEMRRLVADPAHIDSVLRDGGEQAGAIAEQTMRHVRDIVG 351


>gi|237814611|ref|ZP_04593609.1| tryptophanyl-tRNA synthetase [Brucella abortus str. 2308 A]
 gi|254690446|ref|ZP_05153700.1| tryptophanyl-tRNA synthetase [Brucella abortus bv. 6 str. 870]
 gi|254694936|ref|ZP_05156764.1| tryptophanyl-tRNA synthetase [Brucella abortus bv. 3 str. Tulya]
 gi|254696566|ref|ZP_05158394.1| tryptophanyl-tRNA synthetase [Brucella abortus bv. 2 str. 86/8/59]
 gi|256258702|ref|ZP_05464238.1| tryptophanyl-tRNA synthetase [Brucella abortus bv. 9 str. C68]
 gi|297247536|ref|ZP_06931254.1| tryptophanyl-tRNA synthetase [Brucella abortus bv. 5 str. B3196]
 gi|62195252|gb|AAX73552.1| TrpS, tryptophanyl-tRNA synthetase [Brucella abortus bv. 1 str.
           9-941]
 gi|82615160|emb|CAJ10097.1| Aminoacyl-tRNA synthetase, class I:Aminoacyl-tRNA synthetase, class
           Ib:Tryptophanyl-tRNA synthetase, class Ib [Brucella
           melitensis biovar Abortus 2308]
 gi|237789448|gb|EEP63658.1| tryptophanyl-tRNA synthetase [Brucella abortus str. 2308 A]
 gi|297174705|gb|EFH34052.1| tryptophanyl-tRNA synthetase [Brucella abortus bv. 5 str. B3196]
          Length = 385

 Score =  362 bits (929), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 180/351 (51%), Positives = 245/351 (69%), Gaps = 11/351 (3%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQET--CNHLGMYFIADLHAITNNIVQENLRYQS 64
           L  SGVQPTG LHLGNYLG I+  +  Q+T  C    +Y + D+HA+T +     L   +
Sbjct: 37  LVFSGVQPTGNLHLGNYLGAIKRWVEVQKTEEC----IYCVVDMHALTVSPDPVELMQST 92

Query: 65  RLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEE 124
           R   A+FLAAG+DP ++I+F QS V  HA+L+W+ +CVAR+GWM+ M QFK+K+ +++E 
Sbjct: 93  REVTAAFLAAGIDPKKSIVFNQSRVMQHAELAWVFNCVARIGWMSRMTQFKDKAGKDRE- 151

Query: 125 TASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVA--- 181
            ASLGLF YP LMAADILLYRAT VPVGEDQ+QHLE+TR IAQ+FN ++  +I  +    
Sbjct: 152 NASLGLFAYPSLMAADILLYRATAVPVGEDQKQHLELTRDIAQKFNNDYSDRIASLGVGV 211

Query: 182 QKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAK 241
                +EQ S GFFP+ E +I   A RI SLRD +KKMSKSD SD SRINL+D+ D I K
Sbjct: 212 DMIVGDEQVS-GFFPLTEPMISGPAMRIMSLRDGAKKMSKSDPSDLSRINLIDDEDTITK 270

Query: 242 KIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALA 301
           KI+KAKTD D LPSEV GLE R EA NL+ I+A +     E+ LK+FGG+ FS  K +LA
Sbjct: 271 KIRKAKTDSDGLPSEVDGLEGRPEADNLVGIYAALSSTTKEDVLKEFGGRQFSDLKASLA 330

Query: 302 DAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVG 352
           D  +  + PI+ +++ L+ D +++D++L +G  +A   A++TM++V +IVG
Sbjct: 331 DLAVARLSPITHEMRRLVADPAHIDSVLRDGGEQAGAIAEQTMRHVRDIVG 381


>gi|148559638|ref|YP_001258175.1| tryptophanyl-tRNA synthetase [Brucella ovis ATCC 25840]
 gi|161486701|ref|NP_697181.2| tryptophanyl-tRNA synthetase [Brucella suis 1330]
 gi|161511122|ref|NP_540723.2| tryptophanyl-tRNA synthetase [Brucella melitensis bv. 1 str. 16M]
 gi|256045933|ref|ZP_05448805.1| tryptophanyl-tRNA synthetase [Brucella melitensis bv. 1 str. Rev.1]
 gi|256158839|ref|ZP_05456696.1| tryptophanyl-tRNA synthetase [Brucella ceti M490/95/1]
 gi|260563215|ref|ZP_05833701.1| tryptophanyl-tRNA synthetase [Brucella melitensis bv. 1 str. 16M]
 gi|261218144|ref|ZP_05932425.1| tryptophanyl-tRNA synthetase [Brucella ceti M13/05/1]
 gi|261221370|ref|ZP_05935651.1| tryptophanyl-tRNA synthetase [Brucella ceti B1/94]
 gi|261314642|ref|ZP_05953839.1| tryptophanyl-tRNA synthetase [Brucella pinnipedialis M163/99/10]
 gi|261321009|ref|ZP_05960206.1| tryptophanyl-tRNA synthetase [Brucella ceti M644/93/1]
 gi|261324256|ref|ZP_05963453.1| tryptophanyl-tRNA synthetase [Brucella neotomae 5K33]
 gi|261751470|ref|ZP_05995179.1| tryptophanyl-tRNA synthetase [Brucella suis bv. 5 str. 513]
 gi|261756032|ref|ZP_05999741.1| tryptophanyl-tRNA synthetase [Brucella suis bv. 3 str. 686]
 gi|261759257|ref|ZP_06002966.1| tryptophanyl-tRNA synthetase [Brucella sp. F5/99]
 gi|265992344|ref|ZP_06104901.1| tryptophanyl-tRNA synthetase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265997330|ref|ZP_06109887.1| tryptophanyl-tRNA synthetase [Brucella ceti M490/95/1]
 gi|265999669|ref|ZP_05467345.2| tryptophanyl-tRNA synthetase [Brucella melitensis bv. 2 str. 63/9]
 gi|294851542|ref|ZP_06792215.1| tryptophanyl-tRNA synthetase [Brucella sp. NVSL 07-0026]
 gi|54039694|sp|P67587|SYW_BRUSU RecName: Full=Tryptophanyl-tRNA synthetase; AltName:
           Full=Tryptophan--tRNA ligase; Short=TrpRS
 gi|54042051|sp|P67586|SYW_BRUME RecName: Full=Tryptophanyl-tRNA synthetase; AltName:
           Full=Tryptophan--tRNA ligase; Short=TrpRS
 gi|148370895|gb|ABQ60874.1| tryptophanyl-tRNA synthetase [Brucella ovis ATCC 25840]
 gi|260153231|gb|EEW88323.1| tryptophanyl-tRNA synthetase [Brucella melitensis bv. 1 str. 16M]
 gi|260919954|gb|EEX86607.1| tryptophanyl-tRNA synthetase [Brucella ceti B1/94]
 gi|260923233|gb|EEX89801.1| tryptophanyl-tRNA synthetase [Brucella ceti M13/05/1]
 gi|261293699|gb|EEX97195.1| tryptophanyl-tRNA synthetase [Brucella ceti M644/93/1]
 gi|261300236|gb|EEY03733.1| tryptophanyl-tRNA synthetase [Brucella neotomae 5K33]
 gi|261303668|gb|EEY07165.1| tryptophanyl-tRNA synthetase [Brucella pinnipedialis M163/99/10]
 gi|261739241|gb|EEY27237.1| tryptophanyl-tRNA synthetase [Brucella sp. F5/99]
 gi|261741223|gb|EEY29149.1| tryptophanyl-tRNA synthetase [Brucella suis bv. 5 str. 513]
 gi|261745785|gb|EEY33711.1| tryptophanyl-tRNA synthetase [Brucella suis bv. 3 str. 686]
 gi|262551798|gb|EEZ07788.1| tryptophanyl-tRNA synthetase [Brucella ceti M490/95/1]
 gi|263003410|gb|EEZ15703.1| tryptophanyl-tRNA synthetase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263095223|gb|EEZ18892.1| tryptophanyl-tRNA synthetase [Brucella melitensis bv. 2 str. 63/9]
 gi|294820131|gb|EFG37130.1| tryptophanyl-tRNA synthetase [Brucella sp. NVSL 07-0026]
 gi|326537873|gb|ADZ86088.1| tryptophanyl-tRNA synthetase [Brucella melitensis M5-90]
          Length = 355

 Score =  362 bits (929), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 180/351 (51%), Positives = 245/351 (69%), Gaps = 11/351 (3%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQET--CNHLGMYFIADLHAITNNIVQENLRYQS 64
           L  SGVQPTG LHLGNYLG I+  +  Q+T  C    +Y + D+HA+T +     L   +
Sbjct: 7   LVFSGVQPTGNLHLGNYLGAIKRWVEVQKTEEC----IYCVVDMHALTVSPDPVELMQST 62

Query: 65  RLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEE 124
           R   A+FLAAG+DP ++I+F QS V  HA+L+W+ +CVAR+GWM+ M QFK+K+ +++E 
Sbjct: 63  REVTAAFLAAGIDPKKSIVFNQSRVMQHAELAWVFNCVARIGWMSRMTQFKDKAGKDRE- 121

Query: 125 TASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVA--- 181
            ASLGLF YP LMAADILLYRAT VPVGEDQ+QHLE+TR IAQ+FN ++  +I  +    
Sbjct: 122 NASLGLFAYPSLMAADILLYRATAVPVGEDQKQHLELTRDIAQKFNNDYSDRIASLGVGV 181

Query: 182 QKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAK 241
                +EQ S GFFP+ E +I   A RI SLRD +KKMSKSD SD SRINL+D+ D I K
Sbjct: 182 DMKVGDEQVS-GFFPLTEPMISGPAMRIMSLRDGTKKMSKSDPSDLSRINLIDDEDTITK 240

Query: 242 KIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALA 301
           KI+KAKTD D LPSEV GLE R EA NL+ I+A +     E+ LK+FGG+ FS  K +LA
Sbjct: 241 KIRKAKTDSDGLPSEVDGLEGRPEADNLVGIYAALSSTTKEDVLKEFGGRQFSDLKASLA 300

Query: 302 DAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVG 352
           D  +  + PI+ +++ L+ D +++D++L +G  +A   A++TM++V +IVG
Sbjct: 301 DLAVARLSPITHEMRRLVADPAHIDSVLRDGGEQAGAIAEQTMRHVRDIVG 351


>gi|161618131|ref|YP_001592018.1| tryptophanyl-tRNA synthetase [Brucella canis ATCC 23365]
 gi|163842413|ref|YP_001626817.1| tryptophanyl-tRNA synthetase [Brucella suis ATCC 23445]
 gi|225626682|ref|ZP_03784721.1| tryptophanyl-tRNA synthetase [Brucella ceti str. Cudo]
 gi|254700951|ref|ZP_05162779.1| tryptophanyl-tRNA synthetase [Brucella suis bv. 5 str. 513]
 gi|254705320|ref|ZP_05167148.1| tryptophanyl-tRNA synthetase [Brucella suis bv. 3 str. 686]
 gi|254707166|ref|ZP_05168994.1| tryptophanyl-tRNA synthetase [Brucella pinnipedialis M163/99/10]
 gi|254713286|ref|ZP_05175097.1| tryptophanyl-tRNA synthetase [Brucella ceti M644/93/1]
 gi|254716361|ref|ZP_05178172.1| tryptophanyl-tRNA synthetase [Brucella ceti M13/05/1]
 gi|256060284|ref|ZP_05450457.1| tryptophanyl-tRNA synthetase [Brucella neotomae 5K33]
 gi|256254220|ref|ZP_05459756.1| tryptophanyl-tRNA synthetase [Brucella ceti B1/94]
 gi|256368606|ref|YP_003106112.1| tryptophanyl-tRNA synthetase [Brucella microti CCM 4915]
 gi|260169718|ref|ZP_05756529.1| tryptophanyl-tRNA synthetase [Brucella sp. F5/99]
 gi|23346920|gb|AAN29096.1| tryptophanyl-tRNA synthetase [Brucella suis 1330]
 gi|161334942|gb|ABX61247.1| tryptophanyl-tRNA synthetase [Brucella canis ATCC 23365]
 gi|163673136|gb|ABY37247.1| tryptophanyl-tRNA synthetase [Brucella suis ATCC 23445]
 gi|225618339|gb|EEH15382.1| tryptophanyl-tRNA synthetase [Brucella ceti str. Cudo]
 gi|255998764|gb|ACU47163.1| tryptophanyl-tRNA synthetase [Brucella microti CCM 4915]
          Length = 385

 Score =  362 bits (929), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 180/351 (51%), Positives = 245/351 (69%), Gaps = 11/351 (3%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQET--CNHLGMYFIADLHAITNNIVQENLRYQS 64
           L  SGVQPTG LHLGNYLG I+  +  Q+T  C    +Y + D+HA+T +     L   +
Sbjct: 37  LVFSGVQPTGNLHLGNYLGAIKRWVEVQKTEEC----IYCVVDMHALTVSPDPVELMQST 92

Query: 65  RLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEE 124
           R   A+FLAAG+DP ++I+F QS V  HA+L+W+ +CVAR+GWM+ M QFK+K+ +++E 
Sbjct: 93  REVTAAFLAAGIDPKKSIVFNQSRVMQHAELAWVFNCVARIGWMSRMTQFKDKAGKDRE- 151

Query: 125 TASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVA--- 181
            ASLGLF YP LMAADILLYRAT VPVGEDQ+QHLE+TR IAQ+FN ++  +I  +    
Sbjct: 152 NASLGLFAYPSLMAADILLYRATAVPVGEDQKQHLELTRDIAQKFNNDYSDRIASLGVGV 211

Query: 182 QKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAK 241
                +EQ S GFFP+ E +I   A RI SLRD +KKMSKSD SD SRINL+D+ D I K
Sbjct: 212 DMKVGDEQVS-GFFPLTEPMISGPAMRIMSLRDGTKKMSKSDPSDLSRINLIDDEDTITK 270

Query: 242 KIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALA 301
           KI+KAKTD D LPSEV GLE R EA NL+ I+A +     E+ LK+FGG+ FS  K +LA
Sbjct: 271 KIRKAKTDSDGLPSEVDGLEGRPEADNLVGIYAALSSTTKEDVLKEFGGRQFSDLKASLA 330

Query: 302 DAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVG 352
           D  +  + PI+ +++ L+ D +++D++L +G  +A   A++TM++V +IVG
Sbjct: 331 DLAVARLSPITHEMRRLVADPAHIDSVLRDGGEQAGAIAEQTMRHVRDIVG 381


>gi|91681187|gb|ABE37489.1| tryptophanyl-tRNA synthetase [Rhodopseudomonas palustris BisB5]
          Length = 369

 Score =  362 bits (928), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 180/348 (51%), Positives = 243/348 (69%), Gaps = 15/348 (4%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIV----QENLRYQSR 65
           SGVQPTG LHLGNYLG I N ++ QET  H  +Y + DLHAIT  +      + LR  +R
Sbjct: 29  SGVQPTGNLHLGNYLGAIVNFVKLQET--HNCIYCVVDLHAITVPVTVWGGPDELRRNTR 86

Query: 66  LFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEET 125
              A+F+AAG+DP+++IIF QS V  HA+L+W+ +CVAR+GW+N M QFKEK+ +++E  
Sbjct: 87  EVTAAFIAAGIDPNKHIIFNQSQVAEHAELAWVFNCVARLGWLNRMTQFKEKAGKDRE-N 145

Query: 126 ASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYA 185
           AS+GL+ YPVLMA+DIL+YRATHVPVGEDQ+QHLE+TR IAQ+FN +F   I   AQ   
Sbjct: 146 ASIGLYDYPVLMASDILVYRATHVPVGEDQKQHLELTRDIAQKFNNDFAESI--AAQGLG 203

Query: 186 QEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQK 245
                   +FP+ E +I   A+R+ SLRD +KKMSKSD SD+SRINL D+ D IA+KI+K
Sbjct: 204 DS------YFPMPEPVITGPATRVMSLRDGTKKMSKSDPSDYSRINLTDDADAIAQKIRK 257

Query: 246 AKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVI 305
           AKTD + LPSE  GLE R EA NL+ I+A +      + L +FGG  FS FK +L D  +
Sbjct: 258 AKTDPEPLPSEEKGLETRPEADNLVGIYAALAGKPKTDVLAEFGGAQFSAFKSSLVDLAV 317

Query: 306 EEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           E++ PI+ +++ L  D  Y+D++L  G++RAR  A ETM  V +I+G+
Sbjct: 318 EKLSPIAGEMKRLSADHGYVDSVLASGSDRARVIAAETMVGVKDIMGM 365


>gi|254718359|ref|ZP_05180170.1| tryptophanyl-tRNA synthetase [Brucella sp. 83/13]
          Length = 385

 Score =  361 bits (927), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 180/351 (51%), Positives = 245/351 (69%), Gaps = 11/351 (3%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQET--CNHLGMYFIADLHAITNNIVQENLRYQS 64
           L  SGVQPTG LHLGNYLG I+  +  Q+T  C    +Y + D+HA+T +     L   +
Sbjct: 37  LVFSGVQPTGNLHLGNYLGAIKRWVEVQKTEEC----IYCVVDMHALTVSPDPVELMQST 92

Query: 65  RLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEE 124
           R   A+FLAAG+DP ++I+F QS V  HA+L+W+ +CVAR+GWM+ M QFK+K+ +++E 
Sbjct: 93  REVTAAFLAAGIDPKKSIVFNQSRVMQHAELAWVFNCVARIGWMSRMTQFKDKAGKDRE- 151

Query: 125 TASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVA--- 181
            ASLGLF YP LMAADILLYRAT VPVGEDQ+QHLE+TR IAQ+FN ++  +I  +    
Sbjct: 152 NASLGLFAYPSLMAADILLYRATAVPVGEDQKQHLELTRDIAQKFNNDYSDRIASLGVGV 211

Query: 182 QKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAK 241
                +EQ S GFFP+ E +I   A RI SLRD +KKMSKSD SD SRINL+D+ D I K
Sbjct: 212 DMKVGDEQVS-GFFPLTELMISGPAMRIMSLRDGTKKMSKSDPSDLSRINLIDDEDTITK 270

Query: 242 KIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALA 301
           KI+KAKTD D LPSEV GLE R EA NL+ I+A +     E+ LK+FGG+ FS  K +LA
Sbjct: 271 KIRKAKTDSDGLPSEVDGLEGRPEADNLVGIYAALSSTTKEDVLKEFGGRQFSDLKASLA 330

Query: 302 DAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVG 352
           D  +  + PI+ +++ L+ D +++D++L +G  +A   A++TM++V +IVG
Sbjct: 331 DLAVARLSPITHEMRRLVADPAHIDSVLRDGGEQAGAIAEQTMRHVRDIVG 381


>gi|162138292|ref|YP_567390.2| tryptophanyl-tRNA synthetase [Rhodopseudomonas palustris BisB5]
          Length = 348

 Score =  361 bits (927), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 180/348 (51%), Positives = 243/348 (69%), Gaps = 15/348 (4%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIV----QENLRYQSR 65
           SGVQPTG LHLGNYLG I N ++ QET  H  +Y + DLHAIT  +      + LR  +R
Sbjct: 8   SGVQPTGNLHLGNYLGAIVNFVKLQET--HNCIYCVVDLHAITVPVTVWGGPDELRRNTR 65

Query: 66  LFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEET 125
              A+F+AAG+DP+++IIF QS V  HA+L+W+ +CVAR+GW+N M QFKEK+ +++E  
Sbjct: 66  EVTAAFIAAGIDPNKHIIFNQSQVAEHAELAWVFNCVARLGWLNRMTQFKEKAGKDRE-N 124

Query: 126 ASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYA 185
           AS+GL+ YPVLMA+DIL+YRATHVPVGEDQ+QHLE+TR IAQ+FN +F   I   AQ   
Sbjct: 125 ASIGLYDYPVLMASDILVYRATHVPVGEDQKQHLELTRDIAQKFNNDFAESI--AAQGLG 182

Query: 186 QEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQK 245
                   +FP+ E +I   A+R+ SLRD +KKMSKSD SD+SRINL D+ D IA+KI+K
Sbjct: 183 DS------YFPMPEPVITGPATRVMSLRDGTKKMSKSDPSDYSRINLTDDADAIAQKIRK 236

Query: 246 AKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVI 305
           AKTD + LPSE  GLE R EA NL+ I+A +      + L +FGG  FS FK +L D  +
Sbjct: 237 AKTDPEPLPSEEKGLETRPEADNLVGIYAALAGKPKTDVLAEFGGAQFSAFKSSLVDLAV 296

Query: 306 EEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           E++ PI+ +++ L  D  Y+D++L  G++RAR  A ETM  V +I+G+
Sbjct: 297 EKLSPIAGEMKRLSADHGYVDSVLASGSDRARVIAAETMVGVKDIMGM 344


>gi|254709291|ref|ZP_05171102.1| tryptophanyl-tRNA synthetase [Brucella pinnipedialis B2/94]
 gi|256030814|ref|ZP_05444428.1| tryptophanyl-tRNA synthetase [Brucella pinnipedialis M292/94/1]
          Length = 385

 Score =  361 bits (926), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 180/351 (51%), Positives = 244/351 (69%), Gaps = 11/351 (3%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQET--CNHLGMYFIADLHAITNNIVQENLRYQS 64
           L  SGVQPTG LHLGNYLG I+  +  Q+T  C    +Y + D+HA+T +     L   +
Sbjct: 37  LVFSGVQPTGNLHLGNYLGAIKRWVEVQKTEEC----IYCVVDMHALTVSPDPVELMQST 92

Query: 65  RLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEE 124
           R   A+FLAAG+DP ++I+F QS V  HA+L+W+ +CVAR+GWM+ M QFK+K+ +++E 
Sbjct: 93  REVTAAFLAAGIDPKKSIVFNQSRVMQHAELAWVFNCVARIGWMSRMTQFKDKAGKDRE- 151

Query: 125 TASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVA--- 181
            ASLGLF YP LMAADILLYRAT VPVGEDQ+QHLE+TR IAQ+FN ++  +I  +    
Sbjct: 152 NASLGLFAYPSLMAADILLYRATAVPVGEDQKQHLELTRDIAQKFNNDYSDRIASLGVGV 211

Query: 182 QKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAK 241
                +EQ S GFFP  E +I   A RI SLRD +KKMSKSD SD SRINL+D+ D I K
Sbjct: 212 DMKVGDEQVS-GFFPPTEPMISGPAMRIMSLRDGTKKMSKSDPSDLSRINLIDDEDTITK 270

Query: 242 KIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALA 301
           KI+KAKTD D LPSEV GLE R EA NL+ I+A +     E+ LK+FGG+ FS  K +LA
Sbjct: 271 KIRKAKTDSDGLPSEVDGLEGRPEADNLVGIYAALSSTTKEDVLKEFGGRQFSDLKASLA 330

Query: 302 DAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVG 352
           D  +  + PI+ +++ L+ D +++D++L +G  +A   A++TM++V +IVG
Sbjct: 331 DLAVARLSPITHEMRRLVADPAHIDSVLRDGGEQAGAIAEQTMRHVRDIVG 381


>gi|86747709|ref|YP_484205.1| tryptophanyl-tRNA synthetase [Rhodopseudomonas palustris HaA2]
 gi|86570737|gb|ABD05294.1| tryptophanyl-tRNA synthetase [Rhodopseudomonas palustris HaA2]
          Length = 350

 Score =  361 bits (926), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 178/348 (51%), Positives = 240/348 (68%), Gaps = 15/348 (4%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIV----QENLRYQSR 65
           SGVQPTG LHLGNYLG I N ++ QET  H  +Y + DLHAIT  +      + LR  +R
Sbjct: 9   SGVQPTGNLHLGNYLGAIVNFVKLQET--HNCIYCVVDLHAITVPVTVWGGPDELRRNTR 66

Query: 66  LFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEET 125
              A+F+AAG+DP ++IIF QS V  HA+L+W+ +CVAR+GW+N M QFKEK+ +++E  
Sbjct: 67  EVTAAFIAAGIDPQKHIIFNQSQVAEHAELAWVFNCVARLGWLNRMTQFKEKAGKDRE-N 125

Query: 126 ASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYA 185
           AS+GL+ YPVLMA+DIL+YRATHVPVGEDQ+QHLE+TR IAQ+FN +F   I        
Sbjct: 126 ASIGLYDYPVLMASDILVYRATHVPVGEDQKQHLELTRDIAQKFNNDFSASIAA------ 179

Query: 186 QEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQK 245
             +     +FP+ E +I   A+R+ SLRD +KKMSKSD SD+SRINL D+ D IA+KI+K
Sbjct: 180 --QGLGDAYFPLPEPVITGPATRVMSLRDGTKKMSKSDPSDYSRINLTDDADAIAQKIRK 237

Query: 246 AKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVI 305
           AKTD + LP+E  GLE R EA NL+ IFA +      + L +FGG  FS FK  L D  +
Sbjct: 238 AKTDPEPLPTEEKGLEPRPEADNLVGIFAALAGKPKAQVLSEFGGGQFSAFKSNLVDLAV 297

Query: 306 EEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           E++ PI+ +++ L  D  Y+D++L  G++RAR  A ETM  V +I+G+
Sbjct: 298 EKLSPIAGEMKRLSADHGYVDSVLASGSDRARVIAAETMTAVKDIMGM 345


>gi|261316800|ref|ZP_05955997.1| tryptophanyl-tRNA synthetase [Brucella pinnipedialis B2/94]
 gi|265987870|ref|ZP_06100427.1| tryptophanyl-tRNA synthetase [Brucella pinnipedialis M292/94/1]
 gi|261296023|gb|EEX99519.1| tryptophanyl-tRNA synthetase [Brucella pinnipedialis B2/94]
 gi|264660067|gb|EEZ30328.1| tryptophanyl-tRNA synthetase [Brucella pinnipedialis M292/94/1]
          Length = 355

 Score =  361 bits (926), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 180/351 (51%), Positives = 244/351 (69%), Gaps = 11/351 (3%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQET--CNHLGMYFIADLHAITNNIVQENLRYQS 64
           L  SGVQPTG LHLGNYLG I+  +  Q+T  C    +Y + D+HA+T +     L   +
Sbjct: 7   LVFSGVQPTGNLHLGNYLGAIKRWVEVQKTEEC----IYCVVDMHALTVSPDPVELMQST 62

Query: 65  RLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEE 124
           R   A+FLAAG+DP ++I+F QS V  HA+L+W+ +CVAR+GWM+ M QFK+K+ +++E 
Sbjct: 63  REVTAAFLAAGIDPKKSIVFNQSRVMQHAELAWVFNCVARIGWMSRMTQFKDKAGKDRE- 121

Query: 125 TASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVA--- 181
            ASLGLF YP LMAADILLYRAT VPVGEDQ+QHLE+TR IAQ+FN ++  +I  +    
Sbjct: 122 NASLGLFAYPSLMAADILLYRATAVPVGEDQKQHLELTRDIAQKFNNDYSDRIASLGVGV 181

Query: 182 QKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAK 241
                +EQ S GFFP  E +I   A RI SLRD +KKMSKSD SD SRINL+D+ D I K
Sbjct: 182 DMKVGDEQVS-GFFPPTEPMISGPAMRIMSLRDGTKKMSKSDPSDLSRINLIDDEDTITK 240

Query: 242 KIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALA 301
           KI+KAKTD D LPSEV GLE R EA NL+ I+A +     E+ LK+FGG+ FS  K +LA
Sbjct: 241 KIRKAKTDSDGLPSEVDGLEGRPEADNLVGIYAALSSTTKEDVLKEFGGRQFSDLKASLA 300

Query: 302 DAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVG 352
           D  +  + PI+ +++ L+ D +++D++L +G  +A   A++TM++V +IVG
Sbjct: 301 DLAVARLSPITHEMRRLVADPAHIDSVLRDGGEQAGAIAEQTMRHVRDIVG 351


>gi|85714192|ref|ZP_01045181.1| tryptophanyl-tRNA synthetase [Nitrobacter sp. Nb-311A]
 gi|85699318|gb|EAQ37186.1| tryptophanyl-tRNA synthetase [Nitrobacter sp. Nb-311A]
          Length = 375

 Score =  361 bits (926), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 178/348 (51%), Positives = 241/348 (69%), Gaps = 15/348 (4%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIV----QENLRYQSR 65
           SGVQPTG LHLGNYLG I N ++ Q   +H  +Y + DLHAIT  +      + LR  +R
Sbjct: 35  SGVQPTGNLHLGNYLGAIVNFVKLQ--ADHECLYCVVDLHAITVPVAVWGGPDELRRATR 92

Query: 66  LFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEET 125
              A+F+A+G+DP R+IIF QS V  HA+L+W+L+CVAR+GW+N M QFKEK+ +++E  
Sbjct: 93  EVTAAFIASGIDPKRHIIFNQSQVAGHAELAWVLNCVARLGWLNRMTQFKEKAGKDRE-N 151

Query: 126 ASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYA 185
           AS+GL+ YPVLMA+DIL+YRATHVPVGEDQ+QHLE++R IAQ+FN +F   I        
Sbjct: 152 ASVGLYDYPVLMASDILVYRATHVPVGEDQKQHLELSRDIAQKFNNDFSESI-------- 203

Query: 186 QEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQK 245
               +   FFP+ E +I   A+R+ SLRD +KKMSKSD SD+SRINL D+ D IA+KI+K
Sbjct: 204 AANGHGDTFFPLPEPVITGPATRVMSLRDGTKKMSKSDPSDYSRINLTDDADTIAQKIRK 263

Query: 246 AKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVI 305
           AKTD + LPSE  GLENR EA NL+ I+A +        L +FGG  FS FK +L D  +
Sbjct: 264 AKTDPEPLPSEEKGLENRPEADNLVGIYAALSGKPKSALLAEFGGAQFSGFKSSLVDLAV 323

Query: 306 EEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            ++ PI+++++ L  D +++D IL+EGA+RA   A +TM  V +IVG 
Sbjct: 324 AKLSPIAREMKRLTDDPAHVDRILIEGADRASAIASQTMDAVKDIVGF 371


>gi|265983320|ref|ZP_06096055.1| tryptophanyl-tRNA synthetase [Brucella sp. 83/13]
 gi|306839590|ref|ZP_07472394.1| tryptophanyl-tRNA synthetase [Brucella sp. NF 2653]
 gi|264661912|gb|EEZ32173.1| tryptophanyl-tRNA synthetase [Brucella sp. 83/13]
 gi|306405288|gb|EFM61563.1| tryptophanyl-tRNA synthetase [Brucella sp. NF 2653]
          Length = 355

 Score =  360 bits (925), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 180/351 (51%), Positives = 245/351 (69%), Gaps = 11/351 (3%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQET--CNHLGMYFIADLHAITNNIVQENLRYQS 64
           L  SGVQPTG LHLGNYLG I+  +  Q+T  C    +Y + D+HA+T +     L   +
Sbjct: 7   LVFSGVQPTGNLHLGNYLGAIKRWVEVQKTEEC----IYCVVDMHALTVSPDPVELMQST 62

Query: 65  RLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEE 124
           R   A+FLAAG+DP ++I+F QS V  HA+L+W+ +CVAR+GWM+ M QFK+K+ +++E 
Sbjct: 63  REVTAAFLAAGIDPKKSIVFNQSRVMQHAELAWVFNCVARIGWMSRMTQFKDKAGKDRE- 121

Query: 125 TASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVA--- 181
            ASLGLF YP LMAADILLYRAT VPVGEDQ+QHLE+TR IAQ+FN ++  +I  +    
Sbjct: 122 NASLGLFAYPSLMAADILLYRATAVPVGEDQKQHLELTRDIAQKFNNDYSDRIASLGVGV 181

Query: 182 QKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAK 241
                +EQ S GFFP+ E +I   A RI SLRD +KKMSKSD SD SRINL+D+ D I K
Sbjct: 182 DMKVGDEQVS-GFFPLTELMISGPAMRIMSLRDGTKKMSKSDPSDLSRINLIDDEDTITK 240

Query: 242 KIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALA 301
           KI+KAKTD D LPSEV GLE R EA NL+ I+A +     E+ LK+FGG+ FS  K +LA
Sbjct: 241 KIRKAKTDSDGLPSEVDGLEGRPEADNLVGIYAALSSTTKEDVLKEFGGRQFSDLKASLA 300

Query: 302 DAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVG 352
           D  +  + PI+ +++ L+ D +++D++L +G  +A   A++TM++V +IVG
Sbjct: 301 DLAVARLSPITHEMRRLVADPAHIDSVLRDGGEQAGAIAEQTMRHVRDIVG 351


>gi|192288890|ref|YP_001989495.1| tryptophanyl-tRNA synthetase [Rhodopseudomonas palustris TIE-1]
 gi|192282639|gb|ACE99019.1| tryptophanyl-tRNA synthetase [Rhodopseudomonas palustris TIE-1]
          Length = 350

 Score =  360 bits (923), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 173/348 (49%), Positives = 242/348 (69%), Gaps = 15/348 (4%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIV----QENLRYQSR 65
           SG+QPTG LHLGNYLG I N ++ QET  H  +Y + DLHAIT  +      + LR   R
Sbjct: 9   SGIQPTGNLHLGNYLGAIVNFVKMQET--HNCVYCVVDLHAITVPVTVWGGPDELRKNIR 66

Query: 66  LFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEET 125
              A+F+A+G+DP + IIF QS V  H++L+W+L+C+AR+GW+N M QFKEK+ +++E  
Sbjct: 67  EVTAAFIASGIDPKKQIIFNQSQVAEHSELAWVLNCIARLGWLNRMTQFKEKAGKDRENV 126

Query: 126 ASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYA 185
            S+GL+ YPVLMAADIL+YRATHVPVGEDQ+QH+E+TR IAQ+FN +F   I        
Sbjct: 127 -SVGLYDYPVLMAADILVYRATHVPVGEDQKQHVELTRDIAQKFNNDFSASIAA------ 179

Query: 186 QEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQK 245
             + +   +FP+ E +I   A+R+ SLRD +KKMSKSD SD+SRINL D+ D+IA+KI+K
Sbjct: 180 --QGFGDAYFPLPEPVITGPATRVMSLRDGTKKMSKSDPSDYSRINLTDDADVIAQKIKK 237

Query: 246 AKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVI 305
           AKTD + LPSE  GLE R EA NL+ I+A +      + L +FGG  FS FK  L D  +
Sbjct: 238 AKTDPEPLPSEEKGLETRPEADNLVGIYAALSGKPKTDVLTEFGGAQFSAFKSNLVDLAV 297

Query: 306 EEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            ++ PI+ +++ L  D +Y+D++L +G++RAR  A ETM+ V +I+G+
Sbjct: 298 AKLSPIADEMKRLSADHAYVDSVLADGSDRARAIAAETMRAVKDIMGM 345


>gi|163757732|ref|ZP_02164821.1| tryptophanyl-tRNA synthetase [Hoeflea phototrophica DFL-43]
 gi|162285234|gb|EDQ35516.1| tryptophanyl-tRNA synthetase [Hoeflea phototrophica DFL-43]
          Length = 354

 Score =  359 bits (922), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 177/347 (51%), Positives = 240/347 (69%), Gaps = 7/347 (2%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQPTG LHLGNYLG IR  +  Q    H  ++ + DLH+IT  +V E+L+ Q+R   A
Sbjct: 11  SGVQPTGNLHLGNYLGAIRKFVALQN--EHDCIFCVVDLHSITAQLVHEDLKAQTRSIAA 68

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           +F+A+G+DP ++I+F QS V  HA+L+WI +CVAR+GWMN M QFK+K+ +++E  ASLG
Sbjct: 69  AFIASGIDPVKHIVFNQSAVSGHAELAWIFNCVARIGWMNRMTQFKDKAGKDRE-NASLG 127

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVA---QKYAQ 186
           L  YP LMAADILLYRATHVPVG+DQ+QHLE+TR IAQ+FN +F  +IK           
Sbjct: 128 LLAYPSLMAADILLYRATHVPVGDDQKQHLELTRDIAQKFNIDFSDRIKAAGLGVDMMVG 187

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
           EE+ + GFFP+ E LID  A R+ SLRD S+KMSKS+ SD SRIN+ D+ D I KKI+KA
Sbjct: 188 EEKVT-GFFPMTEPLIDGPAPRVMSLRDGSRKMSKSEPSDLSRINMTDDADTIVKKIRKA 246

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
           KTD   LP  +  L+ R EA NL+ I+A +     E+ + ++GG+ FS FK ALA+  + 
Sbjct: 247 KTDPAPLPETLDELKGRPEADNLVAIYAALSDRTREDVIAEYGGQQFSVFKPALAELAVT 306

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + PI+ ++Q L+ D S++D IL +G+ RA   A  TM+ V EI+G 
Sbjct: 307 VLAPITGEMQRLMDDPSHIDAILKDGSERANVIAHNTMRDVREIIGF 353


>gi|299133389|ref|ZP_07026584.1| tryptophanyl-tRNA synthetase [Afipia sp. 1NLS2]
 gi|298593526|gb|EFI53726.1| tryptophanyl-tRNA synthetase [Afipia sp. 1NLS2]
          Length = 345

 Score =  359 bits (922), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 182/346 (52%), Positives = 242/346 (69%), Gaps = 15/346 (4%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAIT--NNIVQENLRYQSRLF 67
           SGVQPTG LHLGNYLG I N ++ Q+T  H  +Y + DLHAIT   N V+  L +  R  
Sbjct: 9   SGVQPTGNLHLGNYLGAIVNFVKLQQT--HNCIYCVVDLHAITVWQNPVE--LTHNIREV 64

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A+FLA+G+DP ++I+F QS V  HA+L+W+L+CVAR+GW+N M QFKEK+ +++E  AS
Sbjct: 65  TAAFLASGIDPDKHIVFNQSQVAEHAELAWVLNCVARLGWLNRMTQFKEKAGKDRE-NAS 123

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GL+ YP LMAADIL+YRATHVPVGEDQ+QHLE+ R IAQ+FN +F   I          
Sbjct: 124 VGLYAYPNLMAADILVYRATHVPVGEDQKQHLELARDIAQKFNNDFSESIAA-------- 175

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
           + Y   FFP  E LI   A+R+ SLRD SKKMSKSD SD+SRINL D+ D IA+KI+KAK
Sbjct: 176 KGYDPKFFPQPEPLITGPATRVMSLRDGSKKMSKSDPSDYSRINLTDDADAIAQKIRKAK 235

Query: 248 TDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
           TD + LPSE  GL++R EA NL+ I+A +      + L++FGG  FS FK  L D  +++
Sbjct: 236 TDPEPLPSEEDGLKSRPEADNLVGIYAALSGRTKADVLREFGGGQFSGFKSTLVDLSVDK 295

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + PI  +++ L++D  ++D +LV+GA RAR  A ETMK V +IVG 
Sbjct: 296 LGPIGAEMKRLMQDPGHVDAVLVKGAERARAIAFETMKAVKDIVGF 341


>gi|75674415|ref|YP_316836.1| tryptophanyl-tRNA synthetase [Nitrobacter winogradskyi Nb-255]
 gi|74419285|gb|ABA03484.1| tryptophanyl-tRNA synthetase [Nitrobacter winogradskyi Nb-255]
          Length = 347

 Score =  359 bits (921), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 178/348 (51%), Positives = 239/348 (68%), Gaps = 15/348 (4%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIV----QENLRYQSR 65
           SGVQPTG LHLGNYLG I N ++ Q   +H  +Y + DLHAIT  +      + LR  +R
Sbjct: 7   SGVQPTGNLHLGNYLGAIVNFVKLQ--ADHECLYCVVDLHAITVPVAVWGGPDELRRATR 64

Query: 66  LFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEET 125
              A+F+A+G+DP ++IIF QS V  HA+L+W+L+CVAR+GW+N M QFKEK+ +++E  
Sbjct: 65  EVTAAFIASGIDPRQHIIFNQSQVAGHAELAWVLNCVARLGWLNRMTQFKEKAGKDRE-N 123

Query: 126 ASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYA 185
           AS+GL+ YPVLMA+DIL+YRATHVPVGEDQ+QHLE++R IAQ+FN +F   I        
Sbjct: 124 ASVGLYDYPVLMASDILVYRATHVPVGEDQKQHLELSRDIAQKFNNDFSESIAA------ 177

Query: 186 QEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQK 245
               +   FFP+ E +I   A+R+ SLRD +KKMSKSD SD+SRINL DN D IA+KI+K
Sbjct: 178 --NGHGDMFFPLPEPVITGPATRVMSLRDGTKKMSKSDPSDYSRINLTDNADTIAQKIRK 235

Query: 246 AKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVI 305
           AKTD + LPSE  GLENR EA NL+ I+A +        L +FGG  FS FK +L D  +
Sbjct: 236 AKTDPEPLPSEEKGLENRPEADNLVGIYAALSGKPKSALLAEFGGAQFSSFKSSLVDLAV 295

Query: 306 EEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            ++ PI+ +++ L  D +++D IL+EGA RA   A +TM  V +IVG 
Sbjct: 296 AKLSPIAHEMKRLTDDPAHVDRILIEGAERASAIASQTMDAVKDIVGF 343


>gi|121601996|ref|YP_989426.1| tryptophanyl-tRNA synthetase [Bartonella bacilliformis KC583]
 gi|120614173|gb|ABM44774.1| tryptophanyl-tRNA synthetase [Bartonella bacilliformis KC583]
          Length = 356

 Score =  358 bits (920), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 173/349 (49%), Positives = 249/349 (71%), Gaps = 5/349 (1%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           L  SGVQP+G LHLGNYLG I+  +  Q   ++  +Y + D+HA+T N     + + +R 
Sbjct: 7   LVFSGVQPSGNLHLGNYLGAIKQWVALQ--ASYPCLYCVVDMHALTVNPDPLTVMHSTRA 64

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A+FLA+G+DP + IIF QS V  H +L+WI +C+AR+GW+  M QFK+K+ +N+E+ A
Sbjct: 65  AAATFLASGIDPEKQIIFNQSRVFQHTELAWIFNCIARIGWLQRMTQFKDKAGKNREQ-A 123

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           SLGLF YP LMAADIL+YRATHVPVGEDQ+QH+E+TR IAQ+FN ++  +I ++    +Q
Sbjct: 124 SLGLFAYPSLMAADILVYRATHVPVGEDQKQHIELTRDIAQKFNNDYAERIADLNYGLSQ 183

Query: 187 --EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQ 244
             +E+  +GFFPI E +I ++A+RI SLRD +KKMSKSD SDFSRINL D+ D+I +KI+
Sbjct: 184 PDDEKKVQGFFPIPEAIIGNAATRIMSLRDGTKKMSKSDPSDFSRINLTDDVDLITQKIR 243

Query: 245 KAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           KAKTD   LP  +  L+ R E  NL+ I+A + ++  E+ L +F G+ FS FK ALAD  
Sbjct: 244 KAKTDSAPLPDTLDDLKERPEVDNLLGIYAALAEVSKEKVLLEFSGQQFSFFKSALADLA 303

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           ++++ PI+Q+++ L +D +Y+DT+L  GA RA   A++ MK + +IVGL
Sbjct: 304 VDKLAPITQELKRLHQDNAYIDTVLRNGAERASALAEKNMKQIRDIVGL 352


>gi|220924281|ref|YP_002499583.1| tryptophanyl-tRNA synthetase [Methylobacterium nodulans ORS 2060]
 gi|219948888|gb|ACL59280.1| tryptophanyl-tRNA synthetase [Methylobacterium nodulans ORS 2060]
          Length = 347

 Score =  358 bits (919), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 185/356 (51%), Positives = 238/356 (66%), Gaps = 16/356 (4%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQE---TCNHLGMYFIADLHAITNNIVQ 57
           M +   L  SGVQPTG LHLGNYLG IR  +  Q    TC    +Y + DLHAIT     
Sbjct: 1   MPAFQELVFSGVQPTGNLHLGNYLGAIRRFVALQAQYATC----LYCVVDLHAITVWQDP 56

Query: 58  ENLRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEK 117
             L  Q R   A+FLAAG+DPSR I+F QS V  HA+L+WI +CVAR+GW+N M QFKEK
Sbjct: 57  AELTNQIREVTAAFLAAGIDPSRAIVFNQSQVPQHAELTWIFNCVARLGWLNRMTQFKEK 116

Query: 118 SKENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKI 177
           + +++E  AS+GL+ YPVLMAADIL YRATHVPVGEDQ+QHLE+TR IAQ+FN +F   I
Sbjct: 117 AGKDRE-NASIGLYDYPVLMAADILAYRATHVPVGEDQKQHLELTRDIAQKFNNDFSGSI 175

Query: 178 KEVAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPD 237
                       + + FFP+ E LI   A+R+ SLRD +KKMSKSD SD+SRINL D+ D
Sbjct: 176 AA--------RGHGEAFFPLTEPLIGGPAARVMSLRDGTKKMSKSDPSDYSRINLTDDAD 227

Query: 238 IIAKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFK 297
            IA+K++KAKTD + LPSEV+GL  R EA NL+ IFA +R +  E+ L+ +GG  FS FK
Sbjct: 228 AIAQKVRKAKTDAEPLPSEVAGLAGRPEADNLVGIFAALRDVSREDVLRDYGGAQFSAFK 287

Query: 298 LALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            AL D  +E + PI  +++ L+ D  ++D +L +GA RA   A  T+  V +IVG 
Sbjct: 288 GALVDLAVERLGPIGAEMKRLVDDPGHIDRVLADGAARAEAIAAPTIAAVKDIVGF 343


>gi|39933532|ref|NP_945808.1| tryptophanyl-tRNA synthetase [Rhodopseudomonas palustris CGA009]
 gi|39647378|emb|CAE25899.1| trytophanyl-tRNA synthetase [Rhodopseudomonas palustris CGA009]
          Length = 350

 Score =  358 bits (919), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 173/348 (49%), Positives = 241/348 (69%), Gaps = 15/348 (4%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIV----QENLRYQSR 65
           SG+QPTG LHLGNYLG I N ++ QET  H  +Y + DLHAIT  +      + LR   R
Sbjct: 9   SGIQPTGNLHLGNYLGAIVNFVKMQET--HNCVYCVVDLHAITVPVTVWGGPDELRKNIR 66

Query: 66  LFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEET 125
              A+F+A+G+DP + IIF QS V  H++L+W+L+C+AR+GW+N M QFKEK+ +++E  
Sbjct: 67  EVTAAFIASGIDPKKQIIFNQSQVAEHSELAWVLNCIARLGWLNRMTQFKEKAGKDRENV 126

Query: 126 ASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYA 185
            S+GL+ YPVLMAADIL+YRATHVPVGEDQ+QH+E+TR IAQ+FN +F   I        
Sbjct: 127 -SVGLYDYPVLMAADILVYRATHVPVGEDQKQHVELTRDIAQKFNNDFSASIAA------ 179

Query: 186 QEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQK 245
             + +   +FP+ E +I   A+R+ SLRD +KKMSKSD SD+SRINL D+ D IA+KI+K
Sbjct: 180 --QGFGDAYFPLPEPVITGPATRVMSLRDGTKKMSKSDPSDYSRINLTDDADAIAQKIKK 237

Query: 246 AKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVI 305
           AKTD + LPSE  GLE R EA NL+ I+A +        L +FGG  FS FK +L D  +
Sbjct: 238 AKTDPEPLPSEEKGLETRPEADNLVGIYAALSGKPKTGVLTEFGGAQFSAFKSSLVDLAV 297

Query: 306 EEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            ++ PI+ +++ L  D +Y+D++L +G++RAR  A ETM+ V +I+G+
Sbjct: 298 AKLSPIADEMKRLSADHAYVDSVLADGSDRARAIAAETMRAVKDIMGM 345


>gi|154247014|ref|YP_001417972.1| tryptophanyl-tRNA synthetase [Xanthobacter autotrophicus Py2]
 gi|154161099|gb|ABS68315.1| tryptophanyl-tRNA synthetase [Xanthobacter autotrophicus Py2]
          Length = 345

 Score =  358 bits (919), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 181/350 (51%), Positives = 239/350 (68%), Gaps = 12/350 (3%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           +D +F SGVQPTG LHLGNYLG I+  +  QE+  H  +Y + DLHAIT       L+  
Sbjct: 5   ADRVF-SGVQPTGNLHLGNYLGAIKRFVALQES--HECIYCVVDLHAITVWQDPVELKRH 61

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
            R   A+F+A G+DP  +I+F QS V  HA+L+WI +CVARMGW+N M QFKEK+ +++E
Sbjct: 62  IREVTAAFIACGIDPKAHIVFNQSQVSGHAELAWIFNCVARMGWLNRMTQFKEKAGKDRE 121

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
              S+GLF YP LMAADILLYRATHVPVGEDQ+QHLE+TR IAQ+FNT+F   I      
Sbjct: 122 NV-SVGLFAYPDLMAADILLYRATHVPVGEDQKQHLELTRDIAQKFNTDFGPSIAA---- 176

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
                 ++ G+FP+ E LI   A+R+ SLRD +KKMSKSD SDFSRINL D+ D IA K+
Sbjct: 177 ----HGHADGYFPLTEPLIAGPATRVMSLRDGAKKMSKSDPSDFSRINLTDDRDTIAGKV 232

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           +KAKTD + LP+E  GL+ R EA NL+ IFA +      + LK +G   FS FK AL D 
Sbjct: 233 RKAKTDPEPLPTEEEGLKGRPEADNLVGIFAALSDRTKADVLKDYGTAQFSAFKAALVDL 292

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            +E++ PI  ++Q L+ + + +D IL++GA+RAR  A +T+  V +IVGL
Sbjct: 293 AVEKLGPIGAEMQRLMAEPAAIDAILIDGADRARVIADQTIAEVKDIVGL 342


>gi|319405376|emb|CBI78995.1| Tryptophanyl-tRNA synthetase [Bartonella sp. AR 15-3]
          Length = 356

 Score =  358 bits (918), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 177/349 (50%), Positives = 248/349 (71%), Gaps = 5/349 (1%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           L  SGVQP+G LHLGNYLG I+  +  Q +  +  +Y + D+HA+T N    +L   +R+
Sbjct: 7   LVFSGVQPSGHLHLGNYLGAIKQWVDLQTS--YKCLYCVVDMHALTINPDSLSLAESTRM 64

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A+FLAAG+DP + IIF QS V  HA+L+WI +C+AR+GW++ M QFK+K+ +N+E+T 
Sbjct: 65  MTAAFLAAGIDPQKQIIFNQSRVFQHAELAWIFNCIARIGWLHRMTQFKDKASKNREQT- 123

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEV--AQKY 184
           SLGLF YP LMAADIL+YRATHVPVGEDQ+QH+E+TR IAQ+FN  +  +I  +      
Sbjct: 124 SLGLFAYPSLMAADILIYRATHVPVGEDQKQHIELTRDIAQKFNNIYADRIANLNFGVSV 183

Query: 185 AQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQ 244
              E+  + FFP+ E LI  +A RI SLRD +KKMSKSD SDFSRINL+D+ D+I +KI+
Sbjct: 184 QNGEKNEQVFFPMPEALIKKTAMRIMSLRDGTKKMSKSDPSDFSRINLIDDADLIVQKIR 243

Query: 245 KAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           KAKTD   LP ++S L+ R E  NL+ I+A   +I  E+AL +F GK FS FK ALAD +
Sbjct: 244 KAKTDSTPLPDKLSDLQERPEVNNLLGIYAAFSEISKEKALLEFSGKQFSLFKSALADLI 303

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + ++ PI+Q+++ L ++K+Y++++L +GA RA   A++ MK V EIVG 
Sbjct: 304 VYKLAPITQELRRLYQEKTYINSVLRDGAQRASLLAEKNMKKVREIVGF 352


>gi|296447297|ref|ZP_06889225.1| tryptophanyl-tRNA synthetase [Methylosinus trichosporium OB3b]
 gi|296255162|gb|EFH02261.1| tryptophanyl-tRNA synthetase [Methylosinus trichosporium OB3b]
          Length = 344

 Score =  358 bits (918), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 179/344 (52%), Positives = 238/344 (69%), Gaps = 11/344 (3%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQ TG LHLGNYLG I   +  Q++ + L  Y + DLHAIT       L+  +R   A
Sbjct: 10  SGVQSTGNLHLGNYLGAIVKFVELQQSFDCL--YCVVDLHAITVPQDPLKLKANTREIAA 67

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           +F+A G+DP +NI+F QS V  HA+L+W+L+CVAR+GW+N M QFK+K+ +++E  AS+G
Sbjct: 68  AFIACGIDPKKNIVFNQSQVAEHAELAWVLNCVARIGWLNRMTQFKDKAGKDRE-NASMG 126

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L  YPVLMAADIL+YRATHVPVG+DQ+QHLE++R IAQ+FN +F   I            
Sbjct: 127 LLDYPVLMAADILIYRATHVPVGDDQKQHLELSRDIAQKFNNDFAESI--------LRNG 178

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
           + + FFP+ E LI   A+R+ SLRD SKKMSKSD+SD+SRINL D+ D IA KI+KAKTD
Sbjct: 179 FGEAFFPLPEPLISGPATRVMSLRDGSKKMSKSDASDYSRINLADDADQIATKIKKAKTD 238

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            D LPSE  GLE R EA+NL+ IFA + Q    + L +FGG NFS FK AL D  +E++ 
Sbjct: 239 PDALPSEEKGLEGRPEAQNLVGIFAALSQRAKADVLAEFGGANFSTFKNALVDLAVEKLS 298

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PI+ +++ L  D++Y+D +L +GA RAR  A+  M  V +IVG 
Sbjct: 299 PITAEMRRLSADEAYVDGVLRDGAERARELARANMDAVKDIVGF 342


>gi|239830992|ref|ZP_04679321.1| tryptophanyl-tRNA synthetase [Ochrobactrum intermedium LMG 3301]
 gi|239823259|gb|EEQ94827.1| tryptophanyl-tRNA synthetase [Ochrobactrum intermedium LMG 3301]
          Length = 355

 Score =  358 bits (918), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 174/348 (50%), Positives = 244/348 (70%), Gaps = 5/348 (1%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           L  SG QPTG LHLGNYLG I+  +  Q+T + +  Y + D+HA+T +     L   +R 
Sbjct: 7   LVFSGAQPTGNLHLGNYLGAIKRWVDMQDTNDCI--YCVVDMHALTISPDPAELTNSTRE 64

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A++LAAGVDP ++I+F QS V  HA+L+W+ +CVAR+GWM+ M QFK+K+ +++E  A
Sbjct: 65  VTAAYLAAGVDPKKSIVFNQSRVMQHAELAWVFNCVARIGWMSRMTQFKDKAGKDRE-NA 123

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKE--VAQKY 184
           SLGLF YP LMAADILLYRAT VPVGEDQ+QHLE+TR IAQ+FN ++  +I    V    
Sbjct: 124 SLGLFAYPSLMAADILLYRATAVPVGEDQKQHLELTRDIAQKFNNDYSDRIASLGVGVDM 183

Query: 185 AQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQ 244
              ++   GFFP+ E +I   A RI SLRD +KKMSKSD SD SRINL+D+ + I KKI+
Sbjct: 184 KVGDERVSGFFPLTEPVISGPAMRIMSLRDGTKKMSKSDPSDLSRINLIDDEETITKKIR 243

Query: 245 KAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           KAKTD D LP+E+ GL+ R EA NL+ I+A +     E+ L +FGG+ FS+FK +LAD  
Sbjct: 244 KAKTDSDGLPTELDGLDGRPEADNLVGIYAALSARSKEDVLNEFGGRQFSEFKASLADLA 303

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVG 352
           + ++ PI+ +++ L+ D +Y+D++L +G  RA   A++TM++V +IVG
Sbjct: 304 VAKLSPITHEMRRLVADPAYIDSVLRDGGERAGVIAEQTMRHVRDIVG 351


>gi|217978706|ref|YP_002362853.1| tryptophanyl-tRNA synthetase [Methylocella silvestris BL2]
 gi|217504082|gb|ACK51491.1| tryptophanyl-tRNA synthetase [Methylocella silvestris BL2]
          Length = 344

 Score =  357 bits (917), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 178/344 (51%), Positives = 232/344 (67%), Gaps = 11/344 (3%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQPTG LHLGNYLG I   +  Q T  H  +Y + DLHAIT     E L+   R   A
Sbjct: 10  SGVQPTGNLHLGNYLGAIVKFVELQRT--HDCIYCVVDLHAITVPQKPEELKASIREVTA 67

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           +F+A+GVDP ++IIF QS V  HA+L+W+ +CVAR+GW+N M QFKEK+ +++E  AS+G
Sbjct: 68  AFIASGVDPKQHIIFNQSQVAEHAELAWVFNCVARIGWLNRMTQFKEKAGKDRE-NASVG 126

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L+ YP LMAADILLYRATHVPVGEDQ+QHLE+ R +AQ+FN +F   I            
Sbjct: 127 LYAYPCLMAADILLYRATHVPVGEDQKQHLELARDVAQKFNLDFAASIAA--------NG 178

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
           + + FFP+ E LI   A+R+ SLRD +KKMSKSD SD+SRINL D+ D IA+K++KAKTD
Sbjct: 179 FGEAFFPLPEPLIQGPATRVMSLRDGAKKMSKSDPSDYSRINLSDDADAIAQKVRKAKTD 238

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            + LPSEV GL  R EA NL+ IFA +      E L  FGG  FS FK AL D  + +I 
Sbjct: 239 PEPLPSEVEGLAARPEADNLVGIFAALNGQTKPEVLSAFGGGQFSAFKSALVDLAVAKIG 298

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PI  +++ L  D +Y+D++L +GA RAR  A++ M  V +I+G 
Sbjct: 299 PIGAEMKRLTADAAYIDSVLADGAARARVIAKDNMAAVKDILGF 342


>gi|146190013|emb|CAL74005.1| Tryptophanyl-tRNA synthetase (Tryptophan--tRNA ligase) (TrpRS)
           [Bradyrhizobium sp. ORS278]
          Length = 364

 Score =  357 bits (917), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 179/348 (51%), Positives = 241/348 (69%), Gaps = 14/348 (4%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNI----VQENLRYQSR 65
           SGVQPTG LHLGNYLG I N ++ QET  H  +Y + D+HAIT  I        L   +R
Sbjct: 23  SGVQPTGNLHLGNYLGAIVNFVKMQET--HNCIYCVVDMHAITMPIDVWGGPAELARNTR 80

Query: 66  LFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEET 125
              A+F+AAG+DP ++I+F QS V  HA+L+WI +CVAR+GW+N M QFKEK+ +++E  
Sbjct: 81  EVTAAFIAAGIDPKKHIVFNQSQVSGHAELAWIFNCVARIGWLNRMTQFKEKAGKDRE-N 139

Query: 126 ASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYA 185
           AS+GL+ YPVLMAADILLYRATHVPVGEDQ+QHLE++R IAQ+FN +F   I+  AQ + 
Sbjct: 140 ASVGLYDYPVLMAADILLYRATHVPVGEDQKQHLELSRDIAQKFNNDFGDSIR--AQGFG 197

Query: 186 QEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQK 245
                   FFP+ E  I   A+R+ SLRD +KKMSKSD+SD+SRINL D+ D IA+K++K
Sbjct: 198 DGL-----FFPLPEPFITGPATRVMSLRDGTKKMSKSDASDYSRINLTDDADTIAQKVRK 252

Query: 246 AKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVI 305
           AKTD + LPSE  GL+ R EA NL+ I+A +      + L++FGG  FS FK AL +  +
Sbjct: 253 AKTDPEPLPSEEKGLDTRPEADNLVGIYAALSDRSKADVLREFGGGQFSSFKNALVELCV 312

Query: 306 EEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            ++ PI+ +++ L  D  Y+D++LV+G  RA+  A ETMK   +IVG 
Sbjct: 313 TKLGPIAAEMKRLTADPGYVDSVLVDGGERAQAIAAETMKTAKDIVGF 360


>gi|161353771|ref|YP_001202255.2| tryptophanyl-tRNA synthetase [Bradyrhizobium sp. ORS278]
          Length = 350

 Score =  357 bits (916), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 179/348 (51%), Positives = 241/348 (69%), Gaps = 14/348 (4%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNI----VQENLRYQSR 65
           SGVQPTG LHLGNYLG I N ++ QET  H  +Y + D+HAIT  I        L   +R
Sbjct: 9   SGVQPTGNLHLGNYLGAIVNFVKMQET--HNCIYCVVDMHAITMPIDVWGGPAELARNTR 66

Query: 66  LFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEET 125
              A+F+AAG+DP ++I+F QS V  HA+L+WI +CVAR+GW+N M QFKEK+ +++E  
Sbjct: 67  EVTAAFIAAGIDPKKHIVFNQSQVSGHAELAWIFNCVARIGWLNRMTQFKEKAGKDRE-N 125

Query: 126 ASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYA 185
           AS+GL+ YPVLMAADILLYRATHVPVGEDQ+QHLE++R IAQ+FN +F   I+  AQ + 
Sbjct: 126 ASVGLYDYPVLMAADILLYRATHVPVGEDQKQHLELSRDIAQKFNNDFGDSIR--AQGFG 183

Query: 186 QEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQK 245
                   FFP+ E  I   A+R+ SLRD +KKMSKSD+SD+SRINL D+ D IA+K++K
Sbjct: 184 DGL-----FFPLPEPFITGPATRVMSLRDGTKKMSKSDASDYSRINLTDDADTIAQKVRK 238

Query: 246 AKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVI 305
           AKTD + LPSE  GL+ R EA NL+ I+A +      + L++FGG  FS FK AL +  +
Sbjct: 239 AKTDPEPLPSEEKGLDTRPEADNLVGIYAALSDRSKADVLREFGGGQFSSFKNALVELCV 298

Query: 306 EEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            ++ PI+ +++ L  D  Y+D++LV+G  RA+  A ETMK   +IVG 
Sbjct: 299 TKLGPIAAEMKRLTADPGYVDSVLVDGGERAQAIAAETMKTAKDIVGF 346


>gi|115522245|ref|YP_779156.1| tryptophanyl-tRNA synthetase [Rhodopseudomonas palustris BisA53]
 gi|115516192|gb|ABJ04176.1| tryptophanyl-tRNA synthetase [Rhodopseudomonas palustris BisA53]
          Length = 349

 Score =  357 bits (915), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 174/348 (50%), Positives = 240/348 (68%), Gaps = 15/348 (4%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIV----QENLRYQSR 65
           SG+QPTG LHLGNYLG I N ++ Q T  H  +Y + DLHAIT  +      + LR   R
Sbjct: 8   SGIQPTGNLHLGNYLGAIVNFVKMQAT--HNCVYCVVDLHAITVPVTVWGGPDELRRNIR 65

Query: 66  LFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEET 125
              A+F+A+G+DP + IIF QS V  HA+L+W+L+C+AR+GW+N M QFKEK+ +++E  
Sbjct: 66  EVTAAFIASGIDPKQQIIFNQSQVAEHAELAWVLNCIARLGWLNRMTQFKEKAGKDRENV 125

Query: 126 ASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYA 185
            S+GL+ YPVLMA+DIL+YRATHVPVGEDQ+QH+E+TR IAQ+FN +F   I        
Sbjct: 126 -SVGLYDYPVLMASDILVYRATHVPVGEDQKQHVELTRDIAQKFNNDFSASIAA------ 178

Query: 186 QEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQK 245
             + +   +FP+ E +I   A+R+ SLRD +KKMSKSD SD+SRINL D+ D IA+KI+K
Sbjct: 179 --QGFGDSYFPLPEPVITGPATRVMSLRDGTKKMSKSDPSDYSRINLTDDADAIAQKIRK 236

Query: 246 AKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVI 305
           AKTD + LPSE  GLE R EA NL+ I+A +      + L +FGG  FS FK +L D  +
Sbjct: 237 AKTDPEPLPSEEKGLEARPEADNLVGIYAALAGKPKSDVLSEFGGAQFSGFKSSLVDLAV 296

Query: 306 EEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           E++ PI+ +++ L  D +Y+D +L +GA+RAR  A ETM  V +I+G+
Sbjct: 297 EKLSPIAAEMKRLSADHAYVDAVLADGADRARVIAAETMTAVKDIMGM 344


>gi|316931560|ref|YP_004106542.1| tryptophanyl-tRNA synthetase [Rhodopseudomonas palustris DX-1]
 gi|315599274|gb|ADU41809.1| tryptophanyl-tRNA synthetase [Rhodopseudomonas palustris DX-1]
          Length = 350

 Score =  356 bits (914), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 174/348 (50%), Positives = 240/348 (68%), Gaps = 15/348 (4%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIV----QENLRYQSR 65
           SG+QPTG LHLGNYLG I N ++ QET  H  +Y + DLHAIT  +      + LR   R
Sbjct: 9   SGIQPTGNLHLGNYLGAIVNFVKMQET--HNCVYCVVDLHAITVPVTVWGGPDELRKNIR 66

Query: 66  LFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEET 125
              A+F+A+G+DP + IIF QS V  H++L+W+L+C+AR+GW+N M QFKEK+ +++E  
Sbjct: 67  EVTAAFIASGIDPKKQIIFNQSQVAEHSELAWVLNCIARLGWLNRMTQFKEKAGKDRENV 126

Query: 126 ASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYA 185
            S+GL+ YPVLMAADIL+YRATHVPVGEDQ+QH+E+TR IAQ+FN +F   I        
Sbjct: 127 -SVGLYDYPVLMAADILVYRATHVPVGEDQKQHVELTRDIAQKFNNDFAASI-------- 177

Query: 186 QEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQK 245
             + +   +FP+ E +I   A+R+ SLRD +KKMSKSD SD+SRINL D+ D IA+KI+K
Sbjct: 178 AAQGFGDAYFPLPEPVITGPATRVMSLRDGTKKMSKSDPSDYSRINLTDDADAIAQKIRK 237

Query: 246 AKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVI 305
           AKTD + LPSE  GLE R EA NL+ I+A +      E L +FGG  FS FK  L D  +
Sbjct: 238 AKTDPEPLPSEEKGLEPRPEADNLVGIYAALAGKPKAEVLTEFGGAQFSAFKSNLVDLAV 297

Query: 306 EEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            ++ PI+ +++ L  D +Y+D++L +G++RAR  A ETM  V +I+G+
Sbjct: 298 AKLSPIAGEMKRLSADHAYVDSVLADGSDRARAIAAETMVAVKDIMGM 345


>gi|154254039|ref|YP_001414863.1| tryptophanyl-tRNA synthetase [Parvibaculum lavamentivorans DS-1]
 gi|154157989|gb|ABS65206.1| tryptophanyl-tRNA synthetase [Parvibaculum lavamentivorans DS-1]
          Length = 335

 Score =  356 bits (913), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 178/353 (50%), Positives = 239/353 (67%), Gaps = 19/353 (5%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENL 60
           M    N   SGVQPTG LHLGNYLG IRN +  Q+T  H  +Y + D+HAIT     + L
Sbjct: 1   MEKPQNRVFSGVQPTGNLHLGNYLGAIRNFVGLQQT--HECIYCVVDMHAITVWQDPKEL 58

Query: 61  RYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKE 120
              +R   A+++AAG+DPS NIIF QS V  HA+L+WIL+CVAR+GW+N M QFK+K+ +
Sbjct: 59  AANTREVAAAYIAAGIDPSTNIIFNQSKVAAHAELAWILNCVARIGWLNRMTQFKDKAGK 118

Query: 121 NKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEV 180
           ++E+ AS+GL+ YP+LMAADIL+YRATHVPVG+DQ+QHLE+ R  AQ+FN +F       
Sbjct: 119 DREK-ASVGLYAYPILMAADILVYRATHVPVGDDQKQHLELARDTAQKFNNDFG------ 171

Query: 181 AQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIA 240
                     ++ FFP+ E LI   A+R+ SLRD +KKMSKSD SD SRI + D+ D IA
Sbjct: 172 ----------AQDFFPLPEPLIMGPATRVMSLRDGTKKMSKSDPSDLSRITMRDSADDIA 221

Query: 241 KKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLAL 300
           KKI+KA+TD D LP  V GL+ R  A+NL+ I+A +  +   E L Q+GG+ FS FK AL
Sbjct: 222 KKIRKAQTDPDPLPETVEGLQGRPGAENLVGIYAALAGMTKAEVLAQYGGQQFSAFKPAL 281

Query: 301 ADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           AD  +E++ PI+ ++  L+ D +Y+D IL +GA+RAR  A   +  V EIVG 
Sbjct: 282 ADLAVEKLSPITDEMARLMADPAYIDGILSKGADRARAIADPVVARVKEIVGF 334


>gi|148251662|ref|YP_001236247.1| tryptophanyl-tRNA synthetase [Bradyrhizobium sp. BTAi1]
 gi|146403835|gb|ABQ32341.1| tryptophanyl-tRNA synthetase [Bradyrhizobium sp. BTAi1]
          Length = 350

 Score =  355 bits (911), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 177/349 (50%), Positives = 239/349 (68%), Gaps = 16/349 (4%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNI----VQENLRYQSR 65
           SGVQPTG LHLGNYLG I N ++ QET  H  +Y + D+HAIT  +        L   +R
Sbjct: 9   SGVQPTGNLHLGNYLGAIVNFVKMQET--HNCIYCVVDMHAITMPVDVWGGPAELARNTR 66

Query: 66  LFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEET 125
              A+F+AAG+DP ++I+F QS V  HA+L+WI +CVAR+GW+N M QFKEK+ +++E  
Sbjct: 67  EVTAAFIAAGIDPKKHIVFNQSQVSGHAELAWIFNCVARIGWLNRMTQFKEKAGKDRE-N 125

Query: 126 ASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYA 185
           AS+GL+ YPVLMAADILLYRATHVPVGEDQ+QHLE++R IAQ+FN +F   I+       
Sbjct: 126 ASVGLYDYPVLMAADILLYRATHVPVGEDQKQHLELSRDIAQKFNNDFGDSIRS------ 179

Query: 186 QEEQYSKG-FFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQ 244
               +  G FFP+ E  I   A+R+ SLRD +KKMSKSD+SD+SRINL D+ D IA+K++
Sbjct: 180 --HGFGDGLFFPLPEPFITGPATRVMSLRDGTKKMSKSDASDYSRINLTDDADTIAQKVR 237

Query: 245 KAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           KAKTD + LP+E  GLE R EA NL+ I+A +      E L+ FGG  FS FK AL +  
Sbjct: 238 KAKTDPEPLPTEEKGLEARPEADNLVGIYAALSDRSKAEVLRDFGGGQFSSFKNALVELC 297

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + ++ PI+ +++ L  D  Y+D++L++G  RA+  A ETMK   +IVG 
Sbjct: 298 VTKLGPIAAEMKRLTADPGYVDSVLIDGGERAQAIAAETMKAAKDIVGF 346


>gi|319403935|emb|CBI77523.1| Tryptophanyl-tRNA synthetase [Bartonella rochalimae ATCC BAA-1498]
          Length = 356

 Score =  355 bits (911), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 175/351 (49%), Positives = 247/351 (70%), Gaps = 5/351 (1%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           L  SGVQP+G LHLGNYLG I+  +  Q +  +  +Y I D+HA+T N    +L   + +
Sbjct: 7   LVFSGVQPSGHLHLGNYLGAIKQWVDLQTS--YKCLYCIVDMHALTINPDPLSLAESTYM 64

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A+FLAAG+DP + IIF QS V  HA+L+WI +C+AR+GW+  M QFK+K+ +N+E+T 
Sbjct: 65  MTAAFLAAGIDPQKQIIFNQSRVFQHAELAWIFNCIARIGWLQRMTQFKDKAGKNREQT- 123

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEV--AQKY 184
           SLGLF YP LMAADIL+Y ATHVPVGEDQ QH+E+TR IAQ+FN+ +  +I  +      
Sbjct: 124 SLGLFAYPSLMAADILIYHATHVPVGEDQTQHIELTRDIAQKFNSIYADRIANLNFGISM 183

Query: 185 AQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQ 244
              E+  + FFP+ E +I+ +A RI SLRD +KKMSKSD SDFSRINL+D+ D+I +KI+
Sbjct: 184 PNGEKNEQNFFPMPEAIINKTAMRIMSLRDGTKKMSKSDPSDFSRINLIDDTDLIVQKIR 243

Query: 245 KAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           KAKTD   LP  ++ L+ R E  NL+ I+A+  +I  E+AL +F GK FS FK ALAD +
Sbjct: 244 KAKTDSTSLPDTLNDLQERPEVNNLLGIYASFAEISKEKALLEFSGKQFSLFKSALADLI 303

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLSH 355
           + ++ PI+Q+++ L ++K+Y++++L +GA RA   A++ MK V EIVG  H
Sbjct: 304 VHKLAPITQELRRLYQEKTYINSVLFDGAQRASLLAEKNMKKVREIVGFVH 354


>gi|114706880|ref|ZP_01439780.1| tryptophanyl-tRNA synthetase [Fulvimarina pelagi HTCC2506]
 gi|114537828|gb|EAU40952.1| tryptophanyl-tRNA synthetase [Fulvimarina pelagi HTCC2506]
          Length = 355

 Score =  355 bits (910), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 175/349 (50%), Positives = 248/349 (71%), Gaps = 5/349 (1%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SG+QPTG LHLGNYLG I+  +  QE    L  + + DLHAIT  +VQ++L  Q+R   
Sbjct: 9   LSGIQPTGHLHLGNYLGAIKKFVAMQEEMPCL--FCVVDLHAITAKLVQDDLAGQTRAIA 66

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A++LAAG+DP R++IF QS V  HA+L+WI +CVAR+GWMN M QFK+K+ +++E  ASL
Sbjct: 67  AAYLAAGIDPERSVIFNQSRVTGHAELAWIFNCVARIGWMNRMTQFKDKAGKDRE-NASL 125

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKE--VAQKYAQ 186
           GL  YP LMAADIL+YRATHVPVG+DQ+QHLE+TR IA +FN +F  +I++  + ++   
Sbjct: 126 GLLAYPSLMAADILVYRATHVPVGDDQKQHLELTRDIAIKFNNDFSERIEKTGLGREVRM 185

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
            E+   G+FPI + +I+  A+RI SL+D +KKMSKSD SD SRINL D+ D IA+K++KA
Sbjct: 186 GEEVVHGYFPITDPIIEGPATRIMSLKDGAKKMSKSDPSDLSRINLTDDADAIARKVKKA 245

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
           KTD D LPSE +GL  R EA+NL+ I+A +     ++ L QFGGK FS+FK AL +  + 
Sbjct: 246 KTDPDALPSEAAGLAGRPEAENLVGIYAALSGETRDQVLTQFGGKQFSEFKPALVELAVS 305

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLSH 355
            + P++ +++ LL D  ++D +L  G  +A   A +TM+ V +I+G+ H
Sbjct: 306 SLGPVTGEMRRLLDDPGHIDAVLKAGGEKANEIAAKTMRDVKDIIGMLH 354


>gi|27375913|ref|NP_767442.1| tryptophanyl-tRNA synthetase [Bradyrhizobium japonicum USDA 110]
 gi|39932182|sp|Q89W91|SYW_BRAJA RecName: Full=Tryptophanyl-tRNA synthetase; AltName:
           Full=Tryptophan--tRNA ligase; Short=TrpRS
 gi|27349051|dbj|BAC46067.1| tryptophan-tRNA ligase [Bradyrhizobium japonicum USDA 110]
          Length = 350

 Score =  355 bits (910), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 181/349 (51%), Positives = 240/349 (68%), Gaps = 16/349 (4%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNI----VQENLRYQSR 65
           SGVQPTG LHLGNYLG I N ++ QET  H  +Y + D+HAIT  +        L   +R
Sbjct: 9   SGVQPTGNLHLGNYLGAIVNFVKMQET--HNCIYCVVDMHAITQGVDVWGGPVELARNTR 66

Query: 66  LFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEET 125
              A+F+A+G+DP ++I+F QS V  HA+L+WI +CVARMGW+  M QFKEK+ +++E  
Sbjct: 67  EVTAAFIASGIDPKKHIVFNQSQVSGHAELAWIFNCVARMGWLGRMTQFKEKAGKDRE-N 125

Query: 126 ASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYA 185
           AS+GLF YPVLMAADILLYRATHVPVGEDQ+QHLE++R IAQ+FN +F   I+       
Sbjct: 126 ASVGLFDYPVLMAADILLYRATHVPVGEDQKQHLELSRDIAQKFNNDFGDSIRA------ 179

Query: 186 QEEQYSKG-FFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQ 244
             +  + G FFP+ E  I   A+R+ SLRD +KKMSKSD+SD SRINL D+ D IA+KI+
Sbjct: 180 --QGTNDGLFFPLPEPFITGPATRVMSLRDGTKKMSKSDASDNSRINLTDDADTIAQKIR 237

Query: 245 KAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           KAKTD + LP+E  GLE R EA NL+ IFA +      + L+ FGG  FS FK ALA+  
Sbjct: 238 KAKTDPEPLPTEEKGLEARPEADNLVGIFAALADRSKADVLRDFGGGQFSSFKNALAELC 297

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + ++ PI+ +++ L+ D  ++D IL EG++RAR  A ETMK   +IVG 
Sbjct: 298 VTKLAPIAGEMKRLVADPGHIDAILNEGSDRARAIADETMKLSKDIVGF 346


>gi|170741582|ref|YP_001770237.1| tryptophanyl-tRNA synthetase [Methylobacterium sp. 4-46]
 gi|168195856|gb|ACA17803.1| tryptophanyl-tRNA synthetase [Methylobacterium sp. 4-46]
          Length = 347

 Score =  354 bits (909), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 183/353 (51%), Positives = 239/353 (67%), Gaps = 10/353 (2%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENL 60
           M +   L  SGVQPTG LHLGNYLG I+  +  Q T     +Y + DLHAIT       L
Sbjct: 1   MPAFQELVFSGVQPTGNLHLGNYLGAIKRFVALQPTYATC-LYCVVDLHAITVWQNPTEL 59

Query: 61  RYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKE 120
             Q R   A+FLAAG+DP+R+++F QS V  HA+L+WI +CVAR+GW+N M QFKEK+ +
Sbjct: 60  TNQIREVTAAFLAAGIDPARSVVFNQSQVPQHAELAWIFNCVARLGWLNRMTQFKEKAGK 119

Query: 121 NKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEV 180
           ++E  AS+GL+ YPVLMAADIL YRATHVPVGEDQ+QHLE+TR IAQ+FNT+F   I   
Sbjct: 120 DRE-NASIGLYDYPVLMAADILAYRATHVPVGEDQKQHLELTRDIAQKFNTDFAASIAA- 177

Query: 181 AQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIA 240
                    + + FFP+ E LI   A+R+ SLRD +KKMSKSD SD+SRINL D+ D IA
Sbjct: 178 -------RGHGEAFFPLTEPLIGGPAARVMSLRDGTKKMSKSDPSDYSRINLTDDADAIA 230

Query: 241 KKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLAL 300
           +K++KAKTD + LPSEV+GL  R EA NL+ IFA +R +  E+ L+ FGG  FS FK AL
Sbjct: 231 QKVRKAKTDAEPLPSEVAGLAGRPEADNLVGIFAALRDVSREDVLRDFGGAQFSAFKGAL 290

Query: 301 ADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            D  +E + PI  +++ L+ D +++D +L EGA RA   A   +  V +IVG 
Sbjct: 291 VDLAVETLGPIGGEMKRLVADPAHIDRVLAEGAARAEAIAAPNLAAVKDIVGF 343


>gi|298293919|ref|YP_003695858.1| tryptophanyl-tRNA synthetase [Starkeya novella DSM 506]
 gi|296930430|gb|ADH91239.1| tryptophanyl-tRNA synthetase [Starkeya novella DSM 506]
          Length = 343

 Score =  354 bits (908), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 177/344 (51%), Positives = 238/344 (69%), Gaps = 11/344 (3%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQPTG LHLGNYLG I+  +  Q++ + L  Y + D+HAIT       L+ Q R   A
Sbjct: 9   SGVQPTGNLHLGNYLGAIQRFVALQDSYDCL--YCVVDMHAITVWQDPAELKKQIREVTA 66

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           +F+AAG+DP+++I+F QS V  HA+L+W+ +CVAR+GW+N M QFKEK+ +++E  AS+G
Sbjct: 67  AFIAAGIDPTKHIVFNQSQVSGHAELAWVFNCVARLGWLNRMTQFKEKAGKDRE-NASVG 125

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L+ YP LMAADILLYRATHVPVGEDQ+QHLE+ R IAQ+FN +F   +  +  + A    
Sbjct: 126 LYAYPNLMAADILLYRATHVPVGEDQKQHLELARDIAQKFNNDFGPSMAMLGIEGA---- 181

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
               FFP  E LI   A+R+ SLRD SKKMSKSD SD SRINL D+ D +A KI+KAKTD
Sbjct: 182 ----FFPQPEPLIGGPAARVMSLRDGSKKMSKSDPSDLSRINLTDDADTVASKIRKAKTD 237

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            + LPSE  GL+ R EA+NL+ I+A +  +  E+ L +FGG  FS FK AL D  + ++ 
Sbjct: 238 PEPLPSEAEGLKGRPEAENLVGIYAALADVSKEKVLAEFGGGQFSTFKAALVDLSVAKLG 297

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PI  +++ L+ + S++D IL +GA RAR  A ETM +V +IVG 
Sbjct: 298 PIGGEMKRLVSEPSHIDAILRDGAARARVIADETMHHVKDIVGF 341


>gi|304393803|ref|ZP_07375728.1| tryptophan--tRNA ligase [Ahrensia sp. R2A130]
 gi|303294002|gb|EFL88377.1| tryptophan--tRNA ligase [Ahrensia sp. R2A130]
          Length = 356

 Score =  353 bits (907), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 169/346 (48%), Positives = 241/346 (69%), Gaps = 5/346 (1%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQPTG LHLGNYLG I+  +  QE+  H  +Y + DLHAIT       L+   R   A
Sbjct: 10  SGVQPTGNLHLGNYLGAIKKFVALQES--HDCIYCVVDLHAITVWQDPAELQQNIREVTA 67

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           +F+A+G+DP+++I+F QS V  HA+L+W+ +CVARMGW++ M QFKEK+ +++E+ AS+G
Sbjct: 68  AFIASGIDPTKHIVFNQSQVSEHAELAWVFNCVARMGWLSRMTQFKEKAGKDREK-ASVG 126

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE-- 187
           LF YP LMA+DIL YRATHVPVGEDQ+QHLE+TR IAQ+FN ++  +I ++      +  
Sbjct: 127 LFSYPTLMASDILTYRATHVPVGEDQKQHLELTRDIAQKFNNDYSDRIAQLDLGVPMQVG 186

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
           +++  G+FP+ E +I   A+R+ SLRD +KKMSKSD SD SRI + D+ D IAKK +KAK
Sbjct: 187 DEHVNGYFPLTEPIIGGPAARVMSLRDGTKKMSKSDPSDLSRIVMTDDADTIAKKFKKAK 246

Query: 248 TDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
           TD D LPSE+ GL++R EA NL+ ++A +        L +FGG  F  FK ALAD  ++ 
Sbjct: 247 TDPDALPSEIEGLKDRPEADNLVGLYAALSDTDKASVLGEFGGAQFGTFKPALADLAVDR 306

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           I PI+ +++ L+ D +++D IL +G+ +AR  A++T+    EIVG 
Sbjct: 307 IGPIANEMRRLMDDHTHIDAILADGSEQARAIARKTLADTKEIVGF 352


>gi|319898611|ref|YP_004158704.1| Tryptophanyl-tRNA synthetase [Bartonella clarridgeiae 73]
 gi|319402575|emb|CBI76120.1| Tryptophanyl-tRNA synthetase [Bartonella clarridgeiae 73]
          Length = 355

 Score =  353 bits (905), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 178/354 (50%), Positives = 247/354 (69%), Gaps = 12/354 (3%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           L  SGVQP+G LHLGNYLG I+  +  Q   ++  +Y + D+HA+T N    +L   +R+
Sbjct: 7   LVFSGVQPSGHLHLGNYLGAIKQWVDLQ--ASYKCLYCVVDMHALTTNPDSLSLAESTRM 64

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A+FLAAG+DP + IIF QS V  HA+L+WI +C+AR+GW+  M QFK+K+ +N+E+T 
Sbjct: 65  VTAAFLAAGIDPQKQIIFNQSRVFQHAELAWIFNCIARIGWLQRMTQFKDKAGKNREQT- 123

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEV-----A 181
           SLGLF YP LMAADIL+YRATHVPVGEDQ QH+E+TR IAQ+FN  +  +I  +      
Sbjct: 124 SLGLFAYPSLMAADILVYRATHVPVGEDQTQHIELTRDIAQKFNNIYANRIANLNFGVSM 183

Query: 182 QKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAK 241
           Q   Q EQ    FFP+ E L  ++A RI SLRD +KKMSKSD SDFSRINL+D+ D+I +
Sbjct: 184 QNGQQSEQV---FFPMPEAL-RNTAMRIMSLRDGTKKMSKSDPSDFSRINLIDDADLIVQ 239

Query: 242 KIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALA 301
           KI+KAKTD   LP  ++ L+ R E  NL+ I+A   +I  E+AL +F GK FS FK ALA
Sbjct: 240 KIRKAKTDSIPLPDTLTDLQKRPEINNLLGIYAAFAEISKEKALLEFSGKQFSIFKSALA 299

Query: 302 DAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLSH 355
           D ++ ++ PI+Q+++ L ++K+Y+D++L +GA R+   A++ MK + EIVG  H
Sbjct: 300 DIIVHKLAPITQELRRLYQEKTYIDSVLFDGAQRSSLLAEKNMKKIREIVGFVH 353


>gi|319406949|emb|CBI80586.1| Tryptophanyl-tRNA synthetase [Bartonella sp. 1-1C]
          Length = 356

 Score =  353 bits (905), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 174/351 (49%), Positives = 250/351 (71%), Gaps = 5/351 (1%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           L  SGVQP+G LHLGNYLG I+  +  Q +  +  +Y I D+HA+T N    +L   + +
Sbjct: 7   LVFSGVQPSGHLHLGNYLGAIKQWVDLQTS--YKCLYCIVDMHALTINPDPLSLAESTYM 64

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A+FLAAG+DP + IIF QS V  HA+L+WI +C+AR+GW+  M QFK+K+++N+E+T 
Sbjct: 65  MTAAFLAAGIDPQKQIIFNQSRVFQHAELAWIFNCIARIGWLQRMTQFKDKARKNREQT- 123

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           SLGLF YP LMAADIL+Y ATHVPVGEDQ QH+E+TR IAQ+FN+ +  +I  +    + 
Sbjct: 124 SLGLFAYPSLMAADILIYHATHVPVGEDQTQHIELTRDIAQKFNSIYADRITNLNFGISM 183

Query: 187 E--EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQ 244
           +  E+  + FFP+ E +I+ +A RI SLRD +KKMSKSD SDFSRINL+D+ ++I +KI+
Sbjct: 184 QNGEKNEQIFFPMPEAIINKTAMRIMSLRDGTKKMSKSDPSDFSRINLIDDANLIVQKIR 243

Query: 245 KAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           KAKTD   LP  ++ L+ R E  NL+ I+A+  +I  E+AL +F GK FS FK ALAD +
Sbjct: 244 KAKTDSTPLPDTLNDLQKRPEVNNLLGIYASFAEISKEKALLEFSGKQFSLFKSALADLI 303

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLSH 355
           + ++ PI+Q+++ L ++K+Y++++L +GA RA   A++ MK V EIVG  H
Sbjct: 304 VHKLAPITQELRRLYQEKTYINSVLFDGAQRASLLAEKNMKKVREIVGFIH 354


>gi|209547638|ref|YP_002279555.1| tryptophanyl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209533394|gb|ACI53329.1| tryptophanyl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 354

 Score =  351 bits (901), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 178/349 (51%), Positives = 242/349 (69%), Gaps = 5/349 (1%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           L  SGVQPTG LHLGNYLG IR  +  QE  + +  Y + D+HA+T  +V E++  Q+R 
Sbjct: 7   LVFSGVQPTGNLHLGNYLGAIRRFVALQEGNDCI--YCVVDMHALTAQLVHEDMPSQTRS 64

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A+F+AAG+DP ++I+F QS V  HA+L+WI +CVAR+GWMN M QFK+K+ +++E+ A
Sbjct: 65  IAAAFIAAGIDPEKHIVFNQSAVPQHAELAWIFNCVARIGWMNRMTQFKDKAGKDREQ-A 123

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQ--KY 184
           SLGL+ YP LMAADIL+YRATHVPVGEDQ+QHLE+ R IA +FN ++   I++       
Sbjct: 124 SLGLYAYPSLMAADILVYRATHVPVGEDQKQHLELARDIAMKFNLDYAEHIRKTGYGIDI 183

Query: 185 AQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQ 244
               +    +FP++E LI   A R+ SLRD +KKMSKSD SD SRINL+D+ D I+KKI+
Sbjct: 184 TVGNEPVHAYFPMVEPLIGGPAPRVMSLRDGTKKMSKSDPSDLSRINLMDDEDAISKKIR 243

Query: 245 KAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           KAKTD D LPSEV GL+ R EA NL+ I+A +      E L +FGG+ FS FK AL D  
Sbjct: 244 KAKTDPDGLPSEVDGLQGRPEADNLVAIYAALADKSKAEVLAEFGGQQFSVFKPALVDLA 303

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           I  + PI+ +++ L+ D S++D IL +G  RAR RA+ TM  V +++G 
Sbjct: 304 IHVLAPITGEMRRLMDDTSHIDAILRKGGERARARAEVTMSQVRDVIGF 352


>gi|307943359|ref|ZP_07658703.1| tryptophan--tRNA ligase [Roseibium sp. TrichSKD4]
 gi|307772989|gb|EFO32206.1| tryptophan--tRNA ligase [Roseibium sp. TrichSKD4]
          Length = 363

 Score =  349 bits (896), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 177/349 (50%), Positives = 235/349 (67%), Gaps = 8/349 (2%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQ-ENLRYQSRLFV 68
           SGVQPTG LHLGNYLG +   +  Q+    +  + + D HAIT +    + L   +R   
Sbjct: 14  SGVQPTGNLHLGNYLGAVSRWVPLQDQMPTI--FCVVDSHAITASFPNPQELTDATREVT 71

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A+++AAG+DP ++IIF QS V  H +L+WI +CVARMGW+N M QFKEK+ +NKE  AS+
Sbjct: 72  AAYMAAGIDPKKSIIFNQSQVREHTELAWIFNCVARMGWLNRMTQFKEKAGKNKE-NASV 130

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKE----VAQKY 184
           GLF YP LMAADIL YRATHVPVG+DQ+QHLE+TR IA +FN +F  +I E    V    
Sbjct: 131 GLFAYPNLMAADILAYRATHVPVGDDQKQHLELTRDIAAKFNNDFAERITELGIGVPNPT 190

Query: 185 AQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQ 244
              E     +FP+ E +I   A+RI SLRD +KKMSKSD SD SRINL D+ D IAKKI+
Sbjct: 191 PSPELPENLYFPLTEPMIAGPATRIMSLRDGTKKMSKSDPSDLSRINLKDDADAIAKKIR 250

Query: 245 KAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           KAKTD D LPSEV GL++R EA NL+ I+A +     E  LK FGG+ FS FK AL+D  
Sbjct: 251 KAKTDPDALPSEVDGLKDRPEADNLVGIYAALAGSTKEAVLKDFGGQQFSAFKPALSDLA 310

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           +E++ P++ +++ L +D S +D +L +GA +A   A+  +K V +IVG 
Sbjct: 311 VEKLSPMTNEMRRLTEDTSEIDAVLKDGAEQASAIAEPVLKDVRKIVGF 359


>gi|218461567|ref|ZP_03501658.1| tryptophanyl-tRNA synthetase [Rhizobium etli Kim 5]
          Length = 354

 Score =  349 bits (896), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 178/351 (50%), Positives = 243/351 (69%), Gaps = 9/351 (2%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           L  SGVQPTG LHLGNYLG IR  +  QE  + +  Y + D+HA+T  +V E++  Q+R 
Sbjct: 7   LVFSGVQPTGNLHLGNYLGAIRRFVALQEGNDCI--YCVVDMHALTAQLVHEDMPSQTRS 64

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A+F+AAG+DP ++I+F QS V  HA+L+WI +CVAR+GWMN M QFK+K+ +++E+ A
Sbjct: 65  IAAAFIAAGIDPEKHIVFNQSAVPQHAELAWIFNCVARIGWMNRMTQFKDKAGKDREQ-A 123

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           SLGL+ YP LMAADIL+YRATHVPVGEDQ+QHLE+ R IA +FN ++   I      Y  
Sbjct: 124 SLGLYAYPSLMAADILVYRATHVPVGEDQKQHLELARDIAMKFNLDYAEHIGRTG--YGV 181

Query: 187 E----EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKK 242
           +    ++    +FP++E LI   A R+ SLRD +KKMSKSD SD SRINL+D+ D I+KK
Sbjct: 182 DITVGDEPVHAYFPMVEPLIGGPAPRVMSLRDGTKKMSKSDPSDLSRINLMDDEDAISKK 241

Query: 243 IQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALAD 302
           I+KAKTD D LPSE  GL+ R EA NL+ I+A +      + L +FGG+ FS FK AL D
Sbjct: 242 IRKAKTDPDGLPSETDGLQGRPEADNLVAIYAALADTSKSQVLAEFGGQQFSVFKPALVD 301

Query: 303 AVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
             I  + PI+ +++ L+ D S++D IL +G  RAR RA+ TMK V +++G 
Sbjct: 302 LAINVLAPITGEMRRLMDDTSHIDAILRKGGERARERAEVTMKQVRDVIGF 352


>gi|190890053|ref|YP_001976595.1| tryptophanyl-tRNA synthetase [Rhizobium etli CIAT 652]
 gi|190695332|gb|ACE89417.1| tryptophanyl-tRNA synthetase protein [Rhizobium etli CIAT 652]
          Length = 354

 Score =  349 bits (895), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 176/349 (50%), Positives = 242/349 (69%), Gaps = 5/349 (1%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           L  SGVQPTG LHLGNYLG IR  +  QE  + +  Y + D+HA+T  +V E++  Q+R 
Sbjct: 7   LVFSGVQPTGNLHLGNYLGAIRRFVALQEGNDCI--YCVVDMHALTAQLVHEDMPSQTRS 64

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A+F+AAG+DP ++I+F QS V  HA+L+WI +CVAR+GWMN M QFK+K+ +++E+ A
Sbjct: 65  IAAAFIAAGIDPEKHIVFNQSAVPQHAELAWIFNCVARIGWMNRMTQFKDKAGKDREQ-A 123

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQ--KY 184
           SLGL+ YP LMAADIL+YRATHVPVGEDQ+QHLE+ R IA +FN ++ + I         
Sbjct: 124 SLGLYAYPSLMAADILVYRATHVPVGEDQKQHLELARDIAMKFNLDYAQHIARTGYGIDI 183

Query: 185 AQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQ 244
              ++    +FP++E LI   A R+ SLRD +KKMSKSD SD SRINL+D+ D I+KKI+
Sbjct: 184 TVGDEPVHAYFPMVEPLIGGPAPRVMSLRDGTKKMSKSDPSDLSRINLMDDEDAISKKIR 243

Query: 245 KAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           KAKTD D LPSE+ GL+ R EA NL+ I+A +      E L +FGG+ FS FK AL D  
Sbjct: 244 KAKTDPDGLPSEIDGLQGRPEADNLVAIYAALADKSKSEVLAEFGGQQFSVFKPALVDLA 303

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           I  + PI+ +++ L+ D S++D IL +G  RAR RA+ TM  + +++G 
Sbjct: 304 IHVLAPITGEMRRLMDDTSHIDAILRKGGERARARAEVTMNQLRDVIGF 352


>gi|254472455|ref|ZP_05085855.1| tryptophanyl-tRNA synthetase [Pseudovibrio sp. JE062]
 gi|211958738|gb|EEA93938.1| tryptophanyl-tRNA synthetase [Pseudovibrio sp. JE062]
          Length = 360

 Score =  349 bits (895), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 178/348 (51%), Positives = 234/348 (67%), Gaps = 7/348 (2%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQPTG LHLGNYLG I   +  Q+    +  + I D+HAIT       L  Q+R   A
Sbjct: 10  SGVQPTGNLHLGNYLGAIVRFVPLQDQMPTI--FSIVDMHAITVWQDPAELTQQTREVTA 67

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           ++LAAGVDP ++IIF QS V  HA+L+WI +C+ARMGW+  M QFK+K+ +N E  AS+G
Sbjct: 68  AYLAAGVDPKKSIIFNQSQVKEHAELAWIFNCIARMGWLKRMTQFKDKAGKNAE-NASVG 126

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKE----VAQKYA 185
           LF YP LMAADIL YRATHVPVG+DQ+QHLE+TR IAQ+FN +F  +IKE    V     
Sbjct: 127 LFAYPNLMAADILAYRATHVPVGDDQKQHLELTRDIAQKFNNDFAERIKELGLGVPNPEP 186

Query: 186 QEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQK 245
             E   + +FPI E +I   A+RI SLRD +KKMSKSD SD SRINL D+ D IAKKI+K
Sbjct: 187 SHEAPDELYFPITEPMITGPATRIMSLRDGNKKMSKSDPSDLSRINLTDDQDTIAKKIRK 246

Query: 246 AKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVI 305
           AKTD + LPSEV GLE R EA NL+ I+A +      E L +FGG+ FS FK AL++  +
Sbjct: 247 AKTDPEALPSEVDGLEGRAEADNLVGIYAALAGKSKAEVLGEFGGQQFSAFKPALSELAV 306

Query: 306 EEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           E++ P++ +++ ++ D + +D +L +GA RA   A+  +  V  IVG 
Sbjct: 307 EKLAPMNNEMRRIMDDPASVDAVLRDGAERAAEIAEPVLHDVRRIVGF 354


>gi|241202792|ref|YP_002973888.1| tryptophanyl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240856682|gb|ACS54349.1| tryptophanyl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 354

 Score =  348 bits (894), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 177/351 (50%), Positives = 243/351 (69%), Gaps = 9/351 (2%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           L  SGVQPTG LHLGNYLG IR  +  QE  + +  Y + D+HA+T  +V E++  Q+R 
Sbjct: 7   LVFSGVQPTGNLHLGNYLGAIRRFVALQEGNDCI--YCVVDMHALTAQLVHEDMPSQTRS 64

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A+F+AAG+DP ++I+F QS V  HA+L+WI +CVAR+GWMN M QFK+K+ +++E+ A
Sbjct: 65  IAAAFIAAGIDPEKHIVFNQSAVPQHAELAWIFNCVARIGWMNRMTQFKDKAGKDREQ-A 123

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           SLGL+ YP LMAADIL+YRATHVPVGEDQ+QHLE+ R IA +FN ++   I      Y  
Sbjct: 124 SLGLYAYPSLMAADILVYRATHVPVGEDQKQHLELARDIAMKFNLDYAEHISRTG--YGV 181

Query: 187 E----EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKK 242
           +     +    +FP++E LI   A R+ SLRD +KKMSKSD SD SRINL+D+ D I+KK
Sbjct: 182 DITVGNEPVHAYFPMVEPLIGGPAPRVMSLRDGTKKMSKSDPSDLSRINLMDDEDAISKK 241

Query: 243 IQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALAD 302
           I+KAKTD D LPSE+ GL+ R EA NL+ I+A +      + L +FGG+ FS FK AL D
Sbjct: 242 IRKAKTDPDGLPSEIDGLQGRPEADNLVAIYAALADKSKADVLAEFGGQQFSVFKPALVD 301

Query: 303 AVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
             I  + PI+ +++ L+ D S++D IL +G  RAR RA+ TM+ V +++G 
Sbjct: 302 LAINVLAPITGEMRRLMDDTSHIDAILRKGGERARARAEVTMRQVRDVIGF 352


>gi|327188583|gb|EGE55793.1| tryptophanyl-tRNA synthetase protein [Rhizobium etli CNPAF512]
          Length = 354

 Score =  348 bits (894), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 176/349 (50%), Positives = 241/349 (69%), Gaps = 5/349 (1%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           L  SGVQPTG LHLGNYLG IR  +  QE  + +  Y + D+HA+T  +V E++  Q+R 
Sbjct: 7   LVFSGVQPTGNLHLGNYLGAIRRFVALQEGNDCI--YCVVDMHALTAQLVHEDMPSQTRS 64

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A+F+AAG+DP ++I+F QS V  HA+L+WI +CVAR+GWMN M QFK+K+ +++E+ A
Sbjct: 65  IAAAFIAAGIDPEKHIVFNQSAVPQHAELAWIFNCVARIGWMNRMTQFKDKAGKDREQ-A 123

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQ--KY 184
           SLGL+ YP LMAADIL+YRATHVPVGEDQ+QHLE+ R IA +FN ++ + I         
Sbjct: 124 SLGLYAYPSLMAADILVYRATHVPVGEDQKQHLELARDIAMKFNLDYAQHIARTGYGIDI 183

Query: 185 AQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQ 244
              ++    +FP++E LI   A R+ SLRD +KKMSKSD SD SRINL+D+ D I+KKI+
Sbjct: 184 TVGDEPVHAYFPMVEPLIGGPAPRVMSLRDGTKKMSKSDPSDLSRINLMDDEDAISKKIR 243

Query: 245 KAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           KAKTD D LPSE+ GL+ R EA NL+ I+A +      E L +FGG  FS FK AL D  
Sbjct: 244 KAKTDPDGLPSEIDGLQGRPEADNLVAIYAALADKSKSEVLAEFGGHQFSVFKPALVDLA 303

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           I  + PI+ +++ L+ D S++D IL +G  RAR RA+ TM  + +++G 
Sbjct: 304 IHVLAPITGEMRRLMDDTSHIDAILRKGGERARARAEVTMNQLRDVIGF 352


>gi|116250171|ref|YP_766009.1| tryptophanyl-tRNA synthetase [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115254819|emb|CAK05893.1| putative tryptophanyl-tRNA synthetase [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 354

 Score =  348 bits (894), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 177/351 (50%), Positives = 243/351 (69%), Gaps = 9/351 (2%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           L  SGVQPTG LHLGNYLG IR  +  QE  + +  Y + D+HA+T  +V E++  Q+R 
Sbjct: 7   LVFSGVQPTGNLHLGNYLGAIRRFVALQEGNDCI--YCVVDMHALTAQLVHEDMPSQTRS 64

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A+F+AAG+DP ++I+F QS V  HA+L+WI +CVAR+GWMN M QFK+K+ +++E+ A
Sbjct: 65  IAAAFIAAGIDPEKHIVFNQSAVPQHAELAWIFNCVARIGWMNRMTQFKDKAGKDREQ-A 123

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           SLGL+ YP LMAADIL+YRATHVPVGEDQ+QHLE+ R IA +FN ++   I      Y  
Sbjct: 124 SLGLYAYPSLMAADILVYRATHVPVGEDQKQHLELARDIAMKFNLDYAEHISRTG--YGV 181

Query: 187 E----EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKK 242
           +     +    +FP++E LI   A R+ SLRD +KKMSKSD SD SRINL+D+ D I+KK
Sbjct: 182 DITVGNEPVHAYFPMVEPLIGGPAPRVMSLRDGTKKMSKSDPSDLSRINLMDDEDAISKK 241

Query: 243 IQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALAD 302
           I+KAKTD D LPSE+ GL+ R EA NL+ I+A +      + L +FGG+ FS FK AL D
Sbjct: 242 IRKAKTDPDGLPSEIDGLQGRPEADNLVAIYAALADKSKADVLAEFGGQQFSVFKPALVD 301

Query: 303 AVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
             I  + PI+ +++ L+ D S++D IL +G  RAR RA+ TM+ V +++G 
Sbjct: 302 LAINVLAPITGEMRRLMDDTSHIDAILRKGGERARARAEVTMRQVRDVIGF 352


>gi|86356040|ref|YP_467932.1| tryptophanyl-tRNA synthetase [Rhizobium etli CFN 42]
 gi|86280142|gb|ABC89205.1| tryptophanyl-tRNA synthetase protein [Rhizobium etli CFN 42]
          Length = 354

 Score =  348 bits (894), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 177/349 (50%), Positives = 242/349 (69%), Gaps = 5/349 (1%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           L  SGVQPTG LHLGNYLG IR  +  QE  + +  Y + D+HA+T  +V E++  Q+R 
Sbjct: 7   LVFSGVQPTGNLHLGNYLGAIRRFVALQEGNDCI--YCVVDMHALTAQLVHEDMPSQTRS 64

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A+F+AAG+DP ++I+F QS V  HA+L+WI +CVAR+GWMN M QFK+K+ +++E+ A
Sbjct: 65  IAAAFIAAGIDPEKHIVFNQSAVPQHAELAWIFNCVARIGWMNRMTQFKDKAGKDREQ-A 123

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQ--KY 184
           SLGL+ YP LMAADIL+YRATHVPVGEDQ+QHLE+ R IA +FN ++   I++       
Sbjct: 124 SLGLYAYPSLMAADILVYRATHVPVGEDQKQHLELARDIAMKFNLDYAEHIRKSGYGIDI 183

Query: 185 AQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQ 244
              ++    +FP++E LI   A R+ SLRD +KKMSKSD SD SRINL+D+ + I+KKI+
Sbjct: 184 TVGDEPVHAYFPMVEPLIGGPAPRVMSLRDGTKKMSKSDPSDLSRINLMDDEEAISKKIR 243

Query: 245 KAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           KAKTD D LPSEV GL+ R EA NL+ I+A +      E L  FGG+ FS FK AL D  
Sbjct: 244 KAKTDPDGLPSEVDGLQGRPEADNLVAIYAALADKSKAEVLADFGGQQFSVFKPALVDLA 303

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           I  + PI+ +++ L+ D S++D IL +G  RAR RA+ TM  V +++G 
Sbjct: 304 IHVLAPITGEMRRLMDDTSHIDAILRKGGERARARAEVTMSQVRDVIGF 352


>gi|300024978|ref|YP_003757589.1| tryptophanyl-tRNA synthetase [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299526799|gb|ADJ25268.1| tryptophanyl-tRNA synthetase [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 345

 Score =  347 bits (891), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 174/348 (50%), Positives = 235/348 (67%), Gaps = 12/348 (3%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           L  SG+QPTG LHLGNYLG + N I  Q+T  H  +Y + DLHAIT       LR+  R 
Sbjct: 6   LVFSGMQPTGSLHLGNYLGAMVNWIEMQKT--HSCIYCVVDLHAITVWQEPAELRHAIRQ 63

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A+++AAG+DP ++I+F QS V  HA+L+WI +CVAR+GW+N M QFKEK+ +++E+ A
Sbjct: 64  VTATYIAAGLDPKKSILFNQSQVSAHAELAWIFNCVARLGWLNRMTQFKEKAGKDREQ-A 122

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           S+GL+ YP LMAADIL YRATHVPVGEDQ+QHLE+ R IAQ+FN +F ++I         
Sbjct: 123 SVGLYAYPNLMAADILAYRATHVPVGEDQKQHLELARDIAQKFNNDFNKEIVAAG----- 177

Query: 187 EEQYSKG-FFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQK 245
              +  G FFP+ E +I   A+R+ SLRD +KKMSKSD SD SRIN+ D+ D IAKKIQK
Sbjct: 178 ---FEDGIFFPLPEPVITGPATRVMSLRDGTKKMSKSDPSDLSRINMTDDADTIAKKIQK 234

Query: 246 AKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVI 305
           AKTD + LPS+  G E R EA+NL+ I+A +    + + LK++GG+ FS FK ALA+   
Sbjct: 235 AKTDPEPLPSDEEGFEGRPEAENLVGIYAALSGQPVADVLKEYGGQQFSSFKKALAEVAT 294

Query: 306 EEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           E++  I  +   L+ D + +D IL +G+ RAR   +  M  V +IVG 
Sbjct: 295 EKVGRIGAEAAKLMGDPAEIDRILADGSARARAVTEPVMAKVKDIVGF 342


>gi|323138814|ref|ZP_08073878.1| tryptophanyl-tRNA synthetase [Methylocystis sp. ATCC 49242]
 gi|322395962|gb|EFX98499.1| tryptophanyl-tRNA synthetase [Methylocystis sp. ATCC 49242]
          Length = 344

 Score =  347 bits (890), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 173/344 (50%), Positives = 235/344 (68%), Gaps = 11/344 (3%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQ TG LHLGNYLG I   +  Q+    L  Y + DLHAIT       L+  +R   A
Sbjct: 10  SGVQSTGNLHLGNYLGAIVKFVELQKAFECL--YCVVDLHAITVPQDPIALKANTREIAA 67

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           +F+A G+DP +NI+F QS V  HA+L+W+L+CVAR+GW+N M QFK+K+ +++E  AS+G
Sbjct: 68  AFIACGIDPKQNIVFNQSQVPEHAELAWVLNCVARIGWLNRMTQFKDKAGKDRE-NASMG 126

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L  YPVLMAADIL+YRATHVPVG+DQ+QHLE+ R IAQ+FN +F   I        +   
Sbjct: 127 LLDYPVLMAADILIYRATHVPVGDDQKQHLELARDIAQKFNNDFGPSI--------ERNG 178

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
           +   FFP+ E LI   A+R+ SLRD +KKMSKSD+SD+SRINL D+ D IA+K++KAKTD
Sbjct: 179 FGGAFFPLPEPLISGPATRVMSLRDGTKKMSKSDASDYSRINLSDDADQIAQKVRKAKTD 238

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            + LPSE  GLE R EA NL+ IFA +      + L ++GG NFS FK AL D  + ++ 
Sbjct: 239 PEALPSEEKGLEGRPEADNLVGIFAALAGRTKADVLTEYGGSNFSTFKNALVDLAVAKLA 298

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PI+ +++ + +D+SY+D +L +G+ RAR  A+E M  V +IVG 
Sbjct: 299 PITAQMRRIREDESYIDGVLRDGSERARAIARENMNAVKDIVGF 342


>gi|254460614|ref|ZP_05074030.1| tryptophanyl-tRNA synthetase [Rhodobacterales bacterium HTCC2083]
 gi|206677203|gb|EDZ41690.1| tryptophanyl-tRNA synthetase [Rhodobacteraceae bacterium HTCC2083]
          Length = 339

 Score =  344 bits (883), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 172/344 (50%), Positives = 230/344 (66%), Gaps = 19/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G L LGNYLG I+  +  QE+     +Y + DLHAIT      +LR+ +R   A
Sbjct: 12  SGIQPSGGLTLGNYLGAIKRFVDMQESGVET-LYCMVDLHAITVWQDPADLRHNTRELAA 70

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            ++AAG+DP+++I+F QS V  HA+L WI +CVARMGWM  M QFK+K+ +N E  ASLG
Sbjct: 71  GYIAAGLDPTKSILFNQSQVSAHAELGWIFNCVARMGWMKRMTQFKDKAGKNAE-NASLG 129

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LMAADIL+Y +THVPVGEDQ+QHLE+TR +A +FN +F                
Sbjct: 130 LFGYPALMAADILIYHSTHVPVGEDQKQHLELTRDVATKFNHDF---------------- 173

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
               FFPI E +I+ +A+R+ SLRD SKKMSKSD SD SRIN+ D+ + IAKKI+KAKTD
Sbjct: 174 -GVDFFPITEPVIEGAATRVMSLRDGSKKMSKSDPSDASRINMTDDAETIAKKIRKAKTD 232

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            D LPSE  GL+ R EA+NL+ IFA +    ++  L   GGK FS+FK  L D  +E++ 
Sbjct: 233 PDALPSEADGLKERHEARNLVNIFAALSDQSVDAVLADVGGKQFSEFKPMLVDLAVEKLS 292

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PIS ++  L+ D + +D IL EG+NRAR  A   ++   +IVG+
Sbjct: 293 PISTEMARLMNDPAEIDRILGEGSNRARTIANPILQKTYDIVGM 336


>gi|182677357|ref|YP_001831503.1| tryptophanyl-tRNA synthetase [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182633240|gb|ACB94014.1| tryptophanyl-tRNA synthetase [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 344

 Score =  344 bits (882), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 175/348 (50%), Positives = 232/348 (66%), Gaps = 11/348 (3%)

Query: 6   NLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSR 65
           N   SG+QPTG LHLGNYLG I   I  Q+T  H  +Y + DLHAIT     + LR   R
Sbjct: 6   NRVFSGIQPTGHLHLGNYLGAIIKFIELQKT--HDCLYCVVDLHAITVAQNPDELRAHIR 63

Query: 66  LFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEET 125
              A+++A G+D  + IIF QS V  HA+L+W+L+CVAR+GW+N M QFKEK+ +++E  
Sbjct: 64  ELTAAYIACGIDYEKQIIFNQSQVSGHAELAWVLNCVARVGWLNRMTQFKEKAGKDRE-N 122

Query: 126 ASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYA 185
           AS+GL+ YP+LMAADILLY+ATHVPVGEDQ+QHLE+ R IAQ+FN +F   I        
Sbjct: 123 ASVGLYDYPILMAADILLYKATHVPVGEDQKQHLELARDIAQKFNLDFASAIAA------ 176

Query: 186 QEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQK 245
               +   FFP+ E LI   A R+ SLRD +KKMSKSD SD SRINL D+ + IA+KI+K
Sbjct: 177 --HGFEDAFFPLPEPLIQGPAQRVMSLRDGTKKMSKSDPSDNSRINLSDDAEAIAQKIRK 234

Query: 246 AKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVI 305
           AKTD + LPSEV GL  R EA+NL+ I+A +      + LK FGG NFS FK AL D  +
Sbjct: 235 AKTDPEALPSEVEGLAKRPEAENLVGIYAALIGETKADVLKTFGGGNFSTFKTALVDLAV 294

Query: 306 EEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           +++ PI  +++ L  + +++D +LV GA RAR  A+  M  V +I+G 
Sbjct: 295 DKLGPIGAEMKRLKAETAFIDQVLVNGATRARALAEPHMAAVKDIMGF 342


>gi|325291783|ref|YP_004277647.1| Tryptophanyl-tRNA synthetase [Agrobacterium sp. H13-3]
 gi|325059636|gb|ADY63327.1| Tryptophanyl-tRNA synthetase [Agrobacterium sp. H13-3]
          Length = 354

 Score =  343 bits (879), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 175/349 (50%), Positives = 239/349 (68%), Gaps = 5/349 (1%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           L  SGVQPTG LHLGNYLG IR  +  QE  + +  Y + D+HAIT  +V  +L+ Q+R 
Sbjct: 7   LVFSGVQPTGNLHLGNYLGAIRKFVALQEDNDCI--YCVVDMHAITAQLVHSDLKAQTRS 64

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A+F+AAG+DP ++I+F QS V  HA+L+WI +CVAR+GWM  M QFK+KS +N E+  
Sbjct: 65  IAAAFIAAGIDPVKHIVFNQSAVPQHAELAWIFNCVARIGWMERMTQFKDKSGKNAEQV- 123

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKE--VAQKY 184
           SLGL  YP LMAADIL+YRATHVPVG+DQ+QHLE+ R IAQ+FN +F   I+   +    
Sbjct: 124 SLGLLAYPSLMAADILVYRATHVPVGDDQKQHLELARDIAQKFNIDFGDHIRNAGLGLDI 183

Query: 185 AQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQ 244
               +    +FP++E LI   A R+ SL+D +KKMSKSD SD SRINL+D+ D I++KI+
Sbjct: 184 TVGNEPVHAYFPMVEPLIGGPAPRVMSLKDGTKKMSKSDPSDLSRINLMDDVDAISRKIK 243

Query: 245 KAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           KAKTD D LPSEV GL+ R EA+NL+ I+A +      E L +FGG+ FS FK AL +  
Sbjct: 244 KAKTDPDALPSEVEGLKGRPEAENLVGIYAALSDKTKAEVLLEFGGQQFSAFKPALVELA 303

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           +  + P++ +++ LL D +++D IL +G  RAR  A+ TM  V +I+G 
Sbjct: 304 VNVLAPVNNEMRRLLDDPTHIDAILKQGGERARAIAENTMNEVRDIIGF 352


>gi|254485676|ref|ZP_05098881.1| tryptophanyl-tRNA synthetase [Roseobacter sp. GAI101]
 gi|214042545|gb|EEB83183.1| tryptophanyl-tRNA synthetase [Roseobacter sp. GAI101]
          Length = 356

 Score =  342 bits (876), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 171/345 (49%), Positives = 227/345 (65%), Gaps = 19/345 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQE-NLRYQSRLFV 68
           SG+QP+G L LGNYLG ++  +  Q   +   +Y + DLHAIT   +    LR+ +R   
Sbjct: 28  SGIQPSGGLTLGNYLGAMKRFVDMQNEGSFQTVYCMVDLHAITAKWLDPATLRHNTRELA 87

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A F+AAG+DP ++I+  QS V  HA L+WI +CVARMGWM  M Q+K+K+ +N E  ASL
Sbjct: 88  AGFIAAGIDPEQSILINQSQVPEHAQLAWIFNCVARMGWMGRMTQWKDKAGKNAE-AASL 146

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GLF YP LMAADIL+Y ATHVPVGEDQ+QHLE+TR IA +FN +                
Sbjct: 147 GLFAYPALMAADILIYHATHVPVGEDQKQHLELTRDIAAKFNHD---------------- 190

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
            Y   FFP+ E +I+ +A+R+ SLRD SKKMSKSD SD SRINL D+ D IAKKI+KAKT
Sbjct: 191 -YGVDFFPLTEPVIEGAATRVMSLRDGSKKMSKSDPSDASRINLTDDADTIAKKIRKAKT 249

Query: 249 DGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
           D D LPSEV GL++R EA+NL+ I+A +    +E+ L + GG+ F  FK  LAD  + ++
Sbjct: 250 DPDALPSEVEGLKDRPEARNLVNIYAALNDQTVEQVLAEVGGQQFGAFKPLLADLAVAKM 309

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            PIS ++  L+ D + +D IL  GAN+AR      +K   EIVG+
Sbjct: 310 SPISTRMAELMADTAEIDRILAHGANQAREITAPILKKTYEIVGM 354


>gi|328545861|ref|YP_004305970.1| aminoacyl-tRNA synthetase, class I:aminoacyl-tRNA synthetase, class
           Ib:Tryptophanyl-tRNA synthetase, class Ib [polymorphum
           gilvum SL003B-26A1]
 gi|326415601|gb|ADZ72664.1| Aminoacyl-tRNA synthetase, class I:Aminoacyl-tRNA synthetase, class
           Ib:Tryptophanyl-tRNA synthetase, class Ib [Polymorphum
           gilvum SL003B-26A1]
          Length = 359

 Score =  339 bits (870), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 167/349 (47%), Positives = 236/349 (67%), Gaps = 8/349 (2%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIV-QENLRYQSRLFV 68
           SGVQPTG LHLGNYLG +   +  Q+    +  + + DLHAIT      + L   +R   
Sbjct: 10  SGVQPTGNLHLGNYLGAVSRWVPLQDEMPSI--FCVVDLHAITAGFPDPKELSAATREVT 67

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A+++A+G+DP+++IIF QS V  HA+L+WI +CVARMGW+N M QFK+K+ +N+E  AS+
Sbjct: 68  AAYIASGIDPAKSIIFNQSQVKEHAELAWIFNCVARMGWLNRMTQFKDKAGKNRE-NASV 126

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKE----VAQKY 184
           GLF YP LMAADIL YRATHVPVG+DQ+QHLE+TR IAQ+FN +F  +I+E    V    
Sbjct: 127 GLFAYPNLMAADILAYRATHVPVGDDQKQHLELTRDIAQKFNNDFAERIRELGIGVPNPT 186

Query: 185 AQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQ 244
              E   + + P+ E +I   A+R+ SLRD +KKMSKSD SD SRINL D+ D I+KK++
Sbjct: 187 PSPELPDELYLPLTEPVIAGPATRVMSLRDGTKKMSKSDPSDLSRINLTDDADAISKKVK 246

Query: 245 KAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           KAKTD + LP E+ GL++R EA NL+ I+A +  +  E  L ++GG+ FS FK ALA+  
Sbjct: 247 KAKTDPEPLPGEMDGLKDRPEADNLVGIYAALAGMAKEAVLAEYGGQPFSVFKPALAEIA 306

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           +  + PI+ +++ L+ D + +D +L +GA RA   AQ  ++ +  IVG 
Sbjct: 307 VMRLAPIAGEMRRLMADPAEIDRVLKDGAERASAIAQPVLRDMRRIVGF 355


>gi|126724976|ref|ZP_01740819.1| tryptophanyl-tRNA synthetase [Rhodobacterales bacterium HTCC2150]
 gi|126706140|gb|EBA05230.1| tryptophanyl-tRNA synthetase [Rhodobacterales bacterium HTCC2150]
          Length = 338

 Score =  338 bits (866), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 167/344 (48%), Positives = 229/344 (66%), Gaps = 19/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G L LGNYLG I+  +  QE      +Y + DLHAIT       LR Q+R   A
Sbjct: 12  SGIQPSGGLTLGNYLGAIKRFVEMQENGIET-VYCMVDLHAITVWQDPAALRRQTRELAA 70

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            ++AAG+DP ++I+F QS V  HA L WI +CVARMGWMN M QFK+K+ +++E+  S+G
Sbjct: 71  GYIAAGLDPHKSILFNQSQVAEHAQLGWIFNCVARMGWMNRMTQFKDKAGKDREKV-SVG 129

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LMAADILLY ATHVPVGEDQ+QH+E+TR IA +FN +                 
Sbjct: 130 LFSYPTLMAADILLYHATHVPVGEDQKQHIELTRDIAAKFNHD----------------- 172

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
           Y   FFP+ E +I+ + +R+ SLRD SKKMSKSD SD SRIN+ D+ D IAKKI+KAK+D
Sbjct: 173 YGVDFFPMTEPVIEGAGTRVMSLRDGSKKMSKSDPSDASRINMTDDADAIAKKIRKAKSD 232

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            D LPSE +GL++R EA+NL+ I+A +  + +E+ L   GG+ FS+FK  LA+  + ++ 
Sbjct: 233 ADALPSEAAGLKDRPEARNLVNIYAGLADMSVEQVLADVGGRQFSEFKPMLAEMAVSKLS 292

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PIS ++  L++    +D +L  GA+RAR  A   ++   EIVG+
Sbjct: 293 PISSEMARLMQAPDEIDAVLRAGADRARAIAAPILEKTYEIVGM 336


>gi|149203456|ref|ZP_01880426.1| tryptophanyl-tRNA synthetase [Roseovarius sp. TM1035]
 gi|149143289|gb|EDM31328.1| tryptophanyl-tRNA synthetase [Roseovarius sp. TM1035]
          Length = 342

 Score =  338 bits (866), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 168/344 (48%), Positives = 227/344 (65%), Gaps = 19/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G LHLGNYLG ++     Q       +Y + DLHAIT      +L   +R   A
Sbjct: 12  SGIQPSGNLHLGNYLGALKRFAEAQNKGIQT-LYCMVDLHAITVWQNPADLARATRELAA 70

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            F+A+G+DP+++I+F QS V  H  ++W+ +CVARMGWM  M QFK+K+ +N +  ASLG
Sbjct: 71  GFIASGLDPAKSILFNQSQVAEHTQMAWVFNCVARMGWMQRMTQFKDKAGKNAQ-NASLG 129

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LMAADIL Y ATHVPVGEDQ+QHLE+TR IA +FN +                 
Sbjct: 130 LFAYPALMAADILTYHATHVPVGEDQKQHLELTRDIAIKFNHD----------------- 172

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
           Y   FFPI E +I+ +A+R+ SLRD S KMSKSD SD SRINL D+ D IAKKI+KAKTD
Sbjct: 173 YGVEFFPIPEPVIEGAATRVMSLRDGSNKMSKSDPSDMSRINLTDDADTIAKKIRKAKTD 232

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            + LPSE +GLE R EA+NL+ I+A +  + +++ + + GGK FS+FK  LAD  ++ I 
Sbjct: 233 PEPLPSEAAGLEGRPEARNLVNIYAALADMTVDQVMAEAGGKPFSEFKPMLADLAVDRIA 292

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PIS ++  L++D S +D IL +GA RAR  A   ++   EI+G+
Sbjct: 293 PISTEMARLMQDLSEIDRILADGAARARTIAAPILRQTYEIMGM 336


>gi|56695307|ref|YP_165655.1| tryptophanyl-tRNA synthetase [Ruegeria pomeroyi DSS-3]
 gi|56677044|gb|AAV93710.1| tryptophanyl-tRNA synthetase [Ruegeria pomeroyi DSS-3]
          Length = 338

 Score =  337 bits (863), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 170/348 (48%), Positives = 229/348 (65%), Gaps = 27/348 (7%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQ----ETCNHLGMYFIADLHAITNNIVQENLRYQSR 65
           SG+QP+G LHLGNYLG ++  +  Q    ET     +Y + DLHAIT     + L + +R
Sbjct: 12  SGIQPSGNLHLGNYLGALKRFVDMQGPEMET-----VYCMVDLHAITVWQDPKELAHSTR 66

Query: 66  LFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEET 125
              A F+AAG+DP ++I+F QS V  HA L+WI +CVARMGWM  M Q+K+K+ +N ++ 
Sbjct: 67  ELCAGFIAAGIDPEQSILFNQSQVPEHAQLAWIFNCVARMGWMQRMTQWKDKAGKN-QQN 125

Query: 126 ASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYA 185
           ASLGLF YP LMAADIL+Y ATHVPVGEDQ+QHLE+TR IA +FN +F            
Sbjct: 126 ASLGLFAYPSLMAADILIYHATHVPVGEDQKQHLELTRDIAIKFNNDF------------ 173

Query: 186 QEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQK 245
                   FFP+ E +I+ +A+R+ SLRD +KKMSKSD SD SRIN+ D+ D IA+KI+K
Sbjct: 174 -----GVDFFPVTEPVIEGAATRVMSLRDGTKKMSKSDPSDMSRINMTDDADAIAQKIRK 228

Query: 246 AKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVI 305
           AKTD D LPSE+ GLE R +A+NLI I+A +    +E+ L   GGK F +FK  LA+  +
Sbjct: 229 AKTDPDALPSEIDGLEGRPDARNLINIYAALADRSVEQVLADVGGKQFGEFKPMLAELAV 288

Query: 306 EEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            ++ PIS ++  L+ D++ +D IL  GA RAR      +K   EIVG+
Sbjct: 289 AKLSPISSEMARLMNDQAEIDRILARGAERARAITAPILKRTYEIVGM 336


>gi|83944323|ref|ZP_00956778.1| tryptophanyl-tRNA synthetase [Sulfitobacter sp. EE-36]
 gi|83844867|gb|EAP82749.1| tryptophanyl-tRNA synthetase [Sulfitobacter sp. EE-36]
          Length = 338

 Score =  337 bits (863), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 168/344 (48%), Positives = 225/344 (65%), Gaps = 19/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G LHLGNYLG ++     Q+      +Y + DLHAIT      +L+  +R   A
Sbjct: 12  SGIQPSGDLHLGNYLGALKRFADAQDKGVQ-SIYCMVDLHAITVWQDPADLKRSTRELCA 70

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            F+A+G+DP ++I+  QS V  HA L+W+ +CVARMGWM  M Q+K+K+ +N E  ASLG
Sbjct: 71  GFIASGIDPDKSILINQSQVPEHAQLAWVFNCVARMGWMGRMTQWKDKAGKNAE-AASLG 129

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LMAADIL+Y ATHVPVGEDQ+QHLE+TR IA +FN +                 
Sbjct: 130 LFAYPALMAADILIYHATHVPVGEDQKQHLELTRDIAAKFNHD----------------- 172

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
           Y   FFP+ E +I+ +A+R+ SLRD SKKMSKSD SD SRINL D+ D IAKKI+KAKTD
Sbjct: 173 YGVDFFPLTEPVIEGAATRVMSLRDGSKKMSKSDPSDASRINLTDDADTIAKKIRKAKTD 232

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            D LPSEV GL++R EA+NL+ IFA +    +E+ L   GG+ F  FK  LA+  + ++ 
Sbjct: 233 ADALPSEVDGLKDRPEARNLVNIFAALNDQTVEQVLADVGGQQFGTFKPKLAELAVAKMA 292

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PIS ++  L+ D++ +D IL  GA +AR      +K   EIVG+
Sbjct: 293 PISTRMAELMADEAEIDRILAHGATQAREITAPILKKTYEIVGM 336


>gi|260431488|ref|ZP_05785459.1| tryptophanyl-tRNA synthetase [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260415316|gb|EEX08575.1| tryptophanyl-tRNA synthetase [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 342

 Score =  336 bits (862), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 172/348 (49%), Positives = 230/348 (66%), Gaps = 27/348 (7%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQ----ETCNHLGMYFIADLHAITNNIVQENLRYQSR 65
           SG+QP+G LHLGNYLG ++  +  Q    ET     +Y + DLHAIT     + L + +R
Sbjct: 12  SGIQPSGNLHLGNYLGALKRFVDMQGPEMET-----VYCMVDLHAITVWQDPKELAHSTR 66

Query: 66  LFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEET 125
              A F+AAG+DP ++I+F QS V  HA L+WI +CVARMGWM  M Q+K+K+ +N ++ 
Sbjct: 67  ELCAGFIAAGIDPEQSILFNQSQVPEHAQLAWIFNCVARMGWMQRMTQWKDKAGKN-QQN 125

Query: 126 ASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYA 185
           ASLGLF YP LMAADIL+Y ATHVPVG+DQ+QHLE+TR IA +FN +             
Sbjct: 126 ASLGLFAYPSLMAADILVYHATHVPVGDDQKQHLELTRDIAIKFNHD------------- 172

Query: 186 QEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQK 245
               Y   FFPI E +I+ +A+R+ SLRD +KKMSKSD SD SRIN+ D+ D IAKKI+K
Sbjct: 173 ----YGVDFFPITEPVIEGAATRVMSLRDGAKKMSKSDPSDMSRINMTDDADTIAKKIRK 228

Query: 246 AKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVI 305
           AKTD D LPSE+ GLE R EA+NL+ I+A +    +E+ L + GGK F +FK  LAD  +
Sbjct: 229 AKTDPDALPSELDGLEGRPEARNLVNIYAALSDQTVEQVLAEVGGKQFGEFKPMLADLAV 288

Query: 306 EEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            ++ PIS ++  L+ D++ +D IL  GA RAR  A   +    EIVG+
Sbjct: 289 AKLSPISTEMARLMGDQAEIDRILDRGAERAREIAAPILSRTYEIVGM 336


>gi|71083082|ref|YP_265801.1| tryptophanyl-tRNA synthetase [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|71062195|gb|AAZ21198.1| Tryptophanyl-tRNA synthetase [Candidatus Pelagibacter ubique
           HTCC1062]
          Length = 333

 Score =  336 bits (862), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 170/344 (49%), Positives = 238/344 (69%), Gaps = 17/344 (4%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQPTG LHLGNYLG I+N ++ Q    +  ++ + DLHAIT     + L+   R   A
Sbjct: 7   SGVQPTGNLHLGNYLGAIKNFVKLQNEKENECIFCVVDLHAITVKQDPKELKKNIRETAA 66

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           +F+A+G+DP+++IIF QS V  H++ +WILSCV+R+GW+N M QFKEK+ ++KE+ AS+G
Sbjct: 67  TFIASGIDPNKSIIFNQSMVPAHSEAAWILSCVSRIGWLNRMTQFKEKAGKDKEK-ASIG 125

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L+ YPVLMAADILLY ATHVPVG+DQ+QHLE+ R IAQ+FN +F                
Sbjct: 126 LYSYPVLMAADILLYDATHVPVGDDQKQHLELCRDIAQKFNNDFN--------------- 170

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
            +  F  + E LI    SRI SL+D  KKMSKSD SD SRINL DN + I  KI+KAKTD
Sbjct: 171 -ATDFLKVPEPLIQKEFSRIMSLKDGLKKMSKSDPSDLSRINLTDNSEEILNKIKKAKTD 229

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
              LPS++  L  R EA+NL+ I+++++   +E+++ +F GKNFS+FK  L++ +IE I 
Sbjct: 230 PLPLPSDIKDLNERPEAENLLGIYSSLKNQNLEKSIIEFKGKNFSEFKEKLSETLIETID 289

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PIS++I+ LL D+ YLD IL+EG+N+A   A + +K + ++VG 
Sbjct: 290 PISKEIKKLLNDEGYLDKILLEGSNKANKIASKKIKEIKDLVGF 333


>gi|163744706|ref|ZP_02152066.1| tryptophanyl-tRNA synthetase [Oceanibulbus indolifex HEL-45]
 gi|161381524|gb|EDQ05933.1| tryptophanyl-tRNA synthetase [Oceanibulbus indolifex HEL-45]
          Length = 338

 Score =  336 bits (862), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 168/344 (48%), Positives = 225/344 (65%), Gaps = 19/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G LHLGNYLG ++     QE      +Y + DLHAIT     E+L+  +R   A
Sbjct: 12  SGIQPSGDLHLGNYLGALKRFADAQEQGVQ-SIYCMVDLHAITVPQKPEDLKKSTRELCA 70

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            F+A+G+DP ++I+  QS V  HA L+W+ +CVARMGWM  M Q+K+K+ +N E  ASLG
Sbjct: 71  GFIASGIDPEKSILINQSQVPEHAQLAWVFNCVARMGWMGRMTQWKDKAGKNAE-AASLG 129

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LMAADIL+Y ATHVPVGEDQ+QHLE+TR IA +FN +                 
Sbjct: 130 LFAYPALMAADILIYHATHVPVGEDQKQHLELTRDIAAKFNHD----------------- 172

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
           Y   FFP+ E +I+ +A+R+ SLRD SKKMSKSD S  SRINL D+ D IAKK +KAKTD
Sbjct: 173 YGVDFFPLTEPVIEGAATRVMSLRDGSKKMSKSDPSPASRINLTDDADTIAKKFRKAKTD 232

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            D LPSE  GL++R EA+NL+ I+A +    I++ L   GG+ F  FK ALAD  + ++ 
Sbjct: 233 PDALPSEAEGLKDRPEARNLVNIYAALSDQSIDQVLADVGGQQFGTFKPALADLAVSKLG 292

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PI+ ++Q L+ D+S +D IL  GA +AR      +K   EI+G+
Sbjct: 293 PITAEMQRLMADESEIDRILARGAEQAREITAPILKRTYEIIGM 336


>gi|126739159|ref|ZP_01754853.1| tryptophanyl-tRNA synthetase [Roseobacter sp. SK209-2-6]
 gi|126719776|gb|EBA16484.1| tryptophanyl-tRNA synthetase [Roseobacter sp. SK209-2-6]
          Length = 342

 Score =  336 bits (861), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 170/354 (48%), Positives = 229/354 (64%), Gaps = 23/354 (6%)

Query: 4   SDNLFV----SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQEN 59
           SD  F     SG+QPTG LHLGNYLG ++  +  Q   +   +Y + DLHAIT     ++
Sbjct: 2   SDTAFTPRVFSGIQPTGNLHLGNYLGALKRFVDWQAR-DAETIYCMVDLHAITVWQDPKD 60

Query: 60  LRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSK 119
           L   +R   A F+AAG+DP ++I+  QS V  HA L+W+ +CVARMGWM  M QFK+K+ 
Sbjct: 61  LMKSTRELCAGFIAAGLDPEQSILINQSQVPEHAQLAWVFNCVARMGWMQRMTQFKDKAG 120

Query: 120 ENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKE 179
           +N +  ASLGLF YP LMAADIL+Y ATHVPVGEDQ+QHLE+TR IA +FN +       
Sbjct: 121 KNAQ-NASLGLFAYPALMAADILVYHATHVPVGEDQKQHLELTRDIATKFNHD------- 172

Query: 180 VAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDII 239
                     Y   FFPI E +I+ + +R+ SLRD SKKMSKSD SD SRIN+ D+ D I
Sbjct: 173 ----------YGVDFFPITEPVIEGAGTRVMSLRDGSKKMSKSDVSDASRINMTDDADTI 222

Query: 240 AKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLA 299
           AKKI+KAKTD D LPSE  GLE R EA+NL+ I+A + +  +++ L + GGK FS+FK  
Sbjct: 223 AKKIRKAKTDPDALPSEAKGLEERAEARNLVNIYAALSEQSVDQVLAKVGGKQFSEFKPM 282

Query: 300 LADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           L D  +E++ PIS ++  L++ +  +D IL  G+ RAR      ++   EI+G+
Sbjct: 283 LVDLSVEKLAPISTEMARLMQHQDEIDKILARGSERARAITAPILRQCYEIIGM 336


>gi|329848203|ref|ZP_08263231.1| tryptophanyl-tRNA synthetase [Asticcacaulis biprosthecum C19]
 gi|328843266|gb|EGF92835.1| tryptophanyl-tRNA synthetase [Asticcacaulis biprosthecum C19]
          Length = 331

 Score =  336 bits (861), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 172/345 (49%), Positives = 225/345 (65%), Gaps = 19/345 (5%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SG+Q +G LHLGNYLG ++     Q   +    Y IADLHAIT     E L  Q+R   
Sbjct: 4   LSGIQASGSLHLGNYLGALKKFADMQ-ALDATRFYMIADLHAITVWQAPEKLLSQTREIA 62

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LAAGVDP ++ IF QS V  H +L+W+ +CVAR+GW++ M QFK+K+ ++KE  AS+
Sbjct: 63  ACYLAAGVDPEKSTIFPQSAVPQHTELAWLFNCVARLGWLDRMTQFKDKAGKDKER-ASI 121

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GL+ YPVL AADILLYRATHVPVGEDQRQHLE+TR + ++FN +F+              
Sbjct: 122 GLYTYPVLQAADILLYRATHVPVGEDQRQHLELTRDVVKKFNHDFKTD------------ 169

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                +FP+ E L     +RI SLRD + KMSKSD SD SRINL D+ D IA KI+KAK+
Sbjct: 170 -----YFPVPETLYQGPGARIMSLRDGTAKMSKSDPSDNSRINLTDDADTIAGKIKKAKS 224

Query: 249 DGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
           D D LPSE +GL  R EAKNL+ I+A +  I  +  L +FGGK F  FK ALAD V+ ++
Sbjct: 225 DMDALPSEEAGLVERPEAKNLVGIYAALSGITNQAVLDEFGGKGFGAFKPALADVVVGKM 284

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            PIS+K++ LL D + +D +L  GA  AR  A   +K V +I GL
Sbjct: 285 APISEKLRTLLNDPAQIDAVLARGAETAREAAAPVVKDVRKIFGL 329


>gi|86139313|ref|ZP_01057883.1| tryptophanyl-tRNA synthetase [Roseobacter sp. MED193]
 gi|85824157|gb|EAQ44362.1| tryptophanyl-tRNA synthetase [Roseobacter sp. MED193]
          Length = 342

 Score =  335 bits (860), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 171/354 (48%), Positives = 229/354 (64%), Gaps = 23/354 (6%)

Query: 4   SDNLFV----SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQEN 59
           SD  F     SG+QP+G LHLGNYLG ++  +  Q+  +   +Y + DLHAIT     ++
Sbjct: 2   SDTTFTPRVFSGIQPSGNLHLGNYLGALKRFVDWQDR-DVESIYCMVDLHAITVWQNPQD 60

Query: 60  LRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSK 119
           L   +R   A F+AAG+DP + I+  QS V  HA L+WI +CVARMGWM  M QFK+K+ 
Sbjct: 61  LMKSTRELCAGFIAAGLDPEQAILINQSQVPEHAQLAWIFNCVARMGWMQRMTQFKDKAG 120

Query: 120 ENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKE 179
           +N +  ASLGLF YP LMAADIL Y ATHVPVGEDQ+QHLE+TR IA +FN +       
Sbjct: 121 KNAQ-NASLGLFAYPALMAADILTYHATHVPVGEDQKQHLELTRDIATKFNHD------- 172

Query: 180 VAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDII 239
                     Y   FFPI E +I+ +A+R+ SLRD SKKMSKSD+SD SRIN+ D+ D I
Sbjct: 173 ----------YDVDFFPITEPVIEGAATRVMSLRDGSKKMSKSDASDASRINMTDDADSI 222

Query: 240 AKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLA 299
           AKKI+KAKTD D LPSE  GLE+R EA+NL+ I+A + +  +++ L   GGK FS+FK  
Sbjct: 223 AKKIRKAKTDPDALPSEAKGLEDRAEARNLVNIYAALNEQSVDQVLTDVGGKQFSEFKPM 282

Query: 300 LADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           L D  + ++ PIS ++  L++ +  +D IL  G+ RAR      ++   EIVG+
Sbjct: 283 LVDLAVAKLAPISTEMARLMQHQDEIDKILTRGSERARAITAPILRQTYEIVGM 336


>gi|83953365|ref|ZP_00962087.1| tryptophanyl-tRNA synthetase [Sulfitobacter sp. NAS-14.1]
 gi|83842333|gb|EAP81501.1| tryptophanyl-tRNA synthetase [Sulfitobacter sp. NAS-14.1]
          Length = 338

 Score =  335 bits (860), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 167/344 (48%), Positives = 225/344 (65%), Gaps = 19/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G LHLGNYLG ++     Q+      +Y + DLHAIT      +L+  +R   A
Sbjct: 12  SGIQPSGDLHLGNYLGALKRFADAQDKGVQ-SIYCMVDLHAITVWQDPADLKRSTRELCA 70

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            F+A+G+DP ++I+  QS V  HA L+W+ +CVARMGWM  M Q+K+K+ +N E  ASLG
Sbjct: 71  GFIASGIDPDKSILINQSQVPEHAQLAWVFNCVARMGWMGRMTQWKDKAGKNAE-AASLG 129

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LMAADIL+Y ATHVPVGEDQ+QHLE+TR IA +FN +                 
Sbjct: 130 LFAYPALMAADILIYHATHVPVGEDQKQHLELTRDIAAKFNHD----------------- 172

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
           Y   FFP+ E +I+ +A+R+ SLRD SKKMSKSD SD SRINL D+ D IAKKI+KAKTD
Sbjct: 173 YGVDFFPLTEPVIEGAATRVMSLRDGSKKMSKSDPSDASRINLTDDADTIAKKIRKAKTD 232

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            D LPSEV GL++R EA+NL+ IFA +    +E+ L   GG+ F  FK  LA+  + ++ 
Sbjct: 233 ADALPSEVDGLKDRPEARNLVNIFAALNDQTVEQVLADVGGQQFGTFKPKLAELAVAKMA 292

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PIS ++  L+ D++ +D IL  GA +AR      +K   EI+G+
Sbjct: 293 PISTRMAELMADEAEIDRILAHGATQAREITAPILKKTYEIMGM 336


>gi|83952469|ref|ZP_00961200.1| tryptophanyl-tRNA synthetase [Roseovarius nubinhibens ISM]
 gi|83836142|gb|EAP75440.1| tryptophanyl-tRNA synthetase [Roseovarius nubinhibens ISM]
          Length = 339

 Score =  335 bits (859), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 166/344 (48%), Positives = 225/344 (65%), Gaps = 19/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G LHLGNYLG ++     QE      ++ + DLHA+T      +L   +R   A
Sbjct: 12  SGIQPSGNLHLGNYLGALKRFAASQERGIE-SLFCMVDLHAVTVWQDPADLTRATRELAA 70

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            F+A+G+DP R+I+F QS V  H  ++W+ +C+ARMGWM  M QFK+K+ +N +  ASLG
Sbjct: 71  GFIASGIDPDRSILFNQSQVPEHTQMAWVFNCIARMGWMQRMTQFKDKAGKNAQ-NASLG 129

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LMAADIL+Y AT VPVGEDQ+QHLE+TR IA +FN +                 
Sbjct: 130 LFAYPALMAADILVYHATEVPVGEDQKQHLELTRDIAAKFNHD----------------- 172

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
           Y   FFP  E  I+ +A+R+ SLRD SKKMSKSD SD SRINL D+ + IAKKI+KAKTD
Sbjct: 173 YGVNFFPETEPRIEGAATRVMSLRDGSKKMSKSDPSDMSRINLTDDAETIAKKIRKAKTD 232

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            + LPSE  GLE R EA+NL+ I+A +    ++E L+  GG+ FS FK ALAD  ++++ 
Sbjct: 233 PEALPSEAEGLEARPEARNLVNIYAALADQSVDEVLRDMGGREFSAFKPALADLAVDQLS 292

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PI+ ++  L++D S +D IL  GA RAR  AQ  ++   EI+G+
Sbjct: 293 PITAEMSRLMQDVSEIDAILARGAERARAIAQPIVRQTYEIMGM 336


>gi|149915363|ref|ZP_01903890.1| tryptophanyl-tRNA synthetase [Roseobacter sp. AzwK-3b]
 gi|149810652|gb|EDM70493.1| tryptophanyl-tRNA synthetase [Roseobacter sp. AzwK-3b]
          Length = 341

 Score =  334 bits (857), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 165/344 (47%), Positives = 229/344 (66%), Gaps = 19/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G L LGNYLG ++     Q       ++ + DLHAIT       LR+ +R   A
Sbjct: 12  SGIQPSGNLTLGNYLGALKRFANSQNEGVE-SIFCMVDLHAITVWQDPAKLRHATRELAA 70

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            F+A+G+DP ++I+F QS V  H  ++W+ +CVARMGWM  M QFK+K+ +N E+ ASLG
Sbjct: 71  GFIASGLDPQKSILFNQSQVPEHTQMAWVFNCVARMGWMKRMTQFKDKAGKNAEQ-ASLG 129

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LMAADIL+Y ATHVPVGEDQ+QHLE+T+ IA++FN +                 
Sbjct: 130 LFGYPALMAADILVYHATHVPVGEDQKQHLELTQEIARKFNHD----------------- 172

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
           Y   FFP  + +I+ +A+R+ SLRD +KKMSKSD SD SRINL D+ D IAKKI+KAKTD
Sbjct: 173 YGVAFFPETQPVIEGAATRVMSLRDGTKKMSKSDPSDMSRINLTDDADTIAKKIRKAKTD 232

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            + LPS+  GLE+R EA+NL+ I+A +    + + +++ GGK FS+FK  LAD  ++ I 
Sbjct: 233 PEPLPSDAEGLEDRPEARNLVNIYAALSDRSVADVMREVGGKPFSEFKPMLADLAVDRIA 292

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PIS ++  L+KD S +D IL +GA RAR  AQ  ++   +I+G+
Sbjct: 293 PISDEMARLMKDVSEIDHILTDGAARARTIAQPILQQTYQIMGM 336


>gi|118591467|ref|ZP_01548864.1| tryptophanyl-tRNA synthetase [Stappia aggregata IAM 12614]
 gi|118435795|gb|EAV42439.1| tryptophanyl-tRNA synthetase [Stappia aggregata IAM 12614]
          Length = 359

 Score =  334 bits (857), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 175/349 (50%), Positives = 235/349 (67%), Gaps = 8/349 (2%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQEN-LRYQSRLFV 68
           SGVQPTG LHLGNYLG +   +  Q+    +  + + D HAIT      + L   +R   
Sbjct: 10  SGVQPTGNLHLGNYLGAVSRWVPLQDQMPTI--FCVVDSHAITAGFPDPHELAQATREVT 67

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A+++AAG+DP ++IIF QS V  H +L+WI +CVARMGW+N M QFKEK+ +NKE  AS+
Sbjct: 68  AAYMAAGIDPKKSIIFNQSQVREHTELAWIFNCVARMGWLNRMTQFKEKAGKNKE-NASV 126

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKE----VAQKY 184
           GLF YP LMAADIL YRATHVPVG+DQ+QHLE+TR IA +FN +F  +IKE    +A   
Sbjct: 127 GLFAYPNLMAADILAYRATHVPVGDDQKQHLELTRDIAAKFNNDFAERIKELDIGIANPT 186

Query: 185 AQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQ 244
              E     +FP+ E +I   A+RI SLRD +KKMSKSD SD SRINL D+ D I+KKI+
Sbjct: 187 PSPELPEYLYFPMTEPMIAGPATRIMSLRDGTKKMSKSDPSDLSRINLTDDADSISKKIK 246

Query: 245 KAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           KAKTD D LPSE  GLE R EA NL+ I+A +      + LK++GG+ FS FK AL+D  
Sbjct: 247 KAKTDPDALPSETDGLEGRPEADNLVGIYAALSGATKADVLKEYGGQQFSTFKPALSDLA 306

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + ++ P++ +++ L+ DK+ +D IL EGA +A   A+  +K V +I+G 
Sbjct: 307 VAKLSPMTDEMRRLIDDKAQIDAILKEGAEKASTIAEPVLKDVRKIIGF 355


>gi|114765398|ref|ZP_01444513.1| tryptophanyl-tRNA synthetase [Pelagibaca bermudensis HTCC2601]
 gi|114542241|gb|EAU45271.1| tryptophanyl-tRNA synthetase [Roseovarius sp. HTCC2601]
          Length = 344

 Score =  334 bits (856), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 165/344 (47%), Positives = 230/344 (66%), Gaps = 19/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G L LGNYLG ++  +  Q +     +Y + D+HAIT     + L+ Q+R   A
Sbjct: 17  SGIQPSGGLTLGNYLGAMKRFVDMQGSGIET-IYCVVDMHAITVWQDPQALQKQTRELTA 75

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LAAG+DP+++I+F QS V  HA L+WI +CVAR+GWMN M QFK+K+ +N E+ ASLG
Sbjct: 76  GYLAAGLDPTKSILFNQSQVPEHAQLAWIFNCVARLGWMNRMTQFKDKAGKNAEK-ASLG 134

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L+ YP LMAADIL+Y AT VPVGEDQ+QH+E+TR IA +FN +                 
Sbjct: 135 LYAYPALMAADILVYHATQVPVGEDQKQHVELTRDIAAKFNHD----------------- 177

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
           Y   FFP+ + +I+ +A+R+ SLRD SKKMSKSD SD SRIN+ D+ D IAKKI+KAKTD
Sbjct: 178 YGTEFFPMTDPVIEGAATRVMSLRDGSKKMSKSDPSDASRINMTDDADAIAKKIRKAKTD 237

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            + LPSE +GL  R EA+NL+ I+A + +  ++  +   GGK FS+FK  LAD  + ++ 
Sbjct: 238 PEPLPSETAGLAERPEARNLVNIYAALSEQSVDAVMADVGGKPFSEFKPMLADLAVAKLA 297

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PIS ++   ++D + +D IL +GA RAR  A   +K   EIVG+
Sbjct: 298 PISTEMARYMEDPAEIDRILADGAGRARKIASPILKKTYEIVGM 341


>gi|283856516|ref|YP_163375.2| tryptophanyl-tRNA synthetase [Zymomonas mobilis subsp. mobilis ZM4]
 gi|283775521|gb|AAV90264.2| tryptophanyl-tRNA synthetase [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 341

 Score =  333 bits (855), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 170/359 (47%), Positives = 235/359 (65%), Gaps = 28/359 (7%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQ------ETCNHLGMYFIADLHAITNN 54
           M+S +   VSG+QPTG LHLGNYLG IRN +  Q      ++C    ++F+ADLHAIT  
Sbjct: 1   MMSKNKRIVSGIQPTGNLHLGNYLGAIRNWVVMQNEMKDGDSC----VFFLADLHAITMP 56

Query: 55  IVQENLRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQF 114
              + L    R   A+ LA+GV+P R + F QSDV  H++++W+L+CVAR+GW+N M QF
Sbjct: 57  QAPDELAENIRNMAATLLASGVNPERAVFFAQSDVAAHSEMAWLLNCVARIGWLNRMTQF 116

Query: 115 KEKSKENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFE 174
           KEKS +N+E  AS+GL+ YPVL AAD++LY+ATHVPVGEDQ+QHLE+ R IA +FN +++
Sbjct: 117 KEKSGKNRE-GASVGLYTYPVLQAADVMLYQATHVPVGEDQKQHLELARDIATKFNNDYD 175

Query: 175 RKIKEVAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLD 234
            KI                 F + E +I  +A+R+ SLR+ S KMSKSD SD SRINL D
Sbjct: 176 DKI-----------------FTLPEPIIQKTAARVMSLRNGSSKMSKSDPSDLSRINLTD 218

Query: 235 NPDIIAKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFS 294
           + D IA+KI+KAKTD D +P    GL +R EAKNL+ I++ ++   + + L+QF G+ F 
Sbjct: 219 SNDDIAQKIRKAKTDPDPIPENEEGLADRPEAKNLLGIYSALKGEALGDVLQQFAGQGFG 278

Query: 295 QFKLALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           QFK ALAD V+E I PI  K+     D + +D IL +GA +A   A++T+      +GL
Sbjct: 279 QFKPALADLVVESIAPIRDKLSSFKNDPAEIDRILSQGAEKAAVIAEKTLDKAYRSMGL 337


>gi|163736888|ref|ZP_02144306.1| tryptophanyl-tRNA synthetase [Phaeobacter gallaeciensis BS107]
 gi|161389492|gb|EDQ13843.1| tryptophanyl-tRNA synthetase [Phaeobacter gallaeciensis BS107]
          Length = 342

 Score =  333 bits (854), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 167/344 (48%), Positives = 228/344 (66%), Gaps = 19/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G LHLGNYLG ++  +  Q   +   +Y + D+HAIT      +L+  +R   A
Sbjct: 12  SGIQPSGNLHLGNYLGALKRFVDWQAK-DVESIYCMVDMHAITVWQDPADLKKSTRELCA 70

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            F+AAG+DP ++I+  QS V  HA L+WI +CVARMGWM  M Q+K+K+ +N +  ASLG
Sbjct: 71  GFIAAGLDPEQSILINQSQVPEHAQLAWIFNCVARMGWMQRMTQWKDKAGKNAQ-NASLG 129

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LMAADIL+Y ATHVPVGEDQ+QHLE+TR IA +FN +                 
Sbjct: 130 LFAYPALMAADILVYHATHVPVGEDQKQHLELTRDIAMKFNHD----------------- 172

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
           Y   FFP+ E +I+ +A+R+ SLRD SKKMSKSD+SD SRINL D+ D IAKKI+KAKTD
Sbjct: 173 YGVDFFPVTEPVIEGAATRVMSLRDGSKKMSKSDASDASRINLTDDADTIAKKIRKAKTD 232

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            D LPSEV GLE R EA+NL+ I+A M +  +++ L   GGK FS+FK  LAD  + ++ 
Sbjct: 233 PDALPSEVEGLEGRPEARNLVNIYAAMAEQSVDQVLTDVGGKAFSEFKPMLADLSVAKMS 292

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PI+ ++  L++ +  +D IL  G+ RAR      ++   +IVG+
Sbjct: 293 PITTEMARLMQHQDEIDKILARGSERAREITAPILRKTYDIVGM 336


>gi|241762224|ref|ZP_04760306.1| tryptophanyl-tRNA synthetase [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|260753804|ref|YP_003226697.1| tryptophanyl-tRNA synthetase [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|241373271|gb|EER62890.1| tryptophanyl-tRNA synthetase [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|258553167|gb|ACV76113.1| tryptophanyl-tRNA synthetase [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
          Length = 341

 Score =  333 bits (854), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 170/359 (47%), Positives = 235/359 (65%), Gaps = 28/359 (7%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQ------ETCNHLGMYFIADLHAITNN 54
           M+S +   VSG+QPTG LHLGNYLG IRN +  Q      ++C    ++F+ADLHAIT  
Sbjct: 1   MMSKNKRIVSGIQPTGNLHLGNYLGAIRNWVVMQNEMKDGDSC----VFFLADLHAITMP 56

Query: 55  IVQENLRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQF 114
              + L    R   A+ LA+GV+P R + F QSDV  H++++W+L+CVAR+GW+N M QF
Sbjct: 57  QAPDELAENIRNMAATLLASGVNPERAVFFAQSDVAAHSEMAWLLNCVARIGWLNRMTQF 116

Query: 115 KEKSKENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFE 174
           KEKS +N+E  AS+GL+ YPVL AAD++LY+ATHVPVGEDQ+QHLE+ R IA +FN +++
Sbjct: 117 KEKSGKNRE-GASVGLYTYPVLQAADVMLYQATHVPVGEDQKQHLELARDIATKFNNDYD 175

Query: 175 RKIKEVAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLD 234
            KI                 F + E +I  +A+R+ SLR+ S KMSKSD SD SRINL D
Sbjct: 176 DKI-----------------FTLPEPIIQKTAARVMSLRNGSSKMSKSDPSDLSRINLTD 218

Query: 235 NPDIIAKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFS 294
           + D IA+KI+KAKTD D +P    GL +R EAKNL+ I++ ++   + + L+QF G+ F 
Sbjct: 219 SNDDIAQKIRKAKTDPDPIPENEEGLADRPEAKNLLGIYSALKGEALGDILQQFAGQGFG 278

Query: 295 QFKLALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           QFK ALAD V+E I PI  K+     D + +D IL +GA +A   A++T+      +GL
Sbjct: 279 QFKPALADLVVESIAPIRDKLSSFKNDPAEIDRILSQGAEKAAVIAEKTLDKAYRSMGL 337


>gi|91762491|ref|ZP_01264456.1| tryptophanyl-tRNA synthetase [Candidatus Pelagibacter ubique
           HTCC1002]
 gi|91718293|gb|EAS84943.1| tryptophanyl-tRNA synthetase [Candidatus Pelagibacter ubique
           HTCC1002]
          Length = 333

 Score =  333 bits (853), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 169/344 (49%), Positives = 237/344 (68%), Gaps = 17/344 (4%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQPTG LHLGNYLG I+N ++ Q    +  ++ + DLHAIT     + L+   R   A
Sbjct: 7   SGVQPTGNLHLGNYLGAIKNFVKLQNEKENECIFCVVDLHAITVKQDPKELKKNIRETAA 66

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           +F+A+G+DP+++IIF QS V  H++ +WILSCV+R+GW+N M QFKEK+ ++KE+ AS+G
Sbjct: 67  TFIASGIDPNKSIIFNQSMVPAHSEAAWILSCVSRIGWLNRMTQFKEKAGKDKEK-ASIG 125

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L+ YPVLMAADILLY ATHVPVG+DQ+QHLE+ R IAQ+FN +F                
Sbjct: 126 LYSYPVLMAADILLYDATHVPVGDDQKQHLELCRDIAQKFNNDFN--------------- 170

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
            +  F  + E LI    SRI SL+D  KKMSKSD SD SRINL DN + I  KI+KAKTD
Sbjct: 171 -ATDFLKVPEPLIQKEFSRIMSLKDGLKKMSKSDPSDLSRINLTDNSEEILNKIKKAKTD 229

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
              LPS++  L  R EA+NL+ I+++++   +E+++ +F  KNFS+FK  L++ +IE I 
Sbjct: 230 PLPLPSDIKDLNERPEAENLLGIYSSLKNQNLEKSIIEFKEKNFSEFKEKLSETLIETID 289

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PIS++I+ LL D+ YLD IL+EG+N+A   A + +K + ++VG 
Sbjct: 290 PISKEIKKLLNDEGYLDKILLEGSNKANKIASKKIKEIKDLVGF 333


>gi|254455423|ref|ZP_05068852.1| tryptophanyl-tRNA synthetase [Candidatus Pelagibacter sp. HTCC7211]
 gi|207082425|gb|EDZ59851.1| tryptophanyl-tRNA synthetase [Candidatus Pelagibacter sp. HTCC7211]
          Length = 333

 Score =  332 bits (852), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 171/344 (49%), Positives = 234/344 (68%), Gaps = 17/344 (4%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQPTG LHLGNYLG I+N +       +  ++ + DLHAIT     + LR   R  VA
Sbjct: 7   SGVQPTGNLHLGNYLGAIKNFVTLNNDTENECIFCVVDLHAITVKQDSKELRNNIRETVA 66

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           +F+A+G++P ++IIF QS V  HA+ +WILSCVARMGW+N M QFKEK+ ++KE+ AS+G
Sbjct: 67  TFIASGINPKKSIIFNQSQVSAHAEGAWILSCVARMGWLNRMTQFKEKAGKDKEK-ASIG 125

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L+ YPVLMA+DILLY ATHVPVG+DQ+QHLE+ R IAQ+FN +FE               
Sbjct: 126 LYSYPVLMASDILLYDATHVPVGDDQKQHLELCRDIAQKFNNDFE--------------- 170

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
               F  + E LI    SRI SL+D SKKMSKS+ SD SRINL D+ D I  KI+KAKTD
Sbjct: 171 -VDNFLQVPEPLIQKEFSRIMSLKDGSKKMSKSELSDLSRINLTDSKDQIINKIKKAKTD 229

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
              +P+ +  L+ R EAKNL+ I+A++    +E++++ F GKNFS+FK +L++ ++ +I 
Sbjct: 230 PMPMPNGLQELDERPEAKNLLGIYASLTNTTLEKSIENFYGKNFSEFKESLSEILVNKIE 289

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PIS +I+ LL D+ YLD IL+EG  +A   A + ++ + EIVG 
Sbjct: 290 PISIEIKKLLADQKYLDQILLEGVEKANLIASKKIQKIKEIVGF 333


>gi|99080284|ref|YP_612438.1| tryptophanyl-tRNA synthetase [Ruegeria sp. TM1040]
 gi|99036564|gb|ABF63176.1| tryptophanyl-tRNA synthetase [Ruegeria sp. TM1040]
          Length = 342

 Score =  332 bits (852), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 166/344 (48%), Positives = 227/344 (65%), Gaps = 19/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G LHLGNYLG ++  +  Q + +   +Y + DLHAIT      +L+  +R   A
Sbjct: 12  SGIQPSGNLHLGNYLGALKRFVDWQ-SRDVESIYCMVDLHAITVWQDPADLKKATRELCA 70

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            F+AAG+DP ++I+  QS V  HA L+WI +CVARMGWM  M Q+K+K+ +N ++ ASLG
Sbjct: 71  GFIAAGLDPEKSILINQSQVPEHAQLAWIFNCVARMGWMQRMTQWKDKAGKN-QQNASLG 129

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L  YP LMAADIL+Y ATHVPVGEDQ+QHLE+TR IA +FN +                 
Sbjct: 130 LLAYPSLMAADILIYHATHVPVGEDQKQHLELTRDIATKFNHD----------------- 172

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
           Y   FFP+ E +I+ +A+R+ SLRD SKKMSKSD SD SRINL D+ D IAKKI+KAKTD
Sbjct: 173 YGVDFFPLTEPVIEGAATRVMSLRDGSKKMSKSDPSDASRINLTDDADTIAKKIRKAKTD 232

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            + LPSE  GLE R EA+NL+ I+A M    +++ L   GGK FS+FK  LAD  +E + 
Sbjct: 233 PEALPSEAKGLEERPEARNLVNIYAAMADQTVDQVLADVGGKQFSEFKPMLADLAVERMA 292

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PI+ ++  L++++  +D IL  G+ RAR      ++   +IVG+
Sbjct: 293 PITTEMARLMENQDEIDKILARGSERARAITAPILRKTYDIVGM 336


>gi|255262706|ref|ZP_05342048.1| tryptophanyl-tRNA synthetase [Thalassiobium sp. R2A62]
 gi|255105041|gb|EET47715.1| tryptophanyl-tRNA synthetase [Thalassiobium sp. R2A62]
          Length = 340

 Score =  332 bits (850), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 166/344 (48%), Positives = 220/344 (63%), Gaps = 18/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G L LGNYLG ++  +  Q       +Y + DLHAIT       LR  +R   A
Sbjct: 12  SGIQPSGGLTLGNYLGAMKRFVDMQNVGGFETVYCMVDLHAITVWQDPAALRQNTRELAA 71

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            F+A+G+DP ++I+F QS V  HA L WI +CVARMGWM  M Q+K+K+ +N +  ASLG
Sbjct: 72  GFIASGIDPEKSILFNQSQVPEHAQLGWIFNCVARMGWMQRMTQWKDKAGKNSQ-NASLG 130

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LMAADIL+Y ATHVPVGEDQ+QHLE+TR IA +FN +F                
Sbjct: 131 LFGYPALMAADILIYHATHVPVGEDQKQHLELTRDIAAKFNNDF---------------- 174

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
               FFPI E +I+ +A+R+ SLR+ SKKMSKSD SD SRIN+ DN D IAKKI+KAKTD
Sbjct: 175 -GVDFFPITEPVIEGAATRVMSLRNGSKKMSKSDPSDASRINMTDNADTIAKKIRKAKTD 233

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            + LP    GL  R EA+NL+ I+A +    ++  L + GGK F +FK  LAD  + ++ 
Sbjct: 234 PEPLPESAEGLAERPEARNLVNIYAALADQSVDAVLAEVGGKQFGEFKPMLADLAVAKLA 293

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PIS ++  L++D++ +D IL  GA R R  A   +K   EIVG+
Sbjct: 294 PISTEMARLMQDQAEIDRILARGAERGREIASPILKKTYEIVGM 337


>gi|16124319|ref|NP_418883.1| tryptophanyl-tRNA synthetase [Caulobacter crescentus CB15]
 gi|221233001|ref|YP_002515437.1| tryptophanyl-tRNA synthetase [Caulobacter crescentus NA1000]
 gi|25009445|sp|Q9AC05|SYW_CAUCR RecName: Full=Tryptophanyl-tRNA synthetase; AltName:
           Full=Tryptophan--tRNA ligase; Short=TrpRS
 gi|13421159|gb|AAK22051.1| tryptophanyl-tRNA synthetase [Caulobacter crescentus CB15]
 gi|220962173|gb|ACL93529.1| tryptophanyl-tRNA synthetase [Caulobacter crescentus NA1000]
          Length = 344

 Score =  332 bits (850), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 166/345 (48%), Positives = 222/345 (64%), Gaps = 19/345 (5%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQP+G LHLGNYLG +    R Q   +     F+ADLHAIT       L  Q+R   
Sbjct: 16  LSGVQPSGALHLGNYLGALVKFTRLQHEIDTF--IFVADLHAITVWQDPAALAQQTREIA 73

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A+++A+G+DP +  IF QS V  HA+LSWI +CVAR+GW++ M QFKEKS ++KE + S+
Sbjct: 74  AAYIASGLDPDKATIFPQSAVREHAELSWIFNCVARLGWLDRMTQFKEKSGKHKERS-SV 132

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GL+ YPVL AADIL+Y+ATHVPVGEDQ+QHLE+TR IAQ+FN +F               
Sbjct: 133 GLYTYPVLQAADILIYKATHVPVGEDQKQHLELTRDIAQKFNHDFN-------------- 178

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
             + GFFP+ + LI    +R+ SLRD S KMSKSD SD+SRINL D  D IA K++KA+T
Sbjct: 179 --APGFFPLPDPLIQGPGARVMSLRDGSAKMSKSDPSDYSRINLTDTADDIAAKVKKART 236

Query: 249 DGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
           D + LP  +  L  R EA NL+ IFA +      E L  + GK F  FK ALA+  +E +
Sbjct: 237 DPEPLPETIEELATRAEADNLVGIFAALAGKTKAEVLADYAGKGFGTFKPALAELAVESL 296

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            P+ ++++ LL D + LD IL +GA +AR  A  T+  V ++VG 
Sbjct: 297 APVGERMRGLLGDPAVLDAILAKGAEKAREAAAPTLAEVKKLVGF 341


>gi|11992026|gb|AAG42413.1| tryptophanyl-tRNA synthase [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 340

 Score =  332 bits (850), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 169/358 (47%), Positives = 234/358 (65%), Gaps = 28/358 (7%)

Query: 2   LSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQ------ETCNHLGMYFIADLHAITNNI 55
           +S +   VSG+QPTG LHLGNYLG IRN +  Q      ++C    ++F+ADLHAIT   
Sbjct: 1   MSKNKRIVSGIQPTGNLHLGNYLGAIRNWVVMQNEMKDGDSC----VFFLADLHAITMPQ 56

Query: 56  VQENLRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFK 115
             + L    R   A+ LA+GV+P R + F QSDV  H++++W+L+CVAR+GW+N M QFK
Sbjct: 57  APDELAENIRNMAATLLASGVNPERAVFFAQSDVAAHSEMAWLLNCVARIGWLNRMTQFK 116

Query: 116 EKSKENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFER 175
           EKS +N+E  AS+GL+ YPVL AAD++LY+ATHVPVGEDQ+QHLE+ R IA +FN +++ 
Sbjct: 117 EKSGKNRE-GASVGLYTYPVLQAADVMLYQATHVPVGEDQKQHLELARDIATKFNNDYDD 175

Query: 176 KIKEVAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDN 235
           KI                 F + E +I  +A+R+ SLR+ S KMSKSD SD SRINL D+
Sbjct: 176 KI-----------------FTLPEPIIQKTAARVMSLRNGSSKMSKSDPSDLSRINLTDS 218

Query: 236 PDIIAKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQ 295
            D IA+KI+KAKTD D +P    GL +R EAKNL+ I++ ++   + + L+QF G+ F Q
Sbjct: 219 NDDIAQKIRKAKTDPDPIPENEEGLADRPEAKNLLGIYSALKGEALGDVLQQFAGQGFGQ 278

Query: 296 FKLALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           FK ALAD V+E I PI  K+     D + +D IL +GA +A   A++T+      +GL
Sbjct: 279 FKPALADLVVESIAPIRDKLSSFKNDPAEIDRILSQGAEKAAVIAEKTLDKAYRSMGL 336


>gi|163740689|ref|ZP_02148083.1| tryptophanyl-tRNA synthetase [Phaeobacter gallaeciensis 2.10]
 gi|161386547|gb|EDQ10922.1| tryptophanyl-tRNA synthetase [Phaeobacter gallaeciensis 2.10]
          Length = 342

 Score =  331 bits (849), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 166/344 (48%), Positives = 228/344 (66%), Gaps = 19/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G LHLGNYLG ++  +  Q   +   +Y + D+HAIT      +L+  +R   A
Sbjct: 12  SGIQPSGNLHLGNYLGALKRFVDWQAK-DVESIYCMVDMHAITVWQDPADLKKSTRELCA 70

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            F+AAG+DP ++I+  QS V  HA L+WI +CVARMGWM  M Q+K+K+ +N +  ASLG
Sbjct: 71  GFIAAGLDPEQSILINQSQVPEHAQLAWIFNCVARMGWMQRMTQWKDKAGKNAQ-NASLG 129

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LMAADIL+Y ATHVPVGEDQ+QHLE+TR IA +FN +                 
Sbjct: 130 LFAYPALMAADILVYHATHVPVGEDQKQHLELTRDIAMKFNHD----------------- 172

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
           Y   FFP+ E +I+ +A+R+ SLRD SKKMSKSD+SD SRINL D+ D IAKKI+KAKTD
Sbjct: 173 YGVDFFPVTEPVIEGAATRVMSLRDGSKKMSKSDASDASRINLTDDADTIAKKIRKAKTD 232

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            D LPSEV GLE R EA+NL+ I+A + +  +++ L   GGK FS+FK  LAD  + ++ 
Sbjct: 233 PDALPSEVEGLEGRPEARNLVNIYAALAEQSVDQVLADVGGKAFSEFKPMLADLSVAKMS 292

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PI+ ++  L++ +  +D IL  G+ RAR      ++   +IVG+
Sbjct: 293 PITTEMARLMQHQDEIDKILARGSERAREITAPILRKTYDIVGM 336


>gi|197106921|ref|YP_002132298.1| tryptophanyl-tRNA synthetase [Phenylobacterium zucineum HLK1]
 gi|196480341|gb|ACG79869.1| tryptophanyl-tRNA synthetase [Phenylobacterium zucineum HLK1]
          Length = 357

 Score =  331 bits (848), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 168/345 (48%), Positives = 218/345 (63%), Gaps = 19/345 (5%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQP+G LHLGNYLG +    R Q         F+ADLHAIT       L+ Q R   
Sbjct: 29  LSGVQPSGDLHLGNYLGALAKFARIQHEAPTF--IFVADLHAITVWQEPSKLKQQVREIA 86

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A++LA G+DP    IF QS V  HA+L+W+ +CVAR+GW++ M QFKEKS ++KE  AS+
Sbjct: 87  AAYLATGLDPKVASIFAQSAVPEHAELAWVFNCVARLGWLDRMTQFKEKSGKHKER-ASV 145

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GL+ YPVL AADIL+Y+ATHVPVGEDQ+QHLE+TR IAQ+FN +F               
Sbjct: 146 GLYTYPVLQAADILIYKATHVPVGEDQKQHLELTRDIAQKFNNDFA-------------- 191

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
             + GFFP+ E L     +R+ SLRD S KMSKSD SD+SRINL D+ D IA+K++KA+T
Sbjct: 192 --APGFFPLPEPLTQGPGARVMSLRDGSAKMSKSDPSDYSRINLTDDADAIAQKVKKART 249

Query: 249 DGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
           D + LP  + GLE R EAKNL+ I+A +      E L +F G+ F  FK  LAD  +  +
Sbjct: 250 DPEPLPETMEGLEGRPEAKNLVGIYAALSGKTDAEVLAEFAGQGFGAFKPKLADLAVSVM 309

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            PI  +++ LL D   +D +L EGA RAR  A   M  V  +VG 
Sbjct: 310 APIGGEMRRLLADPGEIDRVLAEGAGRAREIAAPVMAEVRRLVGF 354


>gi|295687467|ref|YP_003591160.1| tryptophanyl-tRNA synthetase [Caulobacter segnis ATCC 21756]
 gi|295429370|gb|ADG08542.1| tryptophanyl-tRNA synthetase [Caulobacter segnis ATCC 21756]
          Length = 344

 Score =  331 bits (848), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 167/345 (48%), Positives = 222/345 (64%), Gaps = 19/345 (5%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQP+G LHLGNYLG +    R Q   +     F+ADLHAIT     + L  Q+R   
Sbjct: 16  LSGVQPSGALHLGNYLGALVKFARLQHEIDTF--IFVADLHAITVWQEPDALAQQTREIA 73

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A+++A+G+DP +  IF QS V  HA+L+WI  CVAR+GW++ M QFKEKS ++KE + S+
Sbjct: 74  AAYIASGLDPDKATIFPQSAVREHAELAWIFQCVARLGWLDRMTQFKEKSGKHKERS-SV 132

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GL+ YPVL AADIL+Y+ATHVPVGEDQ+QHLE+TR IAQ+FN +F               
Sbjct: 133 GLYTYPVLQAADILVYKATHVPVGEDQKQHLELTRDIAQKFNHDFG-------------- 178

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
              +GFFP  E LI    +R+ SLRD S KMSKSD SD+SRINL D  D IA K++KA+T
Sbjct: 179 --VQGFFPQPEPLIQGPGARVMSLRDGSAKMSKSDPSDYSRINLTDTADDIAAKVRKART 236

Query: 249 DGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
           D + LP  +  L  R EA NL+ IFA +      E L  + GK F  FK ALA+  +E++
Sbjct: 237 DPEPLPETIEELAGRAEADNLVGIFAALSGQSKAEVLADYAGKGFGTFKPALAELAVEKL 296

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            P+ +K++ LL D + LD IL +GA +AR  A  T+  V ++VG 
Sbjct: 297 APVGEKMRGLLGDPAVLDAILAKGAEKARETAAPTLAEVKKLVGF 341


>gi|114800520|ref|YP_759250.1| tryptophanyl-tRNA synthetase [Hyphomonas neptunium ATCC 15444]
 gi|114740694|gb|ABI78819.1| tryptophanyl-tRNA synthetase [Hyphomonas neptunium ATCC 15444]
          Length = 344

 Score =  331 bits (848), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 170/344 (49%), Positives = 221/344 (64%), Gaps = 18/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQPTG LHLGNYLG ++     Q    H  ++ + DLHAIT  + +  L   +R   A
Sbjct: 16  SGVQPTGNLHLGNYLGALKKFADLQRD-GHDCIFAVVDLHAITMPMEKGALISHTRQIAA 74

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           +F+AAGVDPS++IIF QS V  H +L+WI +CVARMGW+  M QFK+K+ ++ E  AS+G
Sbjct: 75  AFIAAGVDPSKSIIFAQSSVLAHVELAWIFNCVARMGWVERMTQFKDKAGKDAER-ASVG 133

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YPVL AADIL Y+ATHVPVGEDQ+QHLE++R IA+RFN E++               
Sbjct: 134 LFTYPVLQAADILAYKATHVPVGEDQKQHLELSRDIAERFNREYD--------------- 178

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
              GFFP  E +I    +RI SL+D +KKMSKSD SD SRINL+D+ D IAKKI+KA TD
Sbjct: 179 -VPGFFPQPEPMIKGPGARIMSLKDGTKKMSKSDPSDLSRINLVDDADTIAKKIKKATTD 237

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
             V+P  V  LE R E +NL+ I+A +     E+ L +F GK F  FK ALAD  +  + 
Sbjct: 238 AGVIPGTVKELEGRPEVENLVGIYAALSGRTAEDVLAEFEGKGFGAFKPALADVTVAHLA 297

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PI+ K + +L D++ LD +L +GA RA   A   M  V  IVG 
Sbjct: 298 PITAKFRDILDDQTGLDRVLADGAARANEVAAPVMDDVRRIVGF 341


>gi|254475472|ref|ZP_05088858.1| tryptophanyl-tRNA synthetase [Ruegeria sp. R11]
 gi|214029715|gb|EEB70550.1| tryptophanyl-tRNA synthetase [Ruegeria sp. R11]
          Length = 342

 Score =  330 bits (847), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 164/344 (47%), Positives = 227/344 (65%), Gaps = 19/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G LHLGNYLG ++  +  Q   +   +Y + DLHAIT      +L+  +R   A
Sbjct: 12  SGIQPSGNLHLGNYLGALKRFVDWQAK-DVESIYCMVDLHAITVWQDPADLKKSTRELCA 70

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            F+AAG+DP ++I+  QS V  HA L+W+ +CVARMGWM  M Q+K+K+ +N +  ASLG
Sbjct: 71  GFIAAGLDPEKSILINQSQVPEHAQLAWVFNCVARMGWMQRMTQWKDKAGKNAQ-NASLG 129

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LMAADIL+Y ATHVPVGEDQ+QHLE+TR IA +FN +                 
Sbjct: 130 LFAYPALMAADILVYHATHVPVGEDQKQHLELTRDIAIKFNHD----------------- 172

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
           Y   FFP  E +I+ +A+R+ SLRD SKKMSKSD SD SRINL D+ D IAKKI+KAKTD
Sbjct: 173 YGVNFFPETEPVIEGAATRVMSLRDGSKKMSKSDPSDASRINLTDDADAIAKKIRKAKTD 232

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            + LPSE  GLE R EA+NL+ I+A M ++ +++ L + GGK FS+FK  LAD  + ++ 
Sbjct: 233 PEALPSEAKGLEERPEARNLVNIYAAMAEMSVDQVLAEVGGKQFSEFKPMLADLAVAKMS 292

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PI+ ++  L++++  +D IL  G+ RAR      +    +I+G+
Sbjct: 293 PITTEMARLMENQDEIDKILARGSERARAITAPILSQTYDIIGM 336


>gi|254418727|ref|ZP_05032451.1| tryptophanyl-tRNA synthetase [Brevundimonas sp. BAL3]
 gi|196184904|gb|EDX79880.1| tryptophanyl-tRNA synthetase [Brevundimonas sp. BAL3]
          Length = 346

 Score =  330 bits (846), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 163/345 (47%), Positives = 228/345 (66%), Gaps = 18/345 (5%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SG+Q +G LHLGNYLG ++  +  Q+    +   F+AD+HAIT     + L  Q+R   
Sbjct: 17  LSGIQASGALHLGNYLGALKRFVELQDQGAPV-FVFVADMHAITVWQEPDKLAAQTREIA 75

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A++LA+G+DP++ IIF QS V  HA+L+WI +CVAR+GW++ M QFKEKS ++KE  AS+
Sbjct: 76  AAYLASGLDPAKAIIFPQSAVRAHAELAWIFNCVARLGWLDRMTQFKEKSGKHKER-ASV 134

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GL+ YPVL AADILLY+AT VPVGEDQ+QHLE+TR IA +FN +F               
Sbjct: 135 GLYTYPVLQAADILLYKATEVPVGEDQKQHLELTRDIAAKFNNDFG-------------- 180

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
               G+FP+ E +I   A+R+ SLRD + KMSKSD SD SRINL D+ D IA KI+KAKT
Sbjct: 181 --VPGYFPVPEPIIQGPATRVMSLRDGAAKMSKSDPSDNSRINLTDDADTIASKIRKAKT 238

Query: 249 DGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
           D + LP  + GL +R EAKNL+ I+A +  +  E+ + QFGG+ F  FK ALAD  +  +
Sbjct: 239 DPEPLPETLDGLNDRPEAKNLVAIYAALAGLTREQVIAQFGGQGFGAFKPALADLAVASL 298

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            P++ +++ L+ D + +D +L +GA+RA   A   +  V  IVG 
Sbjct: 299 APVTAEMRRLMDDPAEIDRVLKDGADRAAEVADPVVDEVKTIVGF 343


>gi|254464560|ref|ZP_05077971.1| tryptophanyl-tRNA synthetase [Rhodobacterales bacterium Y4I]
 gi|206685468|gb|EDZ45950.1| tryptophanyl-tRNA synthetase [Rhodobacterales bacterium Y4I]
          Length = 342

 Score =  330 bits (845), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 165/344 (47%), Positives = 228/344 (66%), Gaps = 19/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G LHLGNYLG ++  +  Q   +   +Y + DLHAIT      +L+  +R   A
Sbjct: 12  SGIQPSGNLHLGNYLGALKRFVDWQAK-DIETIYCMVDLHAITVWQDPADLKKSTRELCA 70

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            F+AAG+DP ++I+  QS V  HA L+W+ +CVARMGWM  M Q+K+K+ +N ++ ASLG
Sbjct: 71  GFIAAGIDPEKSILINQSQVPEHAQLAWVFNCVARMGWMQRMTQWKDKAGKN-QQNASLG 129

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LMAADIL+Y ATHVPVGEDQ+QHLE+TR IA +FN +F                
Sbjct: 130 LFAYPALMAADILVYHATHVPVGEDQKQHLELTRDIAIKFNHDF---------------- 173

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
               FFP  E +I+ +A+R+ SLRD SKKMSKSD+SD SRINL D+ D IAKKI+KAKTD
Sbjct: 174 -GVDFFPETEPVIEGAATRVMSLRDGSKKMSKSDASDASRINLTDDADTIAKKIRKAKTD 232

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            + LPSE  GLE R EA+NL+ I+A + +  +E+ L   GG+ FS+FK  LAD  + ++ 
Sbjct: 233 PEALPSEADGLEGRPEARNLVNIYAALNEQTVEQVLADVGGRQFSEFKPMLADLAVSKLA 292

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PIS ++  L++++  +D IL  G+ RAR      ++   +IVG+
Sbjct: 293 PISTEMARLMQNQDEIDKILSRGSQRAREITAPILRKTYDIVGM 336


>gi|83594864|ref|YP_428616.1| tryptophanyl-tRNA synthetase [Rhodospirillum rubrum ATCC 11170]
 gi|83577778|gb|ABC24329.1| tryptophanyl-tRNA synthetase [Rhodospirillum rubrum ATCC 11170]
          Length = 332

 Score =  330 bits (845), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 169/344 (49%), Positives = 224/344 (65%), Gaps = 20/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQPTG LHLGNYLG IRN ++ Q   + L  + +AD HAIT     E LR  +R   A
Sbjct: 6   SGVQPTGNLHLGNYLGAIRNWVKLQTEYDCL--FCMADQHAITVWQDPETLRRHTREVTA 63

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
             LAAG+DP RNI+F QS V  HA L+W+ +CVARMGW++ M QFK+K+ ++KE  AS+G
Sbjct: 64  GLLAAGIDPKRNIVFNQSTVPAHAQLAWVFNCVARMGWLSRMTQFKDKAGKHKE-NASVG 122

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LMAADILLY+ATHVPVGEDQ+QHLE+TR IAQ+FN +F  ++            
Sbjct: 123 LFAYPDLMAADILLYKATHVPVGEDQKQHLELTRDIAQKFNNDFGVEL------------ 170

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                FP+ E L    A+R+ SLRD +KKMSKSD SD+SRIN+ D+ D IA+K++KAKTD
Sbjct: 171 -----FPLPEPLTLGEATRVMSLRDGTKKMSKSDESDYSRINMTDDADAIAQKLRKAKTD 225

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            + LP  V GL  R EA NL+ I+A +  +   + L + GG+ FS FK  L D  +  + 
Sbjct: 226 PEPLPESVEGLSGRPEAANLVGIYAALSDLSKADVLAKVGGQPFSTFKQDLTDLAVSVLQ 285

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PI+ ++  LL D + +D +L +GA RA   A+  +  V + VG 
Sbjct: 286 PINTEMARLLADPASVDAVLRDGAERAGAIAEPILAEVYDTVGF 329


>gi|294085163|ref|YP_003551923.1| Tryptophanyl-tRNA synthetase, class Ib [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292664738|gb|ADE39839.1| Tryptophanyl-tRNA synthetase, class Ib [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 339

 Score =  329 bits (844), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 175/353 (49%), Positives = 234/353 (66%), Gaps = 20/353 (5%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENL 60
           M  S N   SG+QPTG LHLGNYLG IRN +  Q+  +   +Y + DLHA+T       L
Sbjct: 1   MTESANRIFSGIQPTGNLHLGNYLGAIRNWVTLQD--DFESIYCVVDLHAVTVPQDPAQL 58

Query: 61  RYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKE 120
           R  +R   AS +A+G+ P R+I+F QS V  HA L+WI +CVAR+GW+N M QFKEK+ +
Sbjct: 59  RNSTREVTASLIASGISPERSILFNQSRVPQHAQLAWIFNCVARLGWLNRMTQFKEKAGK 118

Query: 121 NKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEV 180
           N+E+ AS+GL+ YP+LMAADIL Y+ATHVPVGEDQ+QHLE+TR IAQ FN+ +E      
Sbjct: 119 NREQ-ASVGLYSYPILMAADILTYKATHVPVGEDQKQHLELTRDIAQAFNSHYEVDC--- 174

Query: 181 AQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIA 240
                         FP+ E  I  SA+R+ SLRD S KMSKSD S+ SRINL D+ D IA
Sbjct: 175 --------------FPLPEPQIFGSATRVMSLRDGSSKMSKSDMSELSRINLTDDNDTIA 220

Query: 241 KKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLAL 300
            KI+KAKTD D LPSE +GL  R EA+NL+ I+A M  + +++ L++FGG+ F  FK AL
Sbjct: 221 AKIRKAKTDADALPSEAAGLAGRPEAENLVGIYAAMASMTVDDVLREFGGRGFGDFKPAL 280

Query: 301 ADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           A   ++++ PI  +++ LL++   LD IL +GA RA   A+  +  V+EIVG 
Sbjct: 281 AALAVDQLAPIGARMRELLENPDELDAILDDGAVRAEAIARPILAEVHEIVGF 333


>gi|329891099|ref|ZP_08269442.1| tryptophanyl-tRNA synthetase [Brevundimonas diminuta ATCC 11568]
 gi|328846400|gb|EGF95964.1| tryptophanyl-tRNA synthetase [Brevundimonas diminuta ATCC 11568]
          Length = 345

 Score =  329 bits (844), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 164/345 (47%), Positives = 225/345 (65%), Gaps = 18/345 (5%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SG+Q +G LHLGNYLG ++     QET   L   F+AD+HAIT     E L  Q+R   
Sbjct: 16  LSGIQASGALHLGNYLGALKRFTELQETGAPL-FVFVADMHAITVWQEPEKLAAQTREIA 74

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A++LA+G+DP++ +IF QS V  HA+L+WI +CV R+GW++ M QFKEKS ++KE + S+
Sbjct: 75  AAYLASGLDPAKAVIFPQSAVPAHAELAWIFNCVGRLGWLDRMTQFKEKSGKHKERS-SV 133

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GL+ YPVL AADILLY+AT VPVGEDQ+QHLE+TR IAQ+FN +F               
Sbjct: 134 GLYTYPVLQAADILLYKATEVPVGEDQKQHLELTRDIAQKFNNDFG-------------- 179

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
             + G+FP+ E LI   A+R+ SLRD + KMSKSD SD SRINL D+ D IA KI+KAKT
Sbjct: 180 --APGYFPLPEPLIQGPATRVMSLRDGAAKMSKSDPSDLSRINLTDDADAIANKIRKAKT 237

Query: 249 DGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
           D + LP  + GLE R EAKNL+ I+A +     E  L +F G+ F  FK  LA+  +  +
Sbjct: 238 DMEPLPETLEGLEGRAEAKNLVAIYAALAGTTREAVLAEFAGQGFGAFKPKLAELAVSSM 297

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
             ++ +++ L+ D + +D  L  GA +AR  A+ T+  V +IVG 
Sbjct: 298 ANVTAEMRRLMNDPAEIDRALAAGAEKAREIAEPTIAEVKKIVGF 342


>gi|126732340|ref|ZP_01748140.1| tryptophanyl-tRNA synthetase [Sagittula stellata E-37]
 gi|126707209|gb|EBA06275.1| tryptophanyl-tRNA synthetase [Sagittula stellata E-37]
          Length = 343

 Score =  329 bits (843), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 164/344 (47%), Positives = 225/344 (65%), Gaps = 19/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G L LGNYLG ++   + Q T     +Y + D+HAIT       L   +R   A
Sbjct: 17  SGIQPSGGLTLGNYLGALKRFAQSQNTGVQ-SIYCMVDMHAITVWQDPATLTRATRELCA 75

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            F+A+G+DP ++I+F QS V  HA L+W+ +CVARMGWM  M Q+K+K+ +N ++ ASLG
Sbjct: 76  GFIASGIDPEKSILFNQSQVAGHAQLAWVFNCVARMGWMQRMTQWKDKAGKN-QQNASLG 134

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LMAADILLY ATHVPVGEDQ+QH+E+TR IA +FN +F                
Sbjct: 135 LFAYPALMAADILLYHATHVPVGEDQKQHVELTRDIAIKFNHDF---------------- 178

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
               FFPI E +I+ +A+R+ SLRD SKKMSKSD SD +RIN+ D+ D IA KI+KAKTD
Sbjct: 179 -GVDFFPIPEPVIEGAATRVMSLRDGSKKMSKSDPSDMARINMTDDADAIASKIRKAKTD 237

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            + LPSE  GLE R EA+NL+ I+A +    +++ L+  GG+ FS+FK  L+D  + ++ 
Sbjct: 238 PEALPSEAEGLEGRAEARNLVRIYAALSDTTVDDVLRDVGGRQFSEFKPMLSDLAVAKLS 297

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PIS ++  L+++ S +D IL  GA RAR  A   +    EIVG+
Sbjct: 298 PISVEMARLMENPSEIDAILARGAERAREIATPVIDRTLEIVGM 341


>gi|114770134|ref|ZP_01447672.1| tryptophanyl-tRNA synthetase [alpha proteobacterium HTCC2255]
 gi|114548971|gb|EAU51854.1| tryptophanyl-tRNA synthetase [alpha proteobacterium HTCC2255]
          Length = 338

 Score =  329 bits (843), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 166/344 (48%), Positives = 224/344 (65%), Gaps = 19/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G L LGNYLG ++  +  Q +     +Y + DLHAIT       L+ Q+R   A
Sbjct: 12  SGIQPSGNLTLGNYLGAVKRFVEMQNSGIET-IYCMVDLHAITVWQDPIALKTQTRELAA 70

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           +++A G+DP+++I+F QS V  HA+L WILSCV R+GWMN M QFK+K+ +N E+  SLG
Sbjct: 71  AYIACGLDPNKSILFNQSQVSAHAELGWILSCVTRLGWMNRMTQFKDKAGKNAEKM-SLG 129

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L+ YP LMAADIL Y+ATHVPVGEDQ+QH+E+TR IA +FN +                 
Sbjct: 130 LYAYPALMAADILAYQATHVPVGEDQKQHVELTRDIAAKFNHD----------------- 172

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
           Y    FP+ E +I+ +A+R+ SLRD SKKMSKSD SD SRIN+ DN D IA KI+KAKTD
Sbjct: 173 YGLELFPLPEPIIEGAATRVMSLRDGSKKMSKSDPSDKSRINMTDNADTIASKIRKAKTD 232

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            D LPSE  GLENR EA+NL+ I+A +    + + LK+FGG+ F  FK  LA+  +  + 
Sbjct: 233 PDSLPSEPKGLENRPEARNLVNIYAALSDSSVSDVLKEFGGQQFGTFKPILAELAVNHLA 292

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PIS ++  L+ D   +D +L +GA RA   A   +K V   VG+
Sbjct: 293 PISSEMARLMDDPVEIDRLLNDGAMRADAIAAPILKKVKNAVGM 336


>gi|84515911|ref|ZP_01003272.1| tryptophanyl-tRNA synthetase [Loktanella vestfoldensis SKA53]
 gi|84510353|gb|EAQ06809.1| tryptophanyl-tRNA synthetase [Loktanella vestfoldensis SKA53]
          Length = 338

 Score =  329 bits (843), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 163/344 (47%), Positives = 223/344 (64%), Gaps = 20/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG++P+G L LGNYLG I+  +  Q T   +  Y + DLHAIT     ++L   +R   A
Sbjct: 12  SGIKPSGGLQLGNYLGAIKRFVGMQGTMETI--YCVVDLHAITVWQDPKDLANGTREVAA 69

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LAAG+DP+++I+F QS V  HA+L WI +CVAR+GWMN M QFK+K+  N E+  SLG
Sbjct: 70  GYLAAGLDPAKSILFNQSRVSGHAELGWIFNCVARVGWMNRMTQFKDKAGSNAEKV-SLG 128

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L+ YP LMAADILLY ATHVPVGEDQ+QH+E+TR IA +FN +                 
Sbjct: 129 LYAYPSLMAADILLYHATHVPVGEDQKQHVELTRDIAAKFNHD----------------- 171

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
           Y   FFP+ E +ID  A+R+ +LRD +KKMSKS  SD  RIN+LD+ D IAKK +KAKTD
Sbjct: 172 YGIDFFPLTEPVIDGPATRVMNLRDGTKKMSKSGDSDMERINMLDDADTIAKKFKKAKTD 231

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            + LP  V GL+ R EA+NL++I+A +     E  + Q+ G  +  FK ALAD  + ++ 
Sbjct: 232 AEPLPETVEGLKTRPEARNLVDIYAALDDTTPEAVIAQYPGAGWGTFKPALADLAVAKLA 291

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PISQ +   + D + +D IL +GA++AR  AQ  ++   +IVGL
Sbjct: 292 PISQDMARFMADPAEIDRILAQGADKARAIAQPVLQRTYDIVGL 335


>gi|77462353|ref|YP_351857.1| tryptophanyl-tRNA synthetase [Rhodobacter sphaeroides 2.4.1]
 gi|77386771|gb|ABA77956.1| tryptophanyl-tRNA synthetase [Rhodobacter sphaeroides 2.4.1]
          Length = 357

 Score =  328 bits (842), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 165/344 (47%), Positives = 224/344 (65%), Gaps = 19/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G L LGNYLG ++     Q+      +Y + D+HAIT       LR Q+R   A
Sbjct: 27  SGIQPSGGLTLGNYLGALKRFAEMQKDGVET-IYCVVDMHAITVWQDPAKLRQQTREIAA 85

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           +FLAAGVDP R+I+F QS V  HA+L+WI +CVARMGWMN M Q+K+K+ +N E  ASLG
Sbjct: 86  AFLAAGVDPVRSILFNQSQVTAHAELAWIFNCVARMGWMNRMTQWKDKAGKNAE-AASLG 144

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LMAADIL YRATHVPVGEDQ+QH+E+TR IA +FN +F                
Sbjct: 145 LFAYPALMAADILAYRATHVPVGEDQKQHVELTRDIAIKFNNDF---------------- 188

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
               FFP+ E +I+  A+R+ SLRD +KKMSKSD SD SRIN+ D+ D I +KI+KAKTD
Sbjct: 189 -GVNFFPVTEPVIEGVATRVMSLRDGTKKMSKSDPSDQSRINMTDDADTITQKIRKAKTD 247

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            + LP  + GL+ R EA+NL+ I+A + +   E  + +F G  F  FK  LA+  +  + 
Sbjct: 248 PEPLPDSIEGLKERPEARNLVNIYAALSRSTPEAVVAEFAGAQFGSFKPKLAELAVSVMA 307

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PIS ++  L+ D + +D IL +GA+RA   A+  +  V++IVG+
Sbjct: 308 PISDEMNRLMADPAEIDRILGDGADRAEALARPVLDEVHDIVGM 351


>gi|159184271|ref|NP_353381.2| tryptophanyl-tRNA synthetase [Agrobacterium tumefaciens str. C58]
 gi|25009433|sp|Q8UIE8|SYW_AGRT5 RecName: Full=Tryptophanyl-tRNA synthetase; AltName:
           Full=Tryptophan--tRNA ligase; Short=TrpRS
 gi|159139598|gb|AAK86166.2| tryptophan-tRNA ligase [Agrobacterium tumefaciens str. C58]
          Length = 354

 Score =  328 bits (841), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 174/349 (49%), Positives = 241/349 (69%), Gaps = 5/349 (1%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           L  SGVQPTG LHLGNYLG IR  +  QE  + +  Y + D+HAIT  +V  +L+ Q+R 
Sbjct: 7   LVFSGVQPTGNLHLGNYLGAIRKFVALQEDNDCI--YCVVDMHAITAQLVHSDLKAQTRS 64

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A+F+AAG+DP ++I+F QS V  HA+L+W+ +CVAR+GWM  M QFK+KS +N E+  
Sbjct: 65  IAAAFIAAGIDPVKHIVFNQSAVPQHAELAWVFNCVARIGWMERMTQFKDKSGKNAEQV- 123

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKE--VAQKY 184
           SLGL  YP LMAADIL+YRATHVPVG+DQ+QHLE+ R IAQ+FN +F   I+   +    
Sbjct: 124 SLGLLAYPSLMAADILVYRATHVPVGDDQKQHLELARDIAQKFNIDFGGHIRNAGLGVNI 183

Query: 185 AQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQ 244
              ++    +FP++E LI   A R+ SL+D +KKMSKSD SD SRINL+D+ D I+KKI+
Sbjct: 184 TVGDEPVHAYFPMVEPLIGGPAPRVMSLKDGTKKMSKSDPSDLSRINLMDDVDAISKKIK 243

Query: 245 KAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           KAKTD D LPSEV GL+ R EA+NL+ I+A +      + L +FGG+ FS FK AL +  
Sbjct: 244 KAKTDPDALPSEVEGLKGRPEAENLVGIYAALSDKTKADVLAEFGGQQFSTFKPALVELA 303

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           +  + P++ +++ LL D +++D IL +G  RAR  A++TM  V +I+G 
Sbjct: 304 VNVLAPVNNEMRRLLDDPTHIDAILSQGGERARTIAEKTMNEVRDIIGF 352


>gi|85704569|ref|ZP_01035671.1| tryptophanyl-tRNA synthetase [Roseovarius sp. 217]
 gi|85670977|gb|EAQ25836.1| tryptophanyl-tRNA synthetase [Roseovarius sp. 217]
          Length = 342

 Score =  328 bits (841), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 167/344 (48%), Positives = 227/344 (65%), Gaps = 19/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G LHLGNYLG ++     Q       +Y + DLHA+T      +L   +R   A
Sbjct: 12  SGIQPSGNLHLGNYLGALKRFAEAQNKGIQT-LYCMVDLHAVTVWQEPADLARATRELAA 70

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            F+A+G+DP+++I+F QS V  H+ ++W+ +CVARMGWM  M QFK+K+ +N +  ASLG
Sbjct: 71  GFIASGLDPAKSILFNQSQVAEHSQMAWVFNCVARMGWMQRMTQFKDKAGKNAQ-NASLG 129

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LMAADIL Y ATHVPVGEDQ+QHLE+TR IA +FN +                 
Sbjct: 130 LFAYPALMAADILTYHATHVPVGEDQKQHLELTRDIAMKFNHD----------------- 172

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
           Y   FFPI E +I+ S +R+ SLRD S KMSKSD SD SRINL D+ D IAKKI+KAKTD
Sbjct: 173 YGVDFFPIPEPVIEGSGTRVMSLRDGSNKMSKSDPSDMSRINLTDDADAIAKKIRKAKTD 232

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            + LPSE +GLE R EA+NL+ I+A +  + +++ + + GGK FS+FK  LAD  ++ I 
Sbjct: 233 PEPLPSEAAGLEGRPEARNLVNIYAALADMTVDQVMAEAGGKPFSEFKPMLADLAVDRIA 292

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PIS ++  L++D S +D IL +GA RAR  A   ++   EI+G+
Sbjct: 293 PISTEMARLMQDLSEIDRILADGAARARAMAAPILRQTYEIMGM 336


>gi|254510348|ref|ZP_05122415.1| tryptophanyl-tRNA synthetase [Rhodobacteraceae bacterium KLH11]
 gi|221534059|gb|EEE37047.1| tryptophanyl-tRNA synthetase [Rhodobacteraceae bacterium KLH11]
          Length = 342

 Score =  328 bits (840), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 165/344 (47%), Positives = 225/344 (65%), Gaps = 19/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G L LGNYLG ++  +  Q       +Y + DLHAIT       L + +R   A
Sbjct: 12  SGIQPSGGLTLGNYLGAMKRFVDMQGP-EFETIYCMVDLHAITVWQDPAALSHNTRELCA 70

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            ++AAG+DP ++I+F QS V  HA L+WI +CVARMGWM  M Q+K+K+ +N +  ASLG
Sbjct: 71  GYIAAGIDPEQSILFNQSQVPEHAQLAWIFNCVARMGWMQRMTQWKDKAGKNTQ-NASLG 129

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LMAADIL+Y ATHVPVGEDQ+QHLE+TR IA +FN +F                
Sbjct: 130 LFAYPALMAADILIYHATHVPVGEDQKQHLELTRDIAIKFNNDF---------------- 173

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
               FFP+ E +I+ +A+R+ SLRD SKKMSKSD SD SRIN+ D+ D IA+KI+KAKTD
Sbjct: 174 -GVDFFPVTEPVIEGAATRVMSLRDGSKKMSKSDPSDMSRINMTDDADTIARKIRKAKTD 232

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            D LPSEV GLE R EA+NL+ I+A + +  +++ L + GGK F  FK  LA+  + ++ 
Sbjct: 233 PDALPSEVKGLEERPEARNLVNIYAALSEQTVDQVLTEAGGKQFGAFKPMLAELAVSKLS 292

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PIS ++  L+ +++ +D IL  GA RAR  A   ++    IVG+
Sbjct: 293 PISSEMARLMGEEAEIDRILARGAERAREIAAPILQQTYAIVGM 336


>gi|326386376|ref|ZP_08207999.1| tryptophanyl-tRNA synthetase [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326209037|gb|EGD59831.1| tryptophanyl-tRNA synthetase [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 339

 Score =  328 bits (840), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 167/349 (47%), Positives = 229/349 (65%), Gaps = 18/349 (5%)

Query: 8   FVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLG---MYFIADLHAITNNIVQENLRYQS 64
            VSG+QPTG LHLGNYLG IRN +  Q+     G   +YF+ADLHAI+       L   +
Sbjct: 3   IVSGIQPTGNLHLGNYLGAIRNWVLMQDEWTAKGATCLYFLADLHAISMPHQPATLAENT 62

Query: 65  RLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEE 124
           R  VA+ ++ G+DP ++I+F Q+ V  HA+L W+L+  ARMGW+N M Q+K+K+ +N+E 
Sbjct: 63  REMVAALVSCGIDPDKSILFNQAQVPAHAELQWLLNGTARMGWLNRMTQWKDKAGKNRE- 121

Query: 125 TASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKY 184
            AS+ LF YPVL AAD+LLY+ATHVPVGEDQ+QHLE+ R IAQ+FN +F           
Sbjct: 122 GASVALFTYPVLQAADVLLYQATHVPVGEDQKQHLELARDIAQKFNNDF----------- 170

Query: 185 AQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQ 244
           A EE      F + + +I   A+RI SLRD S KMSKSD SD SRINL D+ D I +K++
Sbjct: 171 ASEE---APVFTLPDPIIPPEAARIMSLRDGSAKMSKSDPSDMSRINLTDDADAIMQKVK 227

Query: 245 KAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           KAKTD + LPSE +GLE R EA+NL+ I+A      +   L +FGG+ F  FK AL D +
Sbjct: 228 KAKTDPEPLPSEAAGLEGRPEARNLVGIYAAFSGRDVASILAEFGGQGFGSFKPALGDLL 287

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           ++++ PI+++ + L  D+S LD IL +GA +AR  A  T++     +GL
Sbjct: 288 VDKLEPIAERYRALRIDRSALDAILAKGAEKARVLATPTLEAAYGALGL 336


>gi|126461229|ref|YP_001042343.1| tryptophanyl-tRNA synthetase [Rhodobacter sphaeroides ATCC 17029]
 gi|126102893|gb|ABN75571.1| tryptophanyl-tRNA synthetase [Rhodobacter sphaeroides ATCC 17029]
          Length = 357

 Score =  328 bits (840), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 165/344 (47%), Positives = 223/344 (64%), Gaps = 19/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G L LGNYLG ++     Q+      +Y + D+HAIT       LR Q+R   A
Sbjct: 27  SGIQPSGGLTLGNYLGALKRFAEMQKDGVET-IYCVVDMHAITVWQDPAKLRQQTREIAA 85

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           +FLAAGVDP R+I+F QS V  HA+L+WI +CVARMGWMN M Q+K+K+ +N E  ASLG
Sbjct: 86  AFLAAGVDPVRSILFNQSQVTAHAELAWIFNCVARMGWMNRMTQWKDKAGKNAE-AASLG 144

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LMAADIL YRATHVPVGEDQ+QH+E+TR IA +FN +F                
Sbjct: 145 LFAYPALMAADILAYRATHVPVGEDQKQHVELTRDIAIKFNNDF---------------- 188

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
               FFP+ E +I+  A+R+ SLRD +KKMSKSD SD SRIN+ D+ D I +KI+KAKTD
Sbjct: 189 -GVNFFPVTEPVIEGVATRVMSLRDGTKKMSKSDPSDQSRINMTDDADTITQKIRKAKTD 247

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            + LP  + GL+ R EA+NL+ I+A + +   E  + +F G  F  FK  LA+  +  + 
Sbjct: 248 PEPLPDSIEGLKERPEARNLVNIYAALSRSTPEAVVAEFAGAQFGSFKPKLAELAVSVMA 307

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PIS ++  L+ D + +D IL +GA+RA   A+  +  V +IVG+
Sbjct: 308 PISDEMNRLMADPAEIDRILGDGADRAEALARPVLDEVYDIVGM 351


>gi|259416574|ref|ZP_05740494.1| tryptophanyl-tRNA synthetase [Silicibacter sp. TrichCH4B]
 gi|259348013|gb|EEW59790.1| tryptophanyl-tRNA synthetase [Silicibacter sp. TrichCH4B]
          Length = 342

 Score =  328 bits (840), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 164/344 (47%), Positives = 228/344 (66%), Gaps = 19/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G LHLGNYLG ++  +  Q + +   +Y + DLHAIT      +L+  +R   A
Sbjct: 12  SGIQPSGNLHLGNYLGALKRFVDWQ-SRDVESIYCMVDLHAITVWQDPADLKKATRELCA 70

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            F+AAG+DP ++I+  QS V  HA L+WI +CVARMGWM  M Q+K+K+ +N ++ ASLG
Sbjct: 71  GFIAAGLDPEKSILINQSQVPEHAQLAWIFNCVARMGWMQRMTQWKDKAGKN-QQNASLG 129

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L  YP LMAADIL+Y ATHVPVGEDQ+QHLE+TR IA +FN +                 
Sbjct: 130 LLAYPSLMAADILIYHATHVPVGEDQKQHLELTRDIATKFNHD----------------- 172

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
           Y   FFP+ E +I+ +A+R+ SLRD SKKMSKSD SD SRINL D+ D IAKKI+KAKTD
Sbjct: 173 YGVDFFPLTEPVIEGAATRVMSLRDGSKKMSKSDPSDASRINLTDDADTIAKKIRKAKTD 232

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            + LPSE  GLE R EA+NL+ I+A +    +++ L   GGK FS+FK  LAD  ++++ 
Sbjct: 233 PEALPSEAKGLEERPEARNLVNIYAALSGQTVDQVLADVGGKQFSEFKPMLADLAVDKMS 292

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PI+ ++  L++++  +D IL  G+ RAR      ++   +IVG+
Sbjct: 293 PITTEMARLMENQDEIDKILARGSERAREITAPILRKTYDIVGM 336


>gi|332560236|ref|ZP_08414558.1| tryptophanyl-tRNA synthetase [Rhodobacter sphaeroides WS8N]
 gi|332277948|gb|EGJ23263.1| tryptophanyl-tRNA synthetase [Rhodobacter sphaeroides WS8N]
          Length = 347

 Score =  327 bits (839), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 165/344 (47%), Positives = 223/344 (64%), Gaps = 19/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G L LGNYLG ++     Q+      +Y + D+HAIT       LR Q+R   A
Sbjct: 17  SGIQPSGGLTLGNYLGALKRFAEMQKDGVET-IYCVVDMHAITVWQDPAKLRQQTREIAA 75

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           +FLAAGVDP R+I+F QS V  HA+L+WI +CVARMGWMN M Q+K+K+ +N E  ASLG
Sbjct: 76  AFLAAGVDPVRSILFNQSQVTAHAELAWIFNCVARMGWMNRMTQWKDKAGKNAE-AASLG 134

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LMAADIL YRATHVPVGEDQ+QH+E+TR IA +FN +F                
Sbjct: 135 LFAYPALMAADILAYRATHVPVGEDQKQHVELTRDIAIKFNNDF---------------- 178

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
               FFP+ E +I+  A+R+ SLRD +KKMSKSD SD SRIN+ D+ D I +KI+KAKTD
Sbjct: 179 -GVNFFPVTEPVIEGVATRVMSLRDGTKKMSKSDPSDQSRINMTDDADTITQKIRKAKTD 237

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            + LP  + GL+ R EA+NL+ I+A + +   E  + +F G  F  FK  LA+  +  + 
Sbjct: 238 PEPLPDSIEGLKERPEARNLVNIYAALSRSTPEAVVAEFAGAQFGSFKPKLAELAVSVMA 297

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PIS ++  L+ D + +D IL +GA+RA   A+  +  V +IVG+
Sbjct: 298 PISDEMNRLMADPAEIDRILGDGADRAEALARPVLDEVYDIVGM 341


>gi|84499738|ref|ZP_00998026.1| tryptophanyl-tRNA synthetase [Oceanicola batsensis HTCC2597]
 gi|84392882|gb|EAQ05093.1| tryptophanyl-tRNA synthetase [Oceanicola batsensis HTCC2597]
          Length = 349

 Score =  327 bits (839), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 165/347 (47%), Positives = 224/347 (64%), Gaps = 21/347 (6%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLG---MYFIADLHAITNNIVQENLRYQSRL 66
           SG+QP+G L LGNYLG IR  +  QE     G   +Y + D HAIT       L   +R 
Sbjct: 18  SGIQPSGGLTLGNYLGAIRRFVDMQEENADRGIETLYCMVDQHAITVWQDPAALTRNTRE 77

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A ++AAG+DP+++I+F QS V  HA L+WI +CVARMGWM  M Q+K+K+ +N ++ A
Sbjct: 78  LAAGYIAAGLDPNKSILFNQSQVAAHAQLAWIFNCVARMGWMQRMTQWKDKAGKN-QQNA 136

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           SLGLF YP LMAADIL+Y ATHVPVGEDQ+QH+E+TR IA +FN +F             
Sbjct: 137 SLGLFAYPALMAADILIYHATHVPVGEDQKQHVELTRDIAIKFNHDF------------- 183

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                  FFP+ E +I+ +A+R+ SLRD ++KMSKSD SD +RIN+ D+ D IA KI+KA
Sbjct: 184 ----GVDFFPVPEPVIEGAATRVMSLRDGARKMSKSDPSDMARINMTDDADAIASKIRKA 239

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
           +TD D LPSE  GL  R EA+NL+ I+A +    I E L + GGK FS+FK  L++  + 
Sbjct: 240 RTDPDALPSEAEGLAERPEARNLVNIYAALSDRSIAEVLTEVGGKQFSEFKPMLSELAVA 299

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           ++ PIS ++  L++    +D IL  GA+RAR  A   +K   EIVG+
Sbjct: 300 KLAPISSEMARLMETPDEIDAILRNGADRARTIAAPVLKKTYEIVGM 346


>gi|254295437|ref|YP_003061460.1| tryptophanyl-tRNA synthetase [Hirschia baltica ATCC 49814]
 gi|254043968|gb|ACT60763.1| tryptophanyl-tRNA synthetase [Hirschia baltica ATCC 49814]
          Length = 343

 Score =  327 bits (838), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 173/344 (50%), Positives = 230/344 (66%), Gaps = 19/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G LHLGNYLG + N +  Q+   H  ++   DLHAIT     + L  Q+R  VA
Sbjct: 16  SGMQPSGDLHLGNYLGALINWVNMQDA--HECVFCAVDLHAITVPQDPKLLAGQTREIVA 73

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           ++LAAG+DP +NI+F QS V  H +L+WIL+C ARMGW   M QFK+K+ ++ E  AS+G
Sbjct: 74  AWLAAGIDPKKNIVFAQSSVRAHTELAWILNCTARMGWAERMTQFKDKAGKDAER-ASVG 132

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YPVLMAADIL Y+ATHVPVG+DQ+QHLE+TR  A RFN +F                
Sbjct: 133 LFTYPVLMAADILAYKATHVPVGDDQKQHLELTRDCANRFNRDFN--------------- 177

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
            +  FFPI E LI    +RI SL+D +KKMSKSD S+ SRINL+D+ D IAKKI+KAK+D
Sbjct: 178 -APDFFPIPEPLIQGPGARIMSLKDGTKKMSKSDPSELSRINLIDDADTIAKKIKKAKSD 236

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            DVLPSEV GL+ R EA+NL+ I+  +      + L +FGG+ F +FK ALA+  +E++ 
Sbjct: 237 ADVLPSEVEGLDGRPEARNLVGIYGALSNKSSADVLAEFGGEGFGKFKPALAELAVEKMA 296

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PISQK++  + D + +D +L EGA RA   A   +K V +IVG 
Sbjct: 297 PISQKMRDYIADPAQIDAVLEEGAERASSLADPILKEVRQIVGF 340


>gi|84686322|ref|ZP_01014217.1| tryptophanyl-tRNA synthetase [Maritimibacter alkaliphilus HTCC2654]
 gi|84665849|gb|EAQ12324.1| tryptophanyl-tRNA synthetase [Rhodobacterales bacterium HTCC2654]
          Length = 339

 Score =  327 bits (837), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 161/354 (45%), Positives = 226/354 (63%), Gaps = 22/354 (6%)

Query: 4   SDNLF----VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQEN 59
           SD  F     SG++P+G L LGNYLG I+  +  QE   +  ++ + D+HAIT      +
Sbjct: 2   SDQTFPPRVFSGIKPSGGLTLGNYLGAIKRWVEMQEDPTYETIFCVVDMHAITVWQDPAD 61

Query: 60  LRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSK 119
           L   +R   AS +A+G+DP R+++F Q+ V  H +L W+ SCVAR+GWMN M QFK+K+ 
Sbjct: 62  LTRATREVAASMIASGIDPERSVLFNQARVPAHVELGWLFSCVARVGWMNRMTQFKDKAG 121

Query: 120 ENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKE 179
           +N E+  SLGL+ YP LMAADILLY ATHVPVGEDQ+QH+E+TR IA +FN +       
Sbjct: 122 KNAEKV-SLGLYAYPALMAADILLYHATHVPVGEDQKQHVELTRDIAAKFNHD------- 173

Query: 180 VAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDII 239
                     Y   FFP+ E + +  A R+ +LRD SKKMSKS  SD  RIN+LD+ D I
Sbjct: 174 ----------YGVDFFPLTEPVTEGPAMRVMNLRDGSKKMSKSGESDMERINMLDDADTI 223

Query: 240 AKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLA 299
           +KK +KA+TD + LPSEV+GL++R EAKNL++I+A +     E  L +FGG+ + +FK A
Sbjct: 224 SKKFKKARTDPEALPSEVAGLKDRPEAKNLVDIYAGLSDTTAEAVLAEFGGEGWGKFKPA 283

Query: 300 LADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           LAD  + ++ P+S +++ LL     LD I+  GA RA   A+  +K   EI+G 
Sbjct: 284 LADLAVAKLAPVSDEMRRLLDAPDELDAIMARGAERASALAEPILKKTYEIMGF 337


>gi|260428343|ref|ZP_05782322.1| tryptophanyl-tRNA synthetase [Citreicella sp. SE45]
 gi|260422835|gb|EEX16086.1| tryptophanyl-tRNA synthetase [Citreicella sp. SE45]
          Length = 344

 Score =  326 bits (836), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 169/344 (49%), Positives = 231/344 (67%), Gaps = 19/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G L LGNYLG I+  +  Q +     +Y + D+HAIT       L  Q+R   A
Sbjct: 17  SGIQPSGGLTLGNYLGAIKRFVDMQGSGVET-IYCVVDMHAITVWQDPAALVRQTRELTA 75

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LAAG+DP+R+I+F QS V  HA L WI +CVAR+GWMN M QFK+K+ +N E+ ASLG
Sbjct: 76  GYLAAGLDPTRSILFNQSQVAEHAQLGWIFNCVARLGWMNRMTQFKDKAGKNAEK-ASLG 134

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L+ YP LMAADILLY ATHVPVGEDQ+QH+E+TR IA +FN +F  +             
Sbjct: 135 LYAYPALMAADILLYHATHVPVGEDQKQHVELTRDIAAKFNHDFGTE------------- 181

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
               FFP+ E +I+ +A+R+ SLRD SKKMSKSD SD SRIN+ D+ D IAKKI+KAKTD
Sbjct: 182 ----FFPMTEPVIEGAATRVMSLRDGSKKMSKSDPSDASRINMTDDADAIAKKIRKAKTD 237

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            + LPSE  GL  R EA+NL+ I+A + +  +E+ + + GG+ FS+FK  LAD  ++++ 
Sbjct: 238 PEPLPSEAEGLAERPEARNLVNIYAALSEQTVEQVMAEVGGRPFSEFKPLLADLAVDKLA 297

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PIS ++   ++D + +D IL +GA RAR  A   ++   EIVG+
Sbjct: 298 PISTEMARYMQDPAEIDRILKDGAGRARAIAAPILQKTYEIVGM 341


>gi|146276518|ref|YP_001166677.1| tryptophanyl-tRNA synthetase [Rhodobacter sphaeroides ATCC 17025]
 gi|145554759|gb|ABP69372.1| tryptophanyl-tRNA synthetase [Rhodobacter sphaeroides ATCC 17025]
          Length = 347

 Score =  326 bits (836), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 164/344 (47%), Positives = 224/344 (65%), Gaps = 19/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G L LGNYLG ++     Q+      +Y + D+HAIT       LR Q+R   A
Sbjct: 17  SGIQPSGGLTLGNYLGALKRFADMQKDGVET-IYCVVDMHAITVWQDPAKLRQQTREIAA 75

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           +F+AAGVDP R+I+F QS V  HA+L+WI +CVARMGWMN M Q+K+K+ +N E  ASLG
Sbjct: 76  AFIAAGVDPVRSILFNQSQVTAHAELAWIFNCVARMGWMNRMTQWKDKAGKNAE-AASLG 134

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LMAADIL YRATHVPVGEDQ+QH+E+TR IA +FN +F                
Sbjct: 135 LFAYPALMAADILAYRATHVPVGEDQKQHVELTRDIAIKFNNDF---------------- 178

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
               FFP+ E +I+  A+R+ SLRD ++KMSKSD SD SRIN+ D+ D I +KI+KAKTD
Sbjct: 179 -GVNFFPVTEPVIEGVATRVMSLRDGTRKMSKSDPSDQSRINMTDDADTITQKIRKAKTD 237

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            + LP  + GL++R EA+NL+ I+A + Q   E  + +F G  F  FK  LA+  +  + 
Sbjct: 238 PEPLPDTIDGLKDRPEARNLVNIYAALSQSTPEAVVAEFAGAQFGTFKPKLAELAVSVMA 297

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PIS ++  L+ D + +D IL  GA+RA   A+  ++ V +IVG+
Sbjct: 298 PISSEMNRLMADPAEIDRILGAGADRADALARPILEQVYDIVGM 341


>gi|87198612|ref|YP_495869.1| tryptophanyl-tRNA synthetase [Novosphingobium aromaticivorans DSM
           12444]
 gi|87134293|gb|ABD25035.1| tryptophanyl-tRNA synthetase [Novosphingobium aromaticivorans DSM
           12444]
          Length = 339

 Score =  325 bits (832), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 160/349 (45%), Positives = 228/349 (65%), Gaps = 18/349 (5%)

Query: 8   FVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLG---MYFIADLHAITNNIVQENLRYQS 64
            VSG+QPTG LHLGNYLG IRN +R Q+  +  G   +YF+ADLHAI+       L   +
Sbjct: 3   IVSGIQPTGNLHLGNYLGAIRNWVRMQDEWSAKGGECLYFLADLHAISMPHSPAELAANT 62

Query: 65  RLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEE 124
           R  VA+ ++ G+DP ++++F Q+ V  HA++ W+L+  ARMGW+N M Q+K+K+ +N+E 
Sbjct: 63  REMVAALVSCGIDPDKSVLFNQAQVPAHAEMQWLLNGTARMGWLNRMTQWKDKAGKNRE- 121

Query: 125 TASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKY 184
            AS+ LF YPVL AAD+LLY+ATHVPVGEDQ+QHLE+ R +AQ+FN +F  +   V    
Sbjct: 122 GASVALFTYPVLQAADVLLYQATHVPVGEDQKQHLELARDVAQKFNNDFASEDAPV---- 177

Query: 185 AQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQ 244
                     F + + +I   A+RI SLRD S KMSKSD SD SRINL D+ D I +K++
Sbjct: 178 ----------FTLPDPIIPPEAARIMSLRDGSAKMSKSDPSDMSRINLTDDADAIMQKVR 227

Query: 245 KAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           KAKTD + LP  + GL  R EA NL+ I+A M  I   + L +F G+ F QFK AL + +
Sbjct: 228 KAKTDPEPLPGTMEGLAGRPEANNLVGIYAAMAGISPADVLARFEGQGFGQFKPALGELL 287

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           +E++ P++ + + L +D++ LD IL +GA +AR  A  T+    + +GL
Sbjct: 288 VEKLSPMAARYRELREDRAALDAILAKGAEKARALAAPTLARTYDALGL 336


>gi|221638211|ref|YP_002524473.1| tryptophanyl-tRNA synthetase [Rhodobacter sphaeroides KD131]
 gi|221158992|gb|ACL99971.1| Tryptophanyl-tRNA synthetase precursor [Rhodobacter sphaeroides
           KD131]
          Length = 347

 Score =  324 bits (831), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 165/344 (47%), Positives = 222/344 (64%), Gaps = 19/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G L LGNYLG ++     Q+      +Y + D+HAIT       LR Q+R   A
Sbjct: 17  SGIQPSGGLTLGNYLGALKRFAEMQKDGVET-IYCVVDMHAITVWQDPAKLRQQTREIAA 75

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           +FLAAGVDP R+I+F QS V  HA+L+WI +CVARMGWMN M Q+K+K+ +N E  ASLG
Sbjct: 76  AFLAAGVDPVRSILFNQSQVTAHAELAWIFNCVARMGWMNRMTQWKDKAGKNAE-AASLG 134

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LMAADIL YRATHVPVGEDQ+QH+E+TR IA +FN +F                
Sbjct: 135 LFAYPALMAADILAYRATHVPVGEDQKQHVELTRDIAIKFNNDF---------------- 178

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
               FFP+ E +I+  A+R+ SLRD +KKMSKSD SD SRIN+ D+ D I +KI KAKTD
Sbjct: 179 -GVNFFPVTEPVIEGVATRVMSLRDGTKKMSKSDPSDQSRINMTDDADTITRKIHKAKTD 237

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
              LP  + GL+ R EA+NL+ I+A + +   E  + +F G  F  FK  LA+  +  + 
Sbjct: 238 PLPLPYSIEGLKERPEARNLVNIYAALSRSTPEAVVTEFAGAPFGVFKPKLAELAVSVMA 297

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PIS ++  L+ D + +D IL +GA+RA   A+  +  V++IVG+
Sbjct: 298 PISDEMNRLMADPAEIDRILGDGADRAEALARPVLDEVHDIVGM 341


>gi|83945033|ref|ZP_00957399.1| tryptophanyl-tRNA synthetase [Oceanicaulis alexandrii HTCC2633]
 gi|83851815|gb|EAP89670.1| tryptophanyl-tRNA synthetase [Oceanicaulis alexandrii HTCC2633]
          Length = 347

 Score =  322 bits (826), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 167/352 (47%), Positives = 228/352 (64%), Gaps = 19/352 (5%)

Query: 3   SSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIA-DLHAITNNIVQENLR 61
           S     +SG+QPTG LHLGNYLG ++N +  Q++      +F A D+HA+T       L 
Sbjct: 9   SGPERILSGMQPTGGLHLGNYLGALKNWVPMQDSGKEC--FFCAVDMHAMTVEYDPAVLP 66

Query: 62  YQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKEN 121
            + R   A+++AAGVDP R+ IF QS V  HA+L+W+L CVARMGWM  M QFK+K+   
Sbjct: 67  DRVRGVAAAYIAAGVDPKRSAIFAQSAVPEHAELNWVLQCVARMGWMERMTQFKDKAGSG 126

Query: 122 KE-ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEV 180
           K+ E AS+GLF YPVLMAADIL+Y+ATHVPVG+DQ+QHLE+ R IA RFN +F     E+
Sbjct: 127 KDAERASVGLFTYPVLMAADILVYKATHVPVGDDQKQHLELARDIAARFNRDFGGD--EI 184

Query: 181 AQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIA 240
                          P  E +I  + +RI SL+D +KKMSKSD SD +RINL D+ D IA
Sbjct: 185 -------------ILPQPEPVILPTGARIMSLKDGTKKMSKSDPSDNARINLHDDADTIA 231

Query: 241 KKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLAL 300
           +KI+KAKTD + LP    GL +R EAKNL+ ++A +    + + L +FGG+ F  FK  L
Sbjct: 232 RKIKKAKTDPEPLPETAEGLNDRPEAKNLVGLYAALTGQSVADVLGEFGGQGFGVFKPKL 291

Query: 301 ADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVG 352
           A+A ++ I P+S++   LL DKS +D +L +GA RAR  A+  M  V +++G
Sbjct: 292 AEAAVQYIAPVSEEYARLLNDKSEIDAVLKDGAERARNAARPVMAEVKKLIG 343


>gi|209965901|ref|YP_002298816.1| tryptophanyl-tRNA synthetase TrpS [Rhodospirillum centenum SW]
 gi|209959367|gb|ACJ00004.1| tryptophanyl-tRNA synthetase TrpS [Rhodospirillum centenum SW]
          Length = 332

 Score =  322 bits (826), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 169/348 (48%), Positives = 224/348 (64%), Gaps = 20/348 (5%)

Query: 6   NLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSR 65
           N   SG+QPT  LHLGNYLG +RN +  Q+  ++  ++ + D+HAIT +   E LR   R
Sbjct: 2   NRIFSGMQPTHQLHLGNYLGALRNWVALQK--DYECIFCVVDMHAITIDHRPEVLRENIR 59

Query: 66  LFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEET 125
              A+++AAG+DP +NI+F QS V  HA+L+W+ +C   +GW+N M QFKEK+ +++E  
Sbjct: 60  EVTAAYIAAGIDPEKNILFNQSAVPGHAELNWVFACHTPLGWLNRMTQFKEKAGKHRE-N 118

Query: 126 ASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYA 185
           A LGL+ YPVLMAADILLY+ATHVPVGEDQ+QHLE+ R I   FN  +ER+         
Sbjct: 119 AVLGLYAYPVLMAADILLYKATHVPVGEDQKQHLELARDIGGAFNRYYERE--------- 169

Query: 186 QEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQK 245
                   FFP+ E  I   A+R+ SLRD +KKMSKSD SD+SRINL D+PD IA KI+K
Sbjct: 170 --------FFPLPEPQILGEATRVMSLRDGTKKMSKSDESDYSRINLTDDPDTIALKIRK 221

Query: 246 AKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVI 305
           AKTD + LP  V  LE R EA NL+ I A +     ++ L +  G  FS FK AL D  +
Sbjct: 222 AKTDPEPLPETVEELEKRPEADNLVTIMAALTGRARKDVLAEHAGSQFSGFKGALVDVAV 281

Query: 306 EEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
             + PI+ ++  LL DK+ +D IL  GA RA   A+ETM  V +IVGL
Sbjct: 282 ATLGPITAEMNRLLGDKAEIDRILKRGAERAGAIAEETMNEVKDIVGL 329


>gi|144900391|emb|CAM77255.1| Tryptophanyl-tRNA synthetase [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 332

 Score =  322 bits (826), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 164/344 (47%), Positives = 224/344 (65%), Gaps = 20/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQPTG LHLGNYLG IRN +R Q+   +  ++ + D HAIT     + L   +R   A
Sbjct: 6   SGVQPTGNLHLGNYLGAIRNWVRLQD--QYECIFCMVDQHAITVWQDPKELTRNTREVAA 63

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
             +AAG+DP++N++F QS V  HA L+W+ +CVARMGW+N M QFKEK+ ++KE  AS+G
Sbjct: 64  GMIAAGIDPAKNVLFNQSTVPAHAQLAWVFNCVARMGWLNRMTQFKEKAGKHKE-NASVG 122

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LM+ADIL+Y+ATHVPVGEDQ+QHLE+ R  AQ+FN +                 
Sbjct: 123 LFAYPNLMSADILIYKATHVPVGEDQKQHLELARDTAQKFNND----------------- 165

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
           Y   FFP+ E LI  +A+R+ SLRD +KKMSKSD SD+SRIN+ D+ D IA K++KAKTD
Sbjct: 166 YGVDFFPLPEPLIFGAATRVMSLRDGAKKMSKSDESDYSRINMTDDADTIALKVRKAKTD 225

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
              +P  V GLE R EA NL+ I+A +      E +  F  + FS+FK  L D  +  + 
Sbjct: 226 LFPMPHSVEGLEERPEASNLLGIYAALSDRDKTEVIHHFAERQFSEFKAELVDLAVSVLG 285

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PI+ +++ L+ D S++D +L +GA RA   A+  +K V +IVG 
Sbjct: 286 PINAEMKRLMADPSHIDAVLRQGAERANAIAEPILKDVYDIVGF 329


>gi|163735278|ref|ZP_02142713.1| tryptophanyl-tRNA synthetase [Roseobacter litoralis Och 149]
 gi|161391492|gb|EDQ15826.1| tryptophanyl-tRNA synthetase [Roseobacter litoralis Och 149]
          Length = 337

 Score =  322 bits (825), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 161/344 (46%), Positives = 224/344 (65%), Gaps = 20/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G L LGNYLG I+  +  Q+   +  +Y + DLHAIT     ++L + +R   A
Sbjct: 12  SGIQPSGGLTLGNYLGAIKRFVSMQD--EYPCVYCMVDLHAITVWQDPKDLVHNTRELAA 69

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
             +A+G+ P ++I+  QS V  HA L W+ +CVARMGWM  M QFK+K+ +N +  ASLG
Sbjct: 70  GLIASGISPEKSILINQSQVPEHAQLGWVFNCVARMGWMQRMTQFKDKAGKNAQ-NASLG 128

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LMAADIL+Y ATHVPVGEDQ+QHLE+TR IA +FN +                 
Sbjct: 129 LFGYPALMAADILIYHATHVPVGEDQKQHLELTRDIAAKFNHD----------------- 171

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
           Y   FFP+ E +I+ +A+R+ SLRD SKKMSKSD SD SRIN+ D+ D IAKKI+KAKTD
Sbjct: 172 YGVDFFPLTEPVIEGAATRVMSLRDGSKKMSKSDPSDASRINMTDDADSIAKKIRKAKTD 231

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            D LPSE+ GL++R EA+NL+ I+A +    +E+ L + GG+ F  FK  LA+  + ++ 
Sbjct: 232 PDALPSEIDGLKDRPEARNLVNIYAALNDQTVEDVLAEVGGQQFGTFKPQLAELAVSKLS 291

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PIS ++  L+ D + +D IL +GA +AR      +    EI+G+
Sbjct: 292 PISHEMARLMDDPAEIDRILAKGAAQAREITAPILSKTYEIMGM 335


>gi|262277771|ref|ZP_06055564.1| tryptophan-tRNA ligase [alpha proteobacterium HIMB114]
 gi|262224874|gb|EEY75333.1| tryptophan-tRNA ligase [alpha proteobacterium HIMB114]
          Length = 333

 Score =  322 bits (825), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 170/346 (49%), Positives = 231/346 (66%), Gaps = 21/346 (6%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SG+QPTG LHLGNYLG I+N +  Q   ++   Y +ADLHAIT ++  + LR       
Sbjct: 7   LSGIQPTGNLHLGNYLGAIKNFVTMQN--DYECFYMLADLHAITVSVNPDELRENILNTA 64

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A+FLA G+D  +NIIF QS V  H++LSWIL+C+AR+GW+N M QFKEK+  NKE+ AS+
Sbjct: 65  ATFLACGLDEKKNIIFCQSQVQAHSELSWILNCIARVGWLNRMTQFKEKAGSNKEK-ASV 123

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GL+ YP+LMAADIL+Y+ATHVPVGEDQ+QHLE+ R IA +FN +                
Sbjct: 124 GLYTYPILMAADILVYQATHVPVGEDQKQHLELCRDIATKFNND---------------- 167

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
            Y   FF I E +I  S +RI SLRD +KKMSKS+ SD SRINL D+ D I +K++KAKT
Sbjct: 168 -YKNDFFTIPEPIIPKSVARIMSLRDGTKKMSKSEESDLSRINLTDSKDQIMQKVKKAKT 226

Query: 249 DGDVLPSEVSGLEN-RLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
           D + +   +  L+  R EA+NLI+I+A+++    E+ +K F GK+FS FK +LA+ ++E+
Sbjct: 227 DSEPINEGILALDTKRFEAQNLIKIYASLKSETPEKIIKNFDGKSFSDFKNSLAELLVEK 286

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           I PIS KI+    DK  L  IL  G  +A   A +T+  V +IVGL
Sbjct: 287 ISPISDKIKEYKNDKEQLKKILKNGNEQASDTANKTIIEVKKIVGL 332


>gi|110678514|ref|YP_681521.1| tryptophanyl-tRNA synthetase [Roseobacter denitrificans OCh 114]
 gi|109454630|gb|ABG30835.1| tryptophanyl-tRNA synthetase, putative [Roseobacter denitrificans
           OCh 114]
          Length = 337

 Score =  322 bits (824), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 159/344 (46%), Positives = 225/344 (65%), Gaps = 20/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G L LGNYLG I+  +  Q+  +   +Y + DLHAIT     ++L + +R   A
Sbjct: 12  SGIQPSGGLTLGNYLGAIKRFVAMQD--DFPCVYCMVDLHAITVWQDPKDLAHNTRELAA 69

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            F+A+G+ P ++I+  QS V  HA L W+ +CVARMGWM  M QFK+K+ +N +  ASLG
Sbjct: 70  GFIASGISPEKSILINQSQVPEHAQLGWVFNCVARMGWMQRMTQFKDKAGKNAQ-NASLG 128

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LMAADIL+Y ATHVPVGEDQ+QHLE+TR IA +FN +                 
Sbjct: 129 LFGYPALMAADILIYHATHVPVGEDQKQHLELTRDIAAKFNHD----------------- 171

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
           Y   FFP+ E +I+ +A+R+ SLRD SKKMSKSD SD SRIN+ D+ D IA+KI+KAKTD
Sbjct: 172 YGVDFFPLTEPVIEGAATRVMSLRDGSKKMSKSDPSDASRINMTDDADAIARKIRKAKTD 231

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            D LPSE+ GL++R EA+NL+ I+A +    +E+ L   GG+ F  FK  LA+  + ++ 
Sbjct: 232 PDALPSEIDGLKDRPEARNLVNIYAALNDQTVEDVLADVGGQQFGTFKPQLAELAVSKLS 291

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           P+S+++  L+ D + +D IL +GA +AR      +    E++G+
Sbjct: 292 PVSREMARLMDDPAEIDRILAKGAAQAREITAPILHKTYEVMGM 335


>gi|159045376|ref|YP_001534170.1| tryptophanyl-tRNA synthetase [Dinoroseobacter shibae DFL 12]
 gi|157913136|gb|ABV94569.1| tryptophanyl-tRNA synthetase [Dinoroseobacter shibae DFL 12]
          Length = 341

 Score =  321 bits (823), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 162/344 (47%), Positives = 222/344 (64%), Gaps = 19/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G L LGNYLG I+  +  Q++     +Y + DLHAIT       L   +R   A
Sbjct: 14  SGIQPSGGLTLGNYLGAIKRFVDMQDSGIQT-LYCMVDLHAITVWQDPAALTRNTRELAA 72

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LAAG+DP+R+I+F QS V  HA L WI +CVARMGWM  M Q+K+K+ +N E  ASLG
Sbjct: 73  GYLAAGIDPARSILFNQSQVPEHAQLGWIFNCVARMGWMGRMTQWKDKAGKNAE-NASLG 131

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LMAADIL+Y ATHVPVGEDQ+QH+E+TR IA +FN +                 
Sbjct: 132 LFGYPALMAADILVYHATHVPVGEDQKQHIELTRDIAAKFNHD----------------- 174

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
           Y   FFP+ E +I+ +A+R+ SLRD S+KMSKSD SD SRIN+ D+ D IAKKI+KAKTD
Sbjct: 175 YGVDFFPMTEPVIEGAATRVMSLRDGSRKMSKSDPSDMSRINMTDDADAIAKKIRKAKTD 234

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            + LP  V GL++R EA+NL+ I+A +    +E  +    G  F  FK AL D  ++++ 
Sbjct: 235 PEPLPETVEGLKDRPEARNLVNIYAALSDQSVEAVIAAHAGAQFGTFKPALVDLAVDKLA 294

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PIS ++  L+ D + +D +L +GA +AR  A   ++   +IVG+
Sbjct: 295 PISSEMARLMDDPAEIDRLLGKGAAQAREIATPILQKTYDIVGM 338


>gi|260574120|ref|ZP_05842125.1| tryptophanyl-tRNA synthetase [Rhodobacter sp. SW2]
 gi|259023586|gb|EEW26877.1| tryptophanyl-tRNA synthetase [Rhodobacter sp. SW2]
          Length = 347

 Score =  321 bits (822), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 167/344 (48%), Positives = 231/344 (67%), Gaps = 19/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G L LGNYLG ++  + +Q+      +Y + D+HAIT       LR Q+R   A
Sbjct: 17  SGIQPSGGLTLGNYLGALKRFVEKQDEGIET-VYCLVDMHAITVWQDPAKLRQQTREAAA 75

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            F+AAG+DPSR+I+F QS V  H +L+WI +CVARMGWM+ M QFK+K+ +N E   SLG
Sbjct: 76  GFIAAGIDPSRSILFNQSQVTAHVELAWIFNCVARMGWMSRMTQFKDKAGKNSENV-SLG 134

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LMAADI+ Y+ATHVPVGEDQ+QHLE+TR IA +FN +                 
Sbjct: 135 LFAYPSLMAADIMAYKATHVPVGEDQKQHLELTRDIAIKFNND----------------- 177

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
           Y   FFPI+E +I+ +A+R+ SLRD +KKMSKSD SD SRINL D+ D I+KKI+KAKTD
Sbjct: 178 YGVNFFPIVEPIIEGAATRVMSLRDGTKKMSKSDPSDQSRINLTDDADTISKKIRKAKTD 237

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            + LPSE+ GL++R EA+NL+ I+A +     E+ ++ FGG  F  FK ALAD  + ++ 
Sbjct: 238 PEPLPSELEGLKDRPEARNLVNIYAALAGHTAEQVIRDFGGAQFGSFKPALADLAVAKLS 297

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PI+ ++  L++D + +D IL  G+ RA   A+  +  V +IVG+
Sbjct: 298 PITTEMSRLMQDPAEIDRILGAGSERAEAIARPIVDQVYDIVGM 341


>gi|167643985|ref|YP_001681648.1| tryptophanyl-tRNA synthetase [Caulobacter sp. K31]
 gi|167346415|gb|ABZ69150.1| tryptophanyl-tRNA synthetase [Caulobacter sp. K31]
          Length = 344

 Score =  320 bits (821), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 166/345 (48%), Positives = 217/345 (62%), Gaps = 19/345 (5%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQP+G LHLGNYLG +    R Q   +     F+ADLHAIT     E L  Q+R   
Sbjct: 16  LSGVQPSGALHLGNYLGALVKFARLQHEMDTF--IFVADLHAITVWQDPEALAQQTREIT 73

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A++LAAG+DP +  IF QS V  H++L+WI  CVAR+GW++ M QFKEKS ++KE + S+
Sbjct: 74  AAYLAAGLDPKKATIFPQSAVREHSELAWIFQCVARLGWLDRMTQFKEKSGKHKERS-SV 132

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GL+ YPVL AADIL+Y+ATHVPVGEDQ+QHLE+TR IA +FN +F               
Sbjct: 133 GLYTYPVLQAADILVYKATHVPVGEDQKQHLELTRDIAGKFNHDFG-------------- 178

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
              +GFFP  E LI    +RI SLRD S KMSKSD SD+SRINL D  D IA K++KA+T
Sbjct: 179 --VQGFFPQPEPLIQGPGARIMSLRDGSAKMSKSDPSDYSRINLTDTADDIAAKVRKART 236

Query: 249 DGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
           D + LP  +  L  R EA NL+ IFA +      E L  + GK F  FK ALAD  ++++
Sbjct: 237 DPEPLPETLEELAARPEADNLVGIFAALSGKTKAEVLADYAGKGFGTFKPALADLAVDKL 296

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            P+ + ++  L D + +D IL  GA RA   A  T+  V ++VG 
Sbjct: 297 APVGETMRRFLADPTEIDRILKAGAERASEVAAPTVAEVKKLVGF 341


>gi|315497074|ref|YP_004085878.1| tryptophanyl-tRNA synthetase [Asticcacaulis excentricus CB 48]
 gi|315415086|gb|ADU11727.1| tryptophanyl-tRNA synthetase [Asticcacaulis excentricus CB 48]
          Length = 331

 Score =  320 bits (820), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 166/346 (47%), Positives = 230/346 (66%), Gaps = 19/346 (5%)

Query: 8   FVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
            +SG+Q +G LHLGNYLG ++     Q +      Y IADLHAIT     E L  Q+R  
Sbjct: 3   ILSGIQASGSLHLGNYLGALKKFADMQ-SLEATRFYMIADLHAITVWQDPEKLLSQTREI 61

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A +LAAGVDP ++ IF QS V  H +L+WI +CVAR+GW++ M QFK+K+ ++KE  AS
Sbjct: 62  AACYLAAGVDPVKSAIFPQSAVRAHTELAWIFNCVARLGWLDRMTQFKDKAGKDKER-AS 120

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GL+ YPVL AADILLY+ATHVPVGEDQRQHLE+TR +A++FN +++ +           
Sbjct: 121 IGLYTYPVLQAADILLYKATHVPVGEDQRQHLELTRDVAKKFNHDYKVE----------- 169

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                 +FP+ + L     +RI SLRD   KMSKSD SD SRINL D+ D IA KI+KAK
Sbjct: 170 ------YFPLPDTLYQGPGARIMSLRDGLAKMSKSDPSDNSRINLTDDADTIASKIKKAK 223

Query: 248 TDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
           +D +VLP+E +GL  R EAKNL+ I+A +  + +++ L  FGGK F  FK ALA+ V+++
Sbjct: 224 SDAEVLPTEEAGLAERPEAKNLVGIYAALAGVSVQDVLNDFGGKGFGAFKPALAEVVVDK 283

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + PIS++++ LL D + +D +L  GA  A   A+  ++ V +IVGL
Sbjct: 284 MSPISERLRGLLNDPAEVDRVLKLGAEAAEAAAEPVVRDVKKIVGL 329


>gi|114571563|ref|YP_758243.1| tryptophanyl-tRNA synthetase [Maricaulis maris MCS10]
 gi|114342025|gb|ABI67305.1| tryptophanyl-tRNA synthetase [Maricaulis maris MCS10]
          Length = 345

 Score =  319 bits (817), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 159/344 (46%), Positives = 217/344 (63%), Gaps = 16/344 (4%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QPTG LHLGNYLG ++N +  Q+      +Y + D+HA+T     + L    R   A
Sbjct: 16  SGMQPTGRLHLGNYLGALKNWVAMQDEDESERIYCVVDMHAVTMPHDAKALPDAVRRVTA 75

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           ++LAAG+DP +N+IF QS V  HA+L+WIL+CVAR+GW   M QFK+K  +++E   S+G
Sbjct: 76  AYLAAGLDPEKNVIFAQSAVPAHAELAWILNCVARLGWAERMTQFKDKGGKDRERV-SVG 134

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L  YPVLMAADIL+Y+ATHVPVG+DQ+QHLE+ R +A RFN +F                
Sbjct: 135 LLTYPVLMAADILVYKATHVPVGDDQKQHLELCRDVAARFNRDFGD-------------- 180

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
             +  FPI E LI    +RI SLRD + KMSKSD SD SRINL D+ D IA+KI+KAKTD
Sbjct: 181 -GEAVFPITEPLIQGPGARIMSLRDGTAKMSKSDPSDNSRINLEDDADTIARKIKKAKTD 239

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            + LP  + GL+ R EA NL+ IFA +        L ++GG+ F  FK ALA+  +E + 
Sbjct: 240 PEPLPDSIDGLDGRPEASNLVGIFAALTGGSKASVLAEYGGQGFGAFKPALAEVAVEYLA 299

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PIS + + L+ + + +D IL +GA RAR  A+  +      +G 
Sbjct: 300 PISDEYRRLIAEPAEIDRILKKGAERARAVAEPVIAEAKAAIGF 343


>gi|103487496|ref|YP_617057.1| tryptophanyl-tRNA synthetase [Sphingopyxis alaskensis RB2256]
 gi|98977573|gb|ABF53724.1| tryptophanyl-tRNA synthetase [Sphingopyxis alaskensis RB2256]
          Length = 332

 Score =  319 bits (817), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 155/318 (48%), Positives = 212/318 (66%), Gaps = 18/318 (5%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SG+QPTG LHLGNYLG IRN +R Q+      +YF+ADLHAIT +     L   +R   
Sbjct: 4   LSGIQPTGNLHLGNYLGAIRNWVRMQDAMEGEKLYFLADLHAITVHNDPAELTANTREMA 63

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A+ +AAG+DP++ I+F Q+ V  HA+L+W+L C AR+GW+N M QFKEKS +N+E  AS+
Sbjct: 64  AALMAAGIDPAKAILFNQARVPAHAELAWLLFCTARIGWLNRMTQFKEKSGKNRE-GASV 122

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GLF YPVL AAD+LLY+ THVPVG+DQ+QHLE+ R IA +FN +                
Sbjct: 123 GLFAYPVLQAADVLLYQTTHVPVGDDQKQHLELARDIATKFNLD---------------- 166

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                 F + E  I ++A+RI SLRD + KMSKSD SD SRINL+D+PD I  KI+KAKT
Sbjct: 167 -TGTDTFTLPEPTIPATAARIMSLRDGNAKMSKSDPSDMSRINLVDDPDTIMAKIRKAKT 225

Query: 249 DGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
           D + LPSE +GLE R EAKNL+ I+A M    +++ L +F G+ F  FK AL + ++E +
Sbjct: 226 DPEPLPSEAAGLEGRPEAKNLVSIYAAMADESVDQVLARFAGQGFGAFKPALGELLVETL 285

Query: 309 VPISQKIQHLLKDKSYLD 326
            PI+ ++  L  + + +D
Sbjct: 286 RPIAARLTELKANPAAID 303


>gi|114329079|ref|YP_746236.1| tryptophanyl-tRNA synthetase [Granulibacter bethesdensis CGDNIH1]
 gi|114317253|gb|ABI63313.1| tryptophanyl-tRNA synthetase [Granulibacter bethesdensis CGDNIH1]
          Length = 332

 Score =  319 bits (817), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 161/344 (46%), Positives = 223/344 (64%), Gaps = 20/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G+  LGNYLG +RN +  Q+T  H  +Y + D+HAIT     E LR  +R   A
Sbjct: 6   SGIQPSGIPTLGNYLGALRNWVTLQDT--HECLYCVVDMHAITVAQDPEKLRQSTREMAA 63

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           S +A GVDP+RNI+F QS V  HA L+WI +CVAR+GW+N M QFK+K+ +++E  AS G
Sbjct: 64  SVIACGVDPARNILFVQSSVSAHARLAWIFNCVARLGWLNRMTQFKDKAGKDRE-NASAG 122

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L++YP LMAADIL Y AT VPVG+DQRQHLE+T  IA++FN +F                
Sbjct: 123 LYVYPNLMAADILAYHATLVPVGDDQRQHLELTNDIAEKFNHDF---------------- 166

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
               FFP +E LI   A+R+ SLRD  +KMSKSD SD SRINL D+ D IA KI++AKTD
Sbjct: 167 -GVAFFPHVEPLIQGPAARVMSLRDGLRKMSKSDPSDQSRINLSDDADTIAMKIRRAKTD 225

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            + LP ++ GLE R EA+NL+ I+A +        L++ GGK F  +K AL + +++E+ 
Sbjct: 226 PEPLPEDIDGLEGRPEARNLVGIYAALTNSDTATVLREHGGKGFGPYKEALTELLVQELS 285

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PI+ + + LL D++ LD +L +G  RA   A+  +    ++VG 
Sbjct: 286 PIAAETRRLLADEAELDRLLHDGGRRAEAIAEPIVAEAEKLVGF 329


>gi|296116214|ref|ZP_06834832.1| tryptophanyl-tRNA synthetase [Gluconacetobacter hansenii ATCC
           23769]
 gi|295977320|gb|EFG84080.1| tryptophanyl-tRNA synthetase [Gluconacetobacter hansenii ATCC
           23769]
          Length = 331

 Score =  318 bits (814), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 165/346 (47%), Positives = 224/346 (64%), Gaps = 24/346 (6%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVI--RRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           SG+QPTG+  LGNYLG IRN +  +R   C    ++ + D+HAIT     + LR Q+   
Sbjct: 6   SGIQPTGIPQLGNYLGAIRNWVGLQRDNEC----IFCLVDMHAITVWQDPQALREQTLAQ 61

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A  LA+G+D  R+I+F QS V  HA L+WI +CVAR+GW+N M QFK+K+ +++E   S
Sbjct: 62  TAVLLASGIDVQRHILFNQSAVTAHARLAWIFNCVARLGWLNRMTQFKDKAGKDRE-NHS 120

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
            GL++YP LMAADIL Y+AT VPVG+DQRQHLE+T  IAQ+FN +               
Sbjct: 121 AGLYVYPDLMAADILTYKATAVPVGDDQRQHLELTNDIAQKFNHD--------------- 165

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
             Y + FFPI+E LI    +RI SLRD +KKMSKSD S  SRI + D+ D I +KI++AK
Sbjct: 166 --YGQDFFPIVEALIPPQGARIMSLRDGTKKMSKSDPSAQSRIEMTDDADTIMQKIRRAK 223

Query: 248 TDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
           TD + LPSE +GLENR EA+NL+ I+AT++Q  I++ L Q GG+ F  FK ALAD +I+ 
Sbjct: 224 TDPEPLPSEEAGLENRPEARNLVTIYATLQQCGIQDVLDQHGGEGFGPFKKALADVLIQH 283

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           I PI+ +   LLK+  +L   L +GA RA   A+  +     +VG 
Sbjct: 284 IAPIADETTRLLKEPGFLRDTLRDGARRANVIAEPIVAEAESLVGF 329


>gi|258542587|ref|YP_003188020.1| tryptophanyl-tRNA synthetase [Acetobacter pasteurianus IFO 3283-01]
 gi|256633665|dbj|BAH99640.1| tryptophanyl-tRNA synthetase [Acetobacter pasteurianus IFO 3283-01]
 gi|256636724|dbj|BAI02693.1| tryptophanyl-tRNA synthetase [Acetobacter pasteurianus IFO 3283-03]
 gi|256639777|dbj|BAI05739.1| tryptophanyl-tRNA synthetase [Acetobacter pasteurianus IFO 3283-07]
 gi|256642833|dbj|BAI08788.1| tryptophanyl-tRNA synthetase [Acetobacter pasteurianus IFO 3283-22]
 gi|256645888|dbj|BAI11836.1| tryptophanyl-tRNA synthetase [Acetobacter pasteurianus IFO 3283-26]
 gi|256648941|dbj|BAI14882.1| tryptophanyl-tRNA synthetase [Acetobacter pasteurianus IFO 3283-32]
 gi|256651928|dbj|BAI17862.1| tryptophanyl-tRNA synthetase [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654985|dbj|BAI20912.1| tryptophanyl-tRNA synthetase [Acetobacter pasteurianus IFO 3283-12]
          Length = 331

 Score =  317 bits (812), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 164/344 (47%), Positives = 221/344 (64%), Gaps = 20/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G+  LGNYLG IRN +  Q   N+  ++ + D+HAIT     E LR  +    A
Sbjct: 6   SGIQPSGIPQLGNYLGAIRNWVNLQ--ANYECIFCLVDMHAITVWQDPEKLREHTLTQAA 63

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
             LAAG+D  ++I+F QS V  HA L+WI +CVAR+GW+N M QFK+K+ +++E   S G
Sbjct: 64  ILLAAGIDADKHILFNQSAVSAHARLAWIFNCVARIGWLNRMTQFKDKAGKDRENH-SAG 122

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L++YP LMAADIL Y+ATHVPVGEDQ+QHLE+T  IAQ+FN +                 
Sbjct: 123 LYVYPNLMAADILAYKATHVPVGEDQKQHLELTNDIAQKFNHD----------------- 165

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
           Y   FFP +E LI  +A+RI SLRD +KKMSKSD S  SRI L D+ D IA KI++AKTD
Sbjct: 166 YKVEFFPQVEPLIPPTAARIMSLRDGTKKMSKSDPSAQSRIELTDDADAIALKIRRAKTD 225

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            D LP +++GL  R EAKNL+ I+A +  I +E+ LK+  G+ F  FK AL + V+  I 
Sbjct: 226 SDPLPEDIAGLAERPEAKNLVSIYAALADIPVEQVLKEHAGQGFGPFKAALTEVVVNAIA 285

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PI Q+   LL+D+SYL   L  GA RA+  A+  +    ++VG 
Sbjct: 286 PIGQETTRLLQDESYLLKTLHSGAQRAQSIAEPIVAEAEKLVGF 329


>gi|288959653|ref|YP_003449994.1| tryptophanyl-tRNA synthetase [Azospirillum sp. B510]
 gi|288911961|dbj|BAI73450.1| tryptophanyl-tRNA synthetase [Azospirillum sp. B510]
          Length = 332

 Score =  317 bits (812), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 163/348 (46%), Positives = 225/348 (64%), Gaps = 20/348 (5%)

Query: 6   NLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSR 65
           N   SG+QPT  LHLGNYLG +RN +  Q +  +  ++ + DLHA+T +   E LR   R
Sbjct: 2   NRIFSGMQPTRQLHLGNYLGALRNWVELQNS--YECIFCVVDLHALTIDQDPEVLRNNIR 59

Query: 66  LFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEET 125
              A+++AAG+DP +NI+F QS V  HA+L WILSC   +GW+N M QFKEK+ + K+  
Sbjct: 60  EVAAAYIAAGIDPDKNILFNQSVVPGHAELGWILSCHTPLGWLNRMTQFKEKAGKQKD-M 118

Query: 126 ASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYA 185
           A+LGL+ YP LMAADILLY+ATHVPVGEDQ+QHLE+ R IA  FN  +E +         
Sbjct: 119 ANLGLYAYPTLMAADILLYKATHVPVGEDQKQHLELARDIAGAFNRRYETE--------- 169

Query: 186 QEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQK 245
                   FFP+ E  I   A+R+ SLRD  KKMSKSD S++SRIN+ D+ D IA+KI+K
Sbjct: 170 --------FFPLPEPQILGEATRVMSLRDGKKKMSKSDESEYSRINMTDDADTIAQKIRK 221

Query: 246 AKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVI 305
           AKTD + LP  V+ LE R EA NL+ I+  +     E+ L QF G  FS FK +L D  +
Sbjct: 222 AKTDPEPLPETVTELEARPEADNLVTIYGALAGQSREQVLAQFAGSQFSDFKKSLVDLSV 281

Query: 306 EEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           +++ PI+ +++ LL DK+ +D +L +G  RA   A++ +  V +I+GL
Sbjct: 282 DKLAPITSRMKELLGDKAEIDRLLKKGGERAAAIAEKNLNDVKDIIGL 329


>gi|89053385|ref|YP_508836.1| tryptophanyl-tRNA synthetase [Jannaschia sp. CCS1]
 gi|88862934|gb|ABD53811.1| tryptophanyl-tRNA synthetase [Jannaschia sp. CCS1]
          Length = 341

 Score =  317 bits (812), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 156/345 (45%), Positives = 222/345 (64%), Gaps = 19/345 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQEN-LRYQSRLFV 68
           SG+QP+G L LGNYLG I+  +  Q+   H  +Y + DLHAIT  ++  + LR  +R   
Sbjct: 12  SGIQPSGGLTLGNYLGAIKRFVEMQDAGTHETVYCMVDLHAITARLLSPDELRNNTRELC 71

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A F+A+G+DP ++I+  QS V  HA L+WI +C+ARMGWM  M Q+K+KS ++ E  ASL
Sbjct: 72  AGFIASGIDPEKSILINQSQVPEHAQLAWIFNCIARMGWMGRMTQWKDKSGKDAE-GASL 130

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GLF YP LMAADIL+Y ATHVPVG+DQ+QHLE+TR IA +FN +                
Sbjct: 131 GLFAYPALMAADILVYHATHVPVGDDQKQHLELTRDIAAKFNHD---------------- 174

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
            Y   FFPI E +I+ +A+R+ +L+D +KKMSKSD  + +RIN+ D+ D IA+KI+KAKT
Sbjct: 175 -YGVEFFPITEPVIEGAATRVMNLQDGTKKMSKSDPVEKTRINMTDDADAIARKIRKAKT 233

Query: 249 DGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
           D D LP  V GL  R +A+NL+ I+A +  +  +  L +  G  F  FK+ALAD  + ++
Sbjct: 234 DPDPLPDAVDGLAARPDARNLVNIYAALADVSPQVVLDEHAGAMFGHFKVALADLAVAKL 293

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            PIS ++  L+ D + +D IL  GA RAR      ++   +I+G+
Sbjct: 294 SPISSEMSRLMDDPAEIDRILGRGAERARAITVPILEQTYDIIGM 338


>gi|89068995|ref|ZP_01156376.1| tryptophanyl-tRNA synthetase [Oceanicola granulosus HTCC2516]
 gi|89045364|gb|EAR51429.1| tryptophanyl-tRNA synthetase [Oceanicola granulosus HTCC2516]
          Length = 338

 Score =  317 bits (811), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 160/344 (46%), Positives = 219/344 (63%), Gaps = 19/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG++P+G L LGNYLG I+  ++ Q+      ++ + DLHAIT       L   +R   A
Sbjct: 12  SGIKPSGGLTLGNYLGAIKRFVQTQDAGTE-SIFCVVDLHAITVWQDPAELPGMTREVAA 70

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LA+G+DP R+I+F QS V  HA+L+WI +CVAR+GWMN M QFK+K+ +N E+ ASLG
Sbjct: 71  GYLASGIDPERSILFNQSQVAAHAELAWIFNCVARIGWMNRMTQFKDKAGKNAEK-ASLG 129

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L+ YP LMAADIL+Y ATHVPVGEDQ+QH+E+TR IA +FN +                 
Sbjct: 130 LYAYPSLMAADILIYHATHVPVGEDQKQHVELTRDIAAKFNHD----------------- 172

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
           Y   FFP+ E +I+  A RI +LRD +KKMSKS  SD  RIN+ D+ D IAKK +KA+TD
Sbjct: 173 YKVDFFPLTEPVIEGPAMRIMNLRDGTKKMSKSGESDMERINMTDDADTIAKKFKKARTD 232

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
              LP     L++R EAKNL+EI+A +     E  L +  G  + QFK ALAD  ++++ 
Sbjct: 233 PAPLPETPDELKDRPEAKNLVEIYAALSDSTAERVLAEHAGAGWGQFKPALADLAVDKLA 292

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PI+ +++ L+ D + +D IL  GA RAR  A   +    EIVGL
Sbjct: 293 PIADEMKRLMDDPAEIDRILARGAERAREIADPVLARTYEIVGL 336


>gi|332186212|ref|ZP_08387957.1| tryptophanyl-tRNA synthetase [Sphingomonas sp. S17]
 gi|332013580|gb|EGI55640.1| tryptophanyl-tRNA synthetase [Sphingomonas sp. S17]
          Length = 335

 Score =  316 bits (809), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 161/348 (46%), Positives = 222/348 (63%), Gaps = 21/348 (6%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLG---MYFIADLHAITNNIVQENLRYQSR 65
           VSG++PTG LHLGNYLG ++  +  Q+     G   MYFIADLH +T  I   ++   + 
Sbjct: 4   VSGIKPTGNLHLGNYLGAVKQWVAMQDDIQAKGGETMYFIADLHGLTEWIAPADMAANTI 63

Query: 66  LFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEET 125
              A+ +AAG+DP R+I+F Q+ V  H++LSW+L+ VAR+GW+N M QFK+K+ +N+E  
Sbjct: 64  EMTATLIAAGIDPERSILFNQTRVPQHSELSWLLNNVARVGWLNRMTQFKDKAGKNRE-G 122

Query: 126 ASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYA 185
           AS+GL+ YPVLMAAD+LLY ATHVPVGEDQ+QHLE+ R IA +FN ++ R++        
Sbjct: 123 ASVGLYDYPVLMAADVLLYNATHVPVGEDQKQHLELARDIATKFNNDYGREV-------- 174

Query: 186 QEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQK 245
                    F + E LI ++A RI SLRD + KMSKS+ S+ S + L+D  D+IA+K +K
Sbjct: 175 ---------FTLPEPLISAAAPRIMSLRDGTSKMSKSNPSEMSLVKLIDGDDMIAEKFRK 225

Query: 246 AKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVI 305
           AKTD DVLP  + GLE R EA+NLI I+A M      + L QF GK F  FK  LAD  +
Sbjct: 226 AKTDPDVLPETMEGLEGRAEARNLITIYAAMADRAPADVLAQFAGKGFGAFKPELADLAV 285

Query: 306 EEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
             + PI +++  LL D+  +  IL  GA +AR  A   +  V   +GL
Sbjct: 286 ATLGPIRERLTRLLDDRGEVGRILERGAEKARDLAAPMLLNVQRTMGL 333


>gi|254439253|ref|ZP_05052747.1| tryptophanyl-tRNA synthetase [Octadecabacter antarcticus 307]
 gi|198254699|gb|EDY79013.1| tryptophanyl-tRNA synthetase [Octadecabacter antarcticus 307]
          Length = 339

 Score =  316 bits (809), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 162/354 (45%), Positives = 224/354 (63%), Gaps = 23/354 (6%)

Query: 4   SDNLFV----SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQEN 59
           +DN F     SG++P+G L LGNYLG I+  +  Q + +   +Y   DLHAIT       
Sbjct: 2   TDNAFTPRVFSGIKPSGGLTLGNYLGAIKRWVDMQ-SPDMDNIYCAVDLHAITVWQDPPA 60

Query: 60  LRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSK 119
           L+  +R   A  LA+G+DP  +I+F QS V  HA L+WI +CVAR+GWMN M QFK+K+ 
Sbjct: 61  LKAGTREIAAGLLASGIDPENSILFNQSQVPEHAQLAWIFNCVARVGWMNRMTQFKDKAG 120

Query: 120 ENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKE 179
           +N E+ ASLGL+ YP LMAADIL+Y ATHVPVGEDQ+QH+E+TR IA +FN++F      
Sbjct: 121 KNAEK-ASLGLYAYPSLMAADILMYHATHVPVGEDQKQHVELTRDIAAKFNSDF------ 173

Query: 180 VAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDII 239
                         FFP  E +I+   +R+ +LRD +KKMSKS  SD  RIN+LD+ D I
Sbjct: 174 -----------GVDFFPQTEAVIEGPGTRVMNLRDGTKKMSKSGDSDMERINMLDDADTI 222

Query: 240 AKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLA 299
           AKK +KAKTD D LP  V GL  R EAKNL++I+A++  +  E  + Q+ G ++  FK A
Sbjct: 223 AKKFKKAKTDPDGLPETVEGLAGRPEAKNLVDIYASLSDMTPEAVIAQYPGASWGTFKPA 282

Query: 300 LADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           LAD  + ++ PIS +++ L+ D + +D  L  GA +AR  A   ++   +IVGL
Sbjct: 283 LADLAVTKLAPISDEMKRLMDDPAEIDRKLARGAQKAREIATPILEKTYDIVGL 336


>gi|85709418|ref|ZP_01040483.1| tryptophanyl-tRNA synthetase [Erythrobacter sp. NAP1]
 gi|85688128|gb|EAQ28132.1| tryptophanyl-tRNA synthetase [Erythrobacter sp. NAP1]
          Length = 339

 Score =  315 bits (808), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 162/348 (46%), Positives = 220/348 (63%), Gaps = 18/348 (5%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLG---MYFIADLHAITNNIVQENLRYQSR 65
           VSG+QPTG  HLGNYLG I N ++ Q+  +  G     F+ADLHA++       L   +R
Sbjct: 4   VSGIQPTGKPHLGNYLGAIVNYVKLQDEAHAAGGECFIFLADLHALSQPHDPAELTKNTR 63

Query: 66  LFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEET 125
             VA+ +A GVDPS+ I+F Q+ V  HA+L W+L+  ARMGW+N M Q+K+K+ +N+E  
Sbjct: 64  EMVATLVACGVDPSKTILFNQAQVPAHAELQWLLNGTARMGWLNRMTQWKDKAGKNRE-G 122

Query: 126 ASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYA 185
            S+ LF YPVL AAD+LLY+ATHVPVGEDQ+QHLE+ R IAQ+FN +F     E A  + 
Sbjct: 123 QSVALFTYPVLQAADVLLYQATHVPVGEDQKQHLELARDIAQKFNNDF---CSEDAPLFT 179

Query: 186 QEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQK 245
             E Y           I  +A+RI SLRD + KMSKSD SD SRI+L D+PD + KK++K
Sbjct: 180 LPEPY-----------IPPAAARIMSLRDGTAKMSKSDPSDMSRISLTDDPDTVMKKVKK 228

Query: 246 AKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVI 305
           AKTD + LPSE  GLE+R EAKNL+ I+A +      + L + GG+ F  FK AL + ++
Sbjct: 229 AKTDPEPLPSEEKGLEDRAEAKNLVGIYAALTGKSTADVLAEHGGQGFGAFKPALGEVLV 288

Query: 306 EEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           E + PI+ +   L  D+  LD IL  GA +AR     T+    + +GL
Sbjct: 289 ETLRPINARFMELKDDQEALDAILARGAAQAREHGLPTLNAAYKALGL 336


>gi|294676026|ref|YP_003576641.1| tryptophanyl-tRNA synthetase [Rhodobacter capsulatus SB 1003]
 gi|294474846|gb|ADE84234.1| tryptophanyl-tRNA synthetase [Rhodobacter capsulatus SB 1003]
          Length = 350

 Score =  315 bits (808), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 162/344 (47%), Positives = 221/344 (64%), Gaps = 19/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G L LGNYLG ++    +Q+      +Y + DLHAIT     E L+ Q+R   A
Sbjct: 22  SGIQPSGNLTLGNYLGALKRFAEKQDEGIET-IYCLVDLHAITVWQDPEALKKQTREAAA 80

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           +F+A+G+DP+R+++F QS V  HA+L W+L+CVARMGWMN M Q+K+K+ +N E+  SLG
Sbjct: 81  AFIASGIDPARSVLFNQSQVSAHAELGWLLNCVARMGWMNRMTQWKDKAGKNAEKQ-SLG 139

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LMAADILLY AT VPVGEDQ+QH+E+ R IA +FN +                 
Sbjct: 140 LFAYPSLMAADILLYHATMVPVGEDQKQHVELCRDIAAKFNHD----------------- 182

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
           Y   FFP    LI+  A+R+ SLRD SKKMSKSD SD SRINL D+ D IAKK +KA TD
Sbjct: 183 YGVDFFPAPLPLIEGVATRVMSLRDGSKKMSKSDPSDASRINLTDDADTIAKKFRKAVTD 242

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            + LP  + GLE R EA+NL+ I+A +      E +  + G+ F  FK ALAD  + ++ 
Sbjct: 243 PEPLPDSLEGLEGRAEARNLVNIYAALADKTPAEVVADYAGQGFGVFKPALADLAVSKLE 302

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PIS ++  L+ D + +D IL +GA +A   AQ  ++   EI+G+
Sbjct: 303 PISTEMSRLMNDPAEIDRILGQGAEKADAIAQPILQKTLEIMGM 346


>gi|85374929|ref|YP_458991.1| tryptophanyl-tRNA synthetase [Erythrobacter litoralis HTCC2594]
 gi|84788012|gb|ABC64194.1| tryptophanyl-tRNA synthase [Erythrobacter litoralis HTCC2594]
          Length = 352

 Score =  313 bits (803), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 159/359 (44%), Positives = 220/359 (61%), Gaps = 29/359 (8%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLG--------------MYFIADLHAITNN 54
           VSG+QPTG LHLGNYLG IRN ++ Q+                    ++F+ADLHAI+  
Sbjct: 4   VSGIQPTGNLHLGNYLGAIRNWVKMQDEMGAPAQAAEGGSAEEASECLFFLADLHAISQP 63

Query: 55  IVQENLRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQF 114
                LR  +    A+ +A G+DP R+++F Q+ V  HA+L W+L    RMGW+N M Q+
Sbjct: 64  HDPAELRRNTLEMAAALVACGIDPDRSVMFNQAQVPAHAELQWLLMGTGRMGWLNRMTQW 123

Query: 115 KEKSKENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFE 174
           K+K+ +N+E   S+ LF YPVL AAD+LLY+ATHVPVGEDQ+QHLE+ R IAQ+FN +F 
Sbjct: 124 KDKAGKNRE-GQSVALFAYPVLQAADVLLYQATHVPVGEDQKQHLELARDIAQKFNNDFA 182

Query: 175 RKIKEVAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLD 234
            +   V              F + +  I   A+RI SLRD S KMSKSD S+ SRINL D
Sbjct: 183 SEDAPV--------------FTLPDPYIPPQAARIMSLRDGSAKMSKSDLSEMSRINLTD 228

Query: 235 NPDIIAKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFS 294
           + D I KK++KAKTD + LPSE  GL +R EA NL+ I+A + +  ++  L  FGG+ F 
Sbjct: 229 DADTIMKKVKKAKTDPEPLPSEAEGLADRPEALNLVTIYAALAESTVDSVLGDFGGEGFG 288

Query: 295 QFKLALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           +FK AL + ++E + P S +   LL+D+  ++ IL  GA +AR R   T+    E +GL
Sbjct: 289 KFKPALGELMVETLAPTSARFTELLEDREAIEAILARGAAKARERGLPTLDATYEALGL 347


>gi|254449806|ref|ZP_05063243.1| tryptophanyl-tRNA synthetase [Octadecabacter antarcticus 238]
 gi|198264212|gb|EDY88482.1| tryptophanyl-tRNA synthetase [Octadecabacter antarcticus 238]
          Length = 342

 Score =  312 bits (799), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 158/344 (45%), Positives = 220/344 (63%), Gaps = 19/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG++P+G L LGNYLG I+  +  Q + +   +Y   DLHAIT       L+  +R   A
Sbjct: 15  SGIKPSGGLTLGNYLGAIKRWVDMQ-SPDMENIYCAVDLHAITVWQDPAALKAGTREIAA 73

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
             LA+G+DP  +I+F QS V  HA L+WI +CVAR+GWMN M QFK+K+ +N E+ ASLG
Sbjct: 74  GMLASGIDPENSILFNQSQVPEHAQLAWIFNCVARVGWMNRMTQFKDKAGKNAEK-ASLG 132

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L+ YP LMAADIL+Y ATHVPVGEDQ+QH+E+TR IA +FN +F  +             
Sbjct: 133 LYAYPSLMAADILMYHATHVPVGEDQKQHVELTRDIAAKFNNDFGVE------------- 179

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
               FFP+ E +I+   +R+ +LRD +KKMSKS  SD  RIN+LD+ D IAKK +KAKTD
Sbjct: 180 ----FFPLTEAVIEGPGTRVMNLRDGTKKMSKSGDSDMERINMLDDADTIAKKFKKAKTD 235

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            + LP  V GL  R EAKNL++I+A +  +  E+ + Q+ G  +  FK ALAD  + ++ 
Sbjct: 236 PEGLPETVDGLVGRPEAKNLVDIYAGLANMSPEQVIAQYPGAGWGTFKPALADLAVAKLA 295

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PIS +++ L+ D + +D  L  GA +AR  A   ++   +IVGL
Sbjct: 296 PISDEMKRLMNDPAEIDRKLARGAQKAREIATPILEKTYDIVGL 339


>gi|310815337|ref|YP_003963301.1| tryptophanyl-tRNA synthetase [Ketogulonicigenium vulgare Y25]
 gi|308754072|gb|ADO42001.1| tryptophanyl-tRNA synthetase [Ketogulonicigenium vulgare Y25]
          Length = 344

 Score =  312 bits (799), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 158/345 (45%), Positives = 222/345 (64%), Gaps = 19/345 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCN-HLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           SG++P+G L LGNYLG I+  ++ Q+       +Y I DLHAIT      +LR  +    
Sbjct: 16  SGIKPSGGLQLGNYLGAIKRFVQTQDQGEFETTLYCIVDLHAITVWQDPADLREATYEVT 75

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LAAG+DP ++I+F QS V  HA+L WI +CVAR+GWMN M QFKEK+    E+  SL
Sbjct: 76  AGYLAAGIDPEKSILFNQSRVPAHAELGWIFNCVARVGWMNRMTQFKEKAGSGAEKQ-SL 134

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GL+ YP LMAADILLY ATHVPVGEDQ+QH+E+TR IA +FN +                
Sbjct: 135 GLYAYPSLMAADILLYHATHVPVGEDQKQHVELTRDIANKFNHD---------------- 178

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
            Y   FFP    +I+  A RI +LRD +KKMSKS  SD  RIN+LD+ D I+KK +KA++
Sbjct: 179 -YKVDFFPETIPVIEGPAMRIMNLRDGTKKMSKSGESDMERINMLDDADAISKKFKKARS 237

Query: 249 DGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
           D + LP   + L++R EAKNL+ I+A +  + +++ L Q+ G+ + +FK ALAD  ++++
Sbjct: 238 DMEALPETAAELDHRPEAKNLVNIYAGLADLSVDQVLAQYAGEGWGKFKPALADLAVDQL 297

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            PIS +++ L+ D++ LD  L  GA RAR  A   ++   +IVGL
Sbjct: 298 APISTEMKRLMGDRAELDRYLARGAERAREIANPILQQTYDIVGL 342


>gi|163797118|ref|ZP_02191073.1| Tryptophanyl-tRNA synthetase, class Ib [alpha proteobacterium
           BAL199]
 gi|159177634|gb|EDP62187.1| Tryptophanyl-tRNA synthetase, class Ib [alpha proteobacterium
           BAL199]
          Length = 334

 Score =  312 bits (799), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 162/344 (47%), Positives = 220/344 (63%), Gaps = 18/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G L LGNYLG IRN    Q   ++  ++ + D HAIT       LR  +R   A
Sbjct: 6   SGIQPSGDLTLGNYLGAIRNWALLQREKSYECIFCVVDQHAITVPQDPAALRQATREVAA 65

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
             +A GVDP   I+F QS V  HA L+W+ +CVAR+GW+  M QFKEK+ ++++  A++G
Sbjct: 66  GMIAGGVDPDDCILFNQSAVREHAMLAWVFNCVARVGWLGRMTQFKEKAGKDRD-NATVG 124

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF+YP LMAADIL Y+ATHVPVG+DQ+QHLE+TR IAQ FN+ F                
Sbjct: 125 LFVYPNLMAADILAYKATHVPVGDDQKQHLELTRDIAQAFNSMF---------------- 168

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
               FFP+ E  I  +A+R+ SLRD +KKMSKSD SD SRIN+ D+ D IA+KI+KAKTD
Sbjct: 169 -GVDFFPLPEPQIFGTATRVMSLRDGTKKMSKSDPSDMSRINMTDDADAIAQKIRKAKTD 227

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            + LPSE++GL+ R EA+NLI I+A +     E+ L +FGG+ F  FK ALA+  +  + 
Sbjct: 228 PEPLPSELAGLDERPEARNLIGIYAALASQTPEQVLAEFGGRGFGDFKKALAEVAVSVMG 287

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PI  ++Q L  D + +D IL  G  RA   A+  ++ V +IVG 
Sbjct: 288 PIGSEMQRLSNDPATIDAILRRGGERASEIARPVLEEVYDIVGF 331


>gi|304320847|ref|YP_003854490.1| tryptophanyl-tRNA synthetase [Parvularcula bermudensis HTCC2503]
 gi|303299749|gb|ADM09348.1| tryptophanyl-tRNA synthetase [Parvularcula bermudensis HTCC2503]
          Length = 317

 Score =  311 bits (798), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 157/334 (47%), Positives = 213/334 (63%), Gaps = 19/334 (5%)

Query: 20  LGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVASFLAAGVDPS 79
           +GNYLG IR  +  Q     L  Y I DLHAIT       L  Q+R   A++LAAG+DP 
Sbjct: 1   MGNYLGAIRKFVDLQARFEAL--YCIVDLHAITVPQDPAALADQTREVAAAYLAAGIDPE 58

Query: 80  RNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLGLFMYPVLMAA 139
           + +IF QS V  H +L+W+L+CVARMGW+N M QFK+K+ ++KE  AS+GLF+YP+LMA+
Sbjct: 59  QAVIFNQSAVPEHTELNWLLTCVARMGWLNRMTQFKDKAGKDKER-ASVGLFVYPILMAS 117

Query: 140 DILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQYSKGFFPIIE 199
           DIL+YRATHVPVGEDQ+QHLE+ R IA + N +F+                ++ FFP+ E
Sbjct: 118 DILVYRATHVPVGEDQKQHLELARDIAAKINGDFD----------------AEHFFPLPE 161

Query: 200 GLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTDGDVLPSEVSG 259
            LI    +RI SLRD ++KMSKSD SD SRI ++D PD + +KI+KAKTD + LP  V G
Sbjct: 162 PLIQGPGARIMSLRDGTQKMSKSDPSDLSRIGMMDTPDELVRKIKKAKTDPEPLPETVEG 221

Query: 260 LENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIVPISQKIQHLL 319
           LE R EAKNL+ IF  +     EE L  +GG+ F  FK ALAD  +  + PIS ++  L 
Sbjct: 222 LEGRPEAKNLVGIFGALSGQTHEEVLATYGGQGFGHFKPALADLAVATLAPISSEMIRLK 281

Query: 320 KDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           ++  ++D +L  GA RAR  A   ++   ++ G 
Sbjct: 282 QNPDHIDAVLRAGAERARSIAAPVVQETKKLFGF 315


>gi|329115342|ref|ZP_08244096.1| Tryptophanyl-tRNA synthetase [Acetobacter pomorum DM001]
 gi|326695321|gb|EGE47008.1| Tryptophanyl-tRNA synthetase [Acetobacter pomorum DM001]
          Length = 331

 Score =  311 bits (798), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 163/344 (47%), Positives = 220/344 (63%), Gaps = 20/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+GV  LGNYLG IRN +  Q   N+  ++ + D+HAIT     E LR  +    A
Sbjct: 6   SGIQPSGVPQLGNYLGAIRNWVHLQ--ANYECIFCLVDMHAITVWQDPEKLREHTLTQAA 63

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
             LAAG+D  ++I+F QS V  HA L+WI +CVAR+GW+N M QFK+K+ +++E   S G
Sbjct: 64  ILLAAGIDADKHILFNQSAVSAHARLAWIFNCVARIGWLNRMTQFKDKAGKDRENH-SAG 122

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L++YP LMAADIL Y+ATHVPVGEDQ+QHLE+T  IAQ+FN +++ +             
Sbjct: 123 LYVYPNLMAADILAYKATHVPVGEDQKQHLELTNDIAQKFNHDYKVE------------- 169

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
               FFP +  LI  +A+RI SLRD +KKMSKSD S  SRI L D+ D IA KI++AKTD
Sbjct: 170 ----FFPQVAPLIPPTAARIMSLRDGTKKMSKSDPSAQSRIELTDDADAIALKIRRAKTD 225

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
              LP ++S L +R EAKNL+ I+A +  I  E+ LK+  G+ F  FK AL + V+  I 
Sbjct: 226 SAPLPEDISDLADRPEAKNLVSIYAALADIPTEQVLKEHAGQGFGPFKAALTEIVVNAIA 285

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PI Q+   LL+DKSYL   L  GA RA+  A+  +    ++VG 
Sbjct: 286 PIGQETTRLLQDKSYLLNTLHSGAQRAQSIAEPIVSEAEKLVGF 329


>gi|148556728|ref|YP_001264310.1| tryptophanyl-tRNA synthetase [Sphingomonas wittichii RW1]
 gi|148501918|gb|ABQ70172.1| tryptophanyl-tRNA synthetase [Sphingomonas wittichii RW1]
          Length = 331

 Score =  310 bits (795), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 155/329 (47%), Positives = 214/329 (65%), Gaps = 20/329 (6%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SG+QPTG LHLGNYLG IR  ++ Q     L  +F+ADLHAIT +     L    R   
Sbjct: 7   ISGIQPTGNLHLGNYLGAIRRWVQMQHEGECL--FFLADLHAITVHNEPATLANNIREMA 64

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A+ +A G+DP + ++F+Q DV  HA+L W+L+  AR+GW+N M QFKEKS +N+E  AS+
Sbjct: 65  AALVACGIDPDKAVLFRQRDVAAHAELCWLLNGTARIGWLNRMTQFKEKSGKNRE-GASI 123

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GL+ YPVL AAD+LLY+ATHVPVGEDQ+QHLE+ R IA +FNT+F  ++           
Sbjct: 124 GLYAYPVLQAADVLLYQATHVPVGEDQKQHLELARDIATKFNTDFGVEL----------- 172

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                 F + E +I   A+R+ SLRD + KMSKSD SD SRINL D+ + I  K++KAKT
Sbjct: 173 ------FTLPEPVIGGPAARVMSLRDGTAKMSKSDPSDMSRINLTDDAETIMSKVRKAKT 226

Query: 249 DGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
           D + L   + GLE R EA+NL+ I+A M      E L QFGG+ F  FK AL + +  ++
Sbjct: 227 DPEPLSDTIEGLEGRPEARNLVGIYAAMTDATPAEVLAQFGGQGFGSFKPALGELLASKL 286

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRAR 337
            PI+++++ L  + + LD IL +GA +AR
Sbjct: 287 GPIAERLRELKANPAELDAILAKGAEKAR 315


>gi|126734867|ref|ZP_01750613.1| tryptophanyl-tRNA synthetase [Roseobacter sp. CCS2]
 gi|126715422|gb|EBA12287.1| tryptophanyl-tRNA synthetase [Roseobacter sp. CCS2]
          Length = 338

 Score =  310 bits (795), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 155/344 (45%), Positives = 218/344 (63%), Gaps = 20/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG++P+G L LGNYLG I+  +  Q     +  Y + D+HAIT     + L   +R   A
Sbjct: 12  SGIKPSGGLTLGNYLGAIKRFVGMQGQMETV--YCVVDMHAITVWQDPKELANMTREVAA 69

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LAAG+DPS++I+F QS V  HA+L WI +CVAR+GWMN M QFK+K+  N E+  SLG
Sbjct: 70  GYLAAGLDPSKSILFNQSQVAAHAELGWIFNCVARVGWMNRMTQFKDKAGSNAEKV-SLG 128

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L+ YP LMAADILLY ATHVPVG+DQ+QH+E+TR IA +FN +F+               
Sbjct: 129 LYAYPALMAADILLYHATHVPVGDDQKQHVELTRDIAAKFNHDFKTD------------- 175

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
               FFP+ E +I+  A RI +LRD +KKMSKS  SD  RIN+ D+ D IAKK +KAKTD
Sbjct: 176 ----FFPLTEPVIEGPAMRIMNLRDGTKKMSKSGESDMERINMTDDADKIAKKFRKAKTD 231

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            + LP  + GL +R EA+NL++I+A +  +  E  + ++ G  +  FK ALAD  + ++ 
Sbjct: 232 PEPLPETLDGLADRPEARNLVDIYAALADMTPEAVIAEYPGAQWGTFKPALADLAVAKLA 291

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PIS ++   + D + +D IL  GA +AR  A   ++   +IVG+
Sbjct: 292 PISTEMARFMADPAEIDRILGAGAEKARAIANPILRDTYDIVGM 335


>gi|296283093|ref|ZP_06861091.1| tryptophanyl-tRNA synthetase [Citromicrobium bathyomarinum JL354]
          Length = 338

 Score =  308 bits (790), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 156/320 (48%), Positives = 212/320 (66%), Gaps = 17/320 (5%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQE--TCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           VSG+QPTG LHLGNYLG IRN +R Q+    +   ++F+ADLHAI+       LR  +  
Sbjct: 4   VSGIQPTGNLHLGNYLGAIRNWVRMQDEMDADSECLFFLADLHAISMAHEPAELRRATLE 63

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A+ +A G+DP R+I+F Q+ V  HA+L W+L+  ARMGW+N M Q+K+K+ +N+E  A
Sbjct: 64  MAAALVACGIDPDRSILFNQAQVPQHAELQWLLNGTARMGWLNRMTQWKDKAGKNRE-GA 122

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           S+ LF YPVL AAD+L+++ATHVPVG+DQ+QHLE+ R IAQ+FN +F     E A     
Sbjct: 123 SVALFTYPVLQAADVLVHQATHVPVGDDQKQHLELARDIAQKFNNDF---CTEDAP---- 175

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F + E +    A+RI SLRD SKKMSKSD SD SRINL D+PD + KK++KA
Sbjct: 176 -------LFTLPEPITPPDAARIMSLRDGSKKMSKSDPSDMSRINLSDDPDEVMKKVKKA 228

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
           KTD + LPSE  GLE R EA NL+ I+A +    +++ L + GG+ F  FK AL + +IE
Sbjct: 229 KTDPEPLPSERDGLEGRAEALNLVTIYAALTDRSVDDVLAEHGGQGFGAFKPALGEVLIE 288

Query: 307 EIVPISQKIQHLLKDKSYLD 326
            + PIS +   LL+D+  LD
Sbjct: 289 TLRPISARFNQLLEDREALD 308


>gi|23014048|ref|ZP_00053887.1| COG0180: Tryptophanyl-tRNA synthetase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 332

 Score =  308 bits (789), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 167/344 (48%), Positives = 225/344 (65%), Gaps = 20/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQPTG LHLGNYLG IRN +R Q+   +  ++ I D+HAIT     + L    R   A
Sbjct: 6   SGVQPTGNLHLGNYLGAIRNWVRLQD--EYECIFCIVDMHAITLWQDPKELTRNIREVTA 63

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
             +AAGVDP+++I+F QS V  HA L+WI +CVARMGW+N M QFK+K+ ++KE  AS+G
Sbjct: 64  GMIAAGVDPAKHIVFNQSMVPAHAQLAWIFNCVARMGWLNRMTQFKDKAGKHKE-NASVG 122

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LM+ADIL Y+ATHVPVGEDQ+QHLE+ R  AQ+FN +F  +             
Sbjct: 123 LFAYPNLMSADILTYKATHVPVGEDQKQHLELARDTAQKFNNDFGVE------------- 169

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
               FFP+ E +I   A+RI SLRD +KKMSKSD SD+SRIN+ D+ D IA KI+KAKTD
Sbjct: 170 ----FFPLPEPIIPPEAARIMSLRDGAKKMSKSDESDYSRINMTDDADTIALKIRKAKTD 225

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            + LP+ + GLE R EA NL+ I+A +   +  + + QF GK FS FK  L D  +  + 
Sbjct: 226 LEPLPATLEGLEGRPEASNLLGIYAALSGKEKIQVVTQFEGKQFSDFKKELVDLAVSVLG 285

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PI+ +++ L+ D +++D +L  GA RA   A   ++ V +IVG 
Sbjct: 286 PINTEMKRLMTDTNHIDAVLRSGAERADAIAAPIIREVYDIVGF 329


>gi|330994683|ref|ZP_08318606.1| Tryptophanyl-tRNA synthetase [Gluconacetobacter sp. SXCC-1]
 gi|329758324|gb|EGG74845.1| Tryptophanyl-tRNA synthetase [Gluconacetobacter sp. SXCC-1]
          Length = 331

 Score =  307 bits (787), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 157/344 (45%), Positives = 217/344 (63%), Gaps = 20/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QPTG+  LGNYLG IRN +  Q   +H  ++ + D+HAIT       LR Q+    A
Sbjct: 6   SGIQPTGIPQLGNYLGAIRNWVALQR--DHECIFCLVDMHAITTWQEPATLRQQTLAQTA 63

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
             LA+G+D  R+I+F QS V  HA L WI +CVAR+GW+N M QFK+K+ +++E+  S G
Sbjct: 64  VLLASGIDVERHILFNQSAVSAHARLGWIFNCVARLGWLNRMTQFKDKAGKDREKH-SAG 122

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L++YP LMAADIL Y+AT VPVG+DQ+QHLE+T  IAQ+FN +                 
Sbjct: 123 LYVYPDLMAADILAYKATVVPVGDDQKQHLELTNDIAQKFNHD----------------- 165

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
           Y   FFP +E LI    +RI SLRD  KKMSKSD S  SRI + D+ D IA KI++AKTD
Sbjct: 166 YGTEFFPQVEALIPPQGARIMSLRDGGKKMSKSDPSAQSRIEMTDDADAIASKIRRAKTD 225

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            + LPSE +GLENR EA+NL+ I+AT+    + + L +FGG+ F  FK AL   ++  + 
Sbjct: 226 SEPLPSEEAGLENRPEARNLVTIYATLSGRTVAQVLSEFGGQGFGPFKEALTAVLVGTVA 285

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PI+ + + LL++  +L   L  GA+RAR  A+  +     ++G 
Sbjct: 286 PIAAETERLLREPGFLCDTLRAGASRARTIAEPIVSEAEALIGF 329


>gi|162147639|ref|YP_001602100.1| tryptophanyl-tRNA synthetase [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209542268|ref|YP_002274497.1| tryptophanyl-tRNA synthetase [Gluconacetobacter diazotrophicus PAl
           5]
 gi|161786216|emb|CAP55798.1| putative tryptophanyl-tRNA synthetase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209529945|gb|ACI49882.1| tryptophanyl-tRNA synthetase [Gluconacetobacter diazotrophicus PAl
           5]
          Length = 331

 Score =  307 bits (786), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 157/344 (45%), Positives = 217/344 (63%), Gaps = 20/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QPTG+  LGNYLG IRN +  Q+  +H  ++ + DLHAIT     E LR Q+    A
Sbjct: 6   SGIQPTGIPQLGNYLGAIRNWVALQQ--DHECIFCLVDLHAITVWQDPEALRQQTLAQTA 63

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
             LAAG+DP  +I+F QS V  HA L WI +CV+R+GW+N M QFK+K+ +++E   S G
Sbjct: 64  VLLAAGIDPKAHILFNQSAVSAHARLGWIFNCVSRLGWLNRMTQFKDKAGKDRENH-SAG 122

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L++YP LMAADIL Y+AT VPVG+DQRQHLE+   IAQ+FN +                 
Sbjct: 123 LYIYPNLMAADILAYKATRVPVGDDQRQHLELANDIAQKFNHD----------------- 165

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
           Y   FFP IE LI + A+R+ SLRD +KKMSKSD S  SRI + D+ D IA KI++AKTD
Sbjct: 166 YGVDFFPAIEALIPAGAARVMSLRDGTKKMSKSDPSAQSRIEMTDDADAIALKIRRAKTD 225

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            + LP++ + L++R EA+NL+EI+A +  + + + L + GG  F  FK AL D ++  + 
Sbjct: 226 PEPLPTDPADLQSRPEARNLVEIYAVLSGMTVADVLARHGGTGFGPFKAALTDVLVAAVT 285

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PI  + + LL    +L  +L EGA RA   A+  +  V  +VG 
Sbjct: 286 PIGAETRRLLDAPEHLQAVLREGAARANAIAEPIVSEVERLVGF 329


>gi|302381405|ref|YP_003817228.1| tryptophanyl-tRNA synthetase [Brevundimonas subvibrioides ATCC
           15264]
 gi|302192033|gb|ADK99604.1| tryptophanyl-tRNA synthetase [Brevundimonas subvibrioides ATCC
           15264]
          Length = 346

 Score =  305 bits (782), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 160/345 (46%), Positives = 223/345 (64%), Gaps = 18/345 (5%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SG+Q +G LHLGNYLG ++     Q++       F+ADLHAIT       L  Q+R   
Sbjct: 18  LSGIQASGALHLGNYLGALKRFTALQDSGAPC-FLFVADLHAITVWQDPALLAAQTREIA 76

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A+++A+G+DP+ + IF QS V  H++L+WIL+CVAR+GW++ M QFKEKS ++KE + S+
Sbjct: 77  AAYIASGLDPATSTIFPQSAVRAHSELAWILNCVARLGWLDRMTQFKEKSGKHKERS-SV 135

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GL+ YPVL AADILLY+AT VPVGEDQ+QHLE+TR IA +FNT+F               
Sbjct: 136 GLYTYPVLQAADILLYKATEVPVGEDQKQHLELTRDIAAKFNTDFN-------------- 181

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
             + GFFP+ E LI   A+R+ SLRD + KMSKSD SD SRINL D+ D IA KI+K+KT
Sbjct: 182 --APGFFPLPEPLIQGPATRVMSLRDGAAKMSKSDPSDQSRINLTDDADTIAAKIRKSKT 239

Query: 249 DGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
           D  V+P+    L++R E +NLI I+A +     E    QF G+ F  FK ALAD  +  +
Sbjct: 240 DMGVMPAPGDVLDDRPEVRNLIAIYAALSDTTREAVTAQFAGQGFGAFKPALADLAVAAL 299

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            P++ +++ L+ D + +D +L +GA RA   A   +  V +IVG 
Sbjct: 300 APVTAEMRRLMDDPAEIDRVLKDGAERAAAIADPVVDEVKKIVGF 344


>gi|149185513|ref|ZP_01863829.1| tryptophanyl-tRNA synthetase [Erythrobacter sp. SD-21]
 gi|148830733|gb|EDL49168.1| tryptophanyl-tRNA synthetase [Erythrobacter sp. SD-21]
          Length = 350

 Score =  304 bits (779), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 163/359 (45%), Positives = 227/359 (63%), Gaps = 29/359 (8%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQE--------------TCNHLGMYFIADLHAITNN 54
           VSG+QPTG LHLGNYLG IRN +R Q+              + ++  ++F+ADLHAI+  
Sbjct: 4   VSGIQPTGNLHLGNYLGAIRNWVRMQDDMEDANLAQAAEGGSAHNQCLFFLADLHAISMP 63

Query: 55  IVQENLRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQF 114
                L+  +    A+ +A G+DP+++++F Q+ V  HA+L W+L   ARMGW+N M Q+
Sbjct: 64  HDPAELKKGTLEMAAALVACGIDPAKSVLFNQAQVPQHAELQWLLGGTARMGWLNRMTQW 123

Query: 115 KEKSKENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFE 174
           K+K+ +N+E   S+ LF YPVL AAD+LLY+ATHVPVGEDQ+QHLE+ R IAQ+FN +F 
Sbjct: 124 KDKAGKNRE-GQSVALFTYPVLQAADVLLYQATHVPVGEDQKQHLELARDIAQKFNNDFA 182

Query: 175 RKIKEVAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLD 234
            +   V              F + + ++   A+RI SLRD SKKMSKSD SD SRINL D
Sbjct: 183 SEDAPV--------------FTLPDPIVPPQAARIMSLRDGSKKMSKSDVSDMSRINLAD 228

Query: 235 NPDIIAKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFS 294
           N D + KK++KAKTD + LP E  GLE+R EA NL+ I+A +    + + L +FGG+ F 
Sbjct: 229 NADEVMKKVKKAKTDPEPLPGEEKGLEDRPEALNLVTIYAALTDRSVNDVLGEFGGEGFG 288

Query: 295 QFKLALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            FK AL + ++E + PIS +   LL+D+  LD IL  GA +AR  A  T+    E +GL
Sbjct: 289 TFKPALGEMLVETLRPISARFNELLEDREALDAILARGAAQAREIAVPTLGATYEALGL 347


>gi|67633330|gb|AAY78581.1| predicted tryptophanyl-tRNA synthetase [uncultured bacterium
           MedeBAC82F10]
          Length = 334

 Score =  304 bits (779), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 161/344 (46%), Positives = 221/344 (64%), Gaps = 20/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQPTG LHLGNYLG I+N +  Q+  N   +Y + D HAIT +   + LR      +A
Sbjct: 10  SGVQPTGTLHLGNYLGAIKNFVELQDKYN--CVYCVVDQHAITVDQNPKELRSNILEVLA 67

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           SF+AAGVD  + IIF+QS V  H+ L+W+ +CV+R+GW+N M QFK+K+ +N+E   S+G
Sbjct: 68  SFIAAGVDYKKQIIFQQSSVPAHSQLAWVFNCVSRIGWLNRMTQFKDKAGKNRE-NVSVG 126

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L +YP LMAADIL Y ATHVPVG+DQ+QHLE++R IAQ+FN +F  +             
Sbjct: 127 LMVYPNLMAADILAYLATHVPVGDDQKQHLELSRDIAQKFNNDFGVE------------- 173

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
               FFP  E LI  SA+R+ SLRD SKKMSKSD SDFSRI L D+ D I+ KI+KAK+D
Sbjct: 174 ----FFPQPEPLIYGSATRVMSLRDGSKKMSKSDPSDFSRILLTDDDDTISAKIRKAKSD 229

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            +++PS    L+N+ E  NLI I +       ++ L  + GK +S  K  LAD++I+ I 
Sbjct: 230 SELIPSSKDDLQNKPECLNLINILSATTNQSADQVLGNYAGKEYSALKKDLADSLIQVIS 289

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PI  +I +LL ++  L+ IL +G  +A   A   ++ V +IVG 
Sbjct: 290 PIRGEINNLLNNRDELNVILADGTEKAAAIANPIIEEVYKIVGF 333


>gi|119386660|ref|YP_917715.1| tryptophanyl-tRNA synthetase [Paracoccus denitrificans PD1222]
 gi|119377255|gb|ABL72019.1| tryptophanyl-tRNA synthetase [Paracoccus denitrificans PD1222]
          Length = 339

 Score =  302 bits (773), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 159/344 (46%), Positives = 220/344 (63%), Gaps = 19/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G L LGNYLG ++     Q       +Y + DLHAIT     E LR+ +R   A
Sbjct: 11  SGIQPSGGLTLGNYLGALKRFADYQGKGAET-IYCVVDLHAITVWQEPEKLRHNTREVAA 69

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           +F+A+GVDP  +I+F QS V  HA+L+W+ + VAR+GWM  M QFK+K+ +N E + SLG
Sbjct: 70  AFMASGVDPEVSILFNQSQVSQHAELAWLFNTVARVGWMYRMTQFKDKAGKNSENS-SLG 128

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L  YP LMAADIL Y AT VPVGEDQ+QHLE+TR IA +FN +                 
Sbjct: 129 LLAYPSLMAADILAYHATAVPVGEDQKQHLELTRDIAAKFNHD----------------- 171

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
           Y   FFPI E +I+ +A+R+ SLRD SKKMSKSD SD SRINL D+ D IA+KI+KA+TD
Sbjct: 172 YGVDFFPITEPMIEGTATRVMSLRDGSKKMSKSDPSDASRINLTDDADAIAQKIRKARTD 231

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            D LP  + GL++R EAKNL+ I+A +     ++ L +F G+ F  FK ALA+  +E + 
Sbjct: 232 ADPLPGSMEGLKDRPEAKNLVNIYAALTGENGDQVLARFEGQGFGAFKPALAEVAVEALA 291

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PI++++   + D + +D IL  GA +A   A   ++   +I+G+
Sbjct: 292 PITRRMTEFMADPAEIDRILGRGAGQAAAIAGPIVERTKDIMGM 335


>gi|294010813|ref|YP_003544273.1| tryptophanyl-tRNA synthetase [Sphingobium japonicum UT26S]
 gi|292674143|dbj|BAI95661.1| tryptophanyl-tRNA synthetase [Sphingobium japonicum UT26S]
          Length = 334

 Score =  300 bits (767), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 155/347 (44%), Positives = 222/347 (63%), Gaps = 20/347 (5%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLG--MYFIADLHAITNNIVQENLRYQSRL 66
           +SG+QPTG LHLGNYLG IRN +R Q+  +      +F+AD+H+IT +  +E      R 
Sbjct: 4   LSGIQPTGNLHLGNYLGAIRNWVRMQDEMDSQSQCFFFLADMHSITVHEGREQRIRNVRD 63

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A+ +AAG+DP R+++F Q+ V  HA+L W+L+  AR+GW+N M QFK+K  +++E  A
Sbjct: 64  MAAALVAAGIDPDRSVLFNQARVPAHAELCWLLNGTARIGWLNRMTQFKDKVGKDRE-GA 122

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           S+GLF+YPVL AADIL+Y ATHVPVGEDQ+QHLE+ R IA +FNT+F  ++         
Sbjct: 123 SIGLFVYPVLQAADILVYNATHVPVGEDQKQHLELARDIATKFNTDFGVEL--------- 173

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F + + +I   ++RI SLRD + KMSKSD SD SRINL D+ D I +K++KA
Sbjct: 174 --------FTLPDPIIPKESARIMSLRDGTAKMSKSDPSDMSRINLTDDDDAIMQKVKKA 225

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
           KTD + LP    GL  R EA NL+ I+AT+  + ++    +F GK F  FK AL + ++E
Sbjct: 226 KTDPEPLPDNAEGLAGRPEANNLLGIYATLSGMSVDAVCAEFAGKGFGAFKPALGELLVE 285

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + PI  +   L  D + LD IL +GA +A   A+ T++   + +GL
Sbjct: 286 TLRPIRSRFMELRTDDAALDAILEKGAAKASAAAEPTLRAAYDAMGL 332


>gi|330813333|ref|YP_004357572.1| tryptophanyl-tRNA synthetase [Candidatus Pelagibacter sp. IMCC9063]
 gi|327486428|gb|AEA80833.1| tryptophanyl-tRNA synthetase [Candidatus Pelagibacter sp. IMCC9063]
          Length = 334

 Score =  299 bits (765), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 157/359 (43%), Positives = 224/359 (62%), Gaps = 33/359 (9%)

Query: 2   LSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLR 61
           ++ +   +SG+QPTG LHLGNY G I N +  Q+   +   + +A++HAIT       ++
Sbjct: 1   MTQNKRILSGIQPTGNLHLGNYFGAINNFVLLQK--EYECFFMLANMHAIT-------VK 51

Query: 62  YQSRLF-------VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQF 114
           Y+ ++         A+ +A+G+DP  N IF QS V  HA+L+WI +C AR+GW+N M QF
Sbjct: 52  YEPQILEDNILETTAALVASGIDPKNNTIFVQSSVSAHAELAWIFNCTARIGWLNRMTQF 111

Query: 115 KEKSKENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFE 174
           KEK+  NKE+ AS+GL  YP+LMAADILLYRATHVPVGEDQ+QHLE+ R IA +FN +F+
Sbjct: 112 KEKAGSNKEK-ASVGLLTYPILMAADILLYRATHVPVGEDQKQHLELCRDIAIKFNNDFK 170

Query: 175 RKIKEVAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLD 234
                           +  FF   E +I  + SR+ SLRD +KKMSKS+ SD SRINL D
Sbjct: 171 ----------------ANDFFVTPEPIIPENISRVMSLRDGTKKMSKSEESDLSRINLTD 214

Query: 235 NPDIIAKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFS 294
           + D+I KKIQK KTD + +   +     R EA+NLI IF+ +   K+++ +  + GK FS
Sbjct: 215 DADLILKKIQKGKTDSEAISESILKSNTRPEARNLINIFSALTGKKMQDVITNWNGKAFS 274

Query: 295 QFKLALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           +FK  L   +IE+I PI ++I  L  D  +L  IL +G+ +A+  A   +  + +IVGL
Sbjct: 275 EFKKELGLLLIEKICPIGKEIIKLKSDPVFLKQILKDGSKKAQEVANTNLMEIKKIVGL 333


>gi|94498192|ref|ZP_01304753.1| tryptophanyl-tRNA synthetase [Sphingomonas sp. SKA58]
 gi|94422322|gb|EAT07362.1| tryptophanyl-tRNA synthetase [Sphingomonas sp. SKA58]
          Length = 334

 Score =  296 bits (759), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 159/347 (45%), Positives = 217/347 (62%), Gaps = 20/347 (5%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLG--MYFIADLHAITNNIVQENLRYQSRL 66
           +SG+QPTG LHLGNYLG IRN +R Q+  +      +F+AD+H+IT +  +E      R 
Sbjct: 4   LSGIQPTGNLHLGNYLGAIRNWVRMQDEMDSESQCFFFLADMHSITVHEGREARIRNVRD 63

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A+ +AAG+DP R+++F Q+ V  HA+L W+L+  AR+GW+N M QFK+K  +++E  A
Sbjct: 64  MAAALVAAGIDPDRSVLFNQARVPAHAELCWLLNGTARIGWLNRMTQFKDKVGKDRE-GA 122

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           S+GLF+YPVL AADILLY ATHVPVGEDQ+QHLE+ R IA +FNT+F             
Sbjct: 123 SIGLFVYPVLQAADILLYNATHVPVGEDQKQHLELARDIATKFNTDF------------- 169

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F +   +I   ++RI SLRD S KMSKSD SD SRINL D+ D I +K++KA
Sbjct: 170 ----GIDLFTMPAPIIPKESARIMSLRDGSAKMSKSDPSDMSRINLTDDDDAIMQKVKKA 225

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
           KTD + LP    GL  R EA NL+ IFAT+     +     F GK F  FK AL + ++E
Sbjct: 226 KTDPEPLPETAEGLTGRPEANNLVGIFATLTGRTPDTVCADFAGKGFGAFKPALGEVLVE 285

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + PI ++   L  D + LD IL +GA RA   A+ T++   + +GL
Sbjct: 286 TLRPIRERFLALRTDDAALDAILDKGAARAAAAAEPTLRAAYDAMGL 332


>gi|148260029|ref|YP_001234156.1| tryptophanyl-tRNA synthetase [Acidiphilium cryptum JF-5]
 gi|326403015|ref|YP_004283096.1| tryptophanyl-tRNA synthetase [Acidiphilium multivorum AIU301]
 gi|146401710|gb|ABQ30237.1| tryptophanyl-tRNA synthetase [Acidiphilium cryptum JF-5]
 gi|325049876|dbj|BAJ80214.1| tryptophanyl-tRNA synthetase [Acidiphilium multivorum AIU301]
          Length = 333

 Score =  296 bits (757), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 158/344 (45%), Positives = 218/344 (63%), Gaps = 20/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QPTG+ HLGNYLG I+N +  QE   + G+Y + DLHA+T  +  E LR Q+R+  A
Sbjct: 6   SGIQPTGIAHLGNYLGAIQNWVALQE--GNEGIYCLVDLHALTVWVEPEALRQQTRVNAA 63

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
             +A G+DP+R+I+F QS V  HA L+WI +CVAR GW+N M QFK+K+ +++E   S G
Sbjct: 64  LLVACGIDPARSILFHQSAVHAHARLAWIFNCVARFGWLNRMTQFKDKAGKDRE-AVSTG 122

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF+YP LMAADIL Y AT VPVGEDQ QHLE+   IAQ+FN +                 
Sbjct: 123 LFVYPNLMAADILAYHATEVPVGEDQSQHLELANDIAQKFNHD----------------- 165

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
           Y   FFP I   I   ++RI SLRD ++KMSKSD+SD SRINL D+ D IA+KI++A+TD
Sbjct: 166 YGVEFFPAITPRIIGGSARIMSLRDGTRKMSKSDTSDQSRINLTDDADAIAQKIRRARTD 225

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            + LP   + L++R EA+NL+ I+A +  I  EE L+Q  G  F  FK  L +  ++++ 
Sbjct: 226 PEPLPERPAQLDSRPEARNLVGIYAALAGITAEEVLRQHAGSGFGPFKERLTELAVQKLT 285

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PI  + + L  D + +D +L  GA RA   A+  +     +VGL
Sbjct: 286 PIGAETKRLAADPAEIDRMLQAGAARAAAIAEPIVAEAERLVGL 329


>gi|254503587|ref|ZP_05115738.1| tryptophanyl-tRNA synthetase [Labrenzia alexandrii DFL-11]
 gi|222439658|gb|EEE46337.1| tryptophanyl-tRNA synthetase [Labrenzia alexandrii DFL-11]
          Length = 316

 Score =  295 bits (756), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 159/312 (50%), Positives = 212/312 (67%), Gaps = 6/312 (1%)

Query: 47  DLHAITNNIVQEN-LRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARM 105
           D HAIT      + L   +R   A+++AAG+DP ++IIF QS V  H +L+WI +CVARM
Sbjct: 2   DSHAITAGFPDPSELTNATREVTAAYMAAGIDPKKSIIFNQSQVREHMELAWIFNCVARM 61

Query: 106 GWMNNMIQFKEKSKENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLI 165
           GW+N M QFKEK+ +NKE  AS+GLF YP LMAADIL YRATHVPVG+DQ+QHLE+TR I
Sbjct: 62  GWLNRMTQFKEKAGKNKE-NASVGLFAYPNLMAADILAYRATHVPVGDDQKQHLELTRDI 120

Query: 166 AQRFNTEFERKIKE----VAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSK 221
           A +FN +F  +IKE    V       E   + +FP+ E +I   A+RI SLRD +KKMSK
Sbjct: 121 AAKFNNDFGARIKELGIGVPNPTPSPELPEELYFPLTEPMIAGPATRIMSLRDGTKKMSK 180

Query: 222 SDSSDFSRINLLDNPDIIAKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKI 281
           SD SD SRINL D+ D IAKKI+KAKTD D LPSE  GLE R EA NL+ I+A +  +  
Sbjct: 181 SDPSDLSRINLKDDADAIAKKIKKAKTDPDALPSETDGLEGRPEADNLVGIYAALNGMSK 240

Query: 282 EEALKQFGGKNFSQFKLALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQ 341
           ++ LK++GG+ FS FK AL+D  + ++ P++ +++ L  D + +D IL EGA  A   A+
Sbjct: 241 DDVLKEYGGQQFSAFKPALSDLAVAKLAPMTDEMRRLTGDPAQIDAILKEGAENASAIAE 300

Query: 342 ETMKYVNEIVGL 353
             +K V +I+G 
Sbjct: 301 PVLKDVRKIIGF 312


>gi|296535531|ref|ZP_06897714.1| tryptophanyl-tRNA synthetase [Roseomonas cervicalis ATCC 49957]
 gi|296264144|gb|EFH10586.1| tryptophanyl-tRNA synthetase [Roseomonas cervicalis ATCC 49957]
          Length = 333

 Score =  295 bits (754), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 153/344 (44%), Positives = 211/344 (61%), Gaps = 20/344 (5%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G+  LGNYLG IRN +      +H  +Y + D HAIT     + L  Q+R   A
Sbjct: 6   SGIQPSGIPTLGNYLGAIRNWV--PMMADHECIYCVVDQHAITVWQDPKELARQTREMAA 63

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           + +A GV P +  +F QS V  H  L+WI +CVAR+GW+N M QFK+K+ +++E  A  G
Sbjct: 64  ALIACGVTPDKCTLFVQSHVPAHTRLAWIFNCVARIGWLNRMTQFKDKAGKDRE-NAGAG 122

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L++YP LMAADI  Y AT VPVGEDQ+QHLE+   IAQ+FN +                 
Sbjct: 123 LYVYPNLMAADIHAYHATRVPVGEDQKQHLELANDIAQKFNHD----------------- 165

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
           Y   FFP IE +I   A+R+ SLRD ++KMSKSD SD SRINL D+ D IA KI++AKTD
Sbjct: 166 YGVDFFPNIEPMIQGVAARVMSLRDGTRKMSKSDPSDQSRINLTDDADAIALKIRRAKTD 225

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            + LP E +GLE R EA+NL+ I A +  +   E L+Q  G+ F  FK  L DA++  + 
Sbjct: 226 PEPLPGEAAGLEGRPEARNLVGILAAITGVTPAEVLRQHEGQGFGSFKTVLTDALVAHLG 285

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           PI  ++Q LL D + +D  L +G+++A   A+  +    E+VG 
Sbjct: 286 PIQAEMQRLLDDPAAVDAELRKGSDKASAIAEPIVNRAEELVGF 329


>gi|307294075|ref|ZP_07573919.1| tryptophanyl-tRNA synthetase [Sphingobium chlorophenolicum L-1]
 gi|306880226|gb|EFN11443.1| tryptophanyl-tRNA synthetase [Sphingobium chlorophenolicum L-1]
          Length = 345

 Score =  292 bits (747), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 154/358 (43%), Positives = 220/358 (61%), Gaps = 31/358 (8%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHL-------------GMYFIADLHAITNNI 55
           +SG+QPTG LHLGNYLG IRN +R Q+  + +               +F+AD+H+IT + 
Sbjct: 4   LSGIQPTGNLHLGNYLGAIRNWVRMQDEMDTVVANADSATNGRSQCFFFLADMHSITVHE 63

Query: 56  VQENLRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFK 115
            +E      R   A+ +AAG+DP R+++F Q+ V  HA+L W+L+  AR+GW+N M QFK
Sbjct: 64  GREQRIRNVRDMAAALVAAGIDPDRSVLFNQARVPAHAELCWLLNGTARIGWLNRMTQFK 123

Query: 116 EKSKENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFER 175
           +K  +++E  AS+GLF+YPVL AADIL+Y ATHVPVGEDQ+QHLE+ R IA +FNT+F  
Sbjct: 124 DKVGKDRE-GASIGLFVYPVLQAADILVYNATHVPVGEDQKQHLELARDIATKFNTDFGV 182

Query: 176 KIKEVAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDN 235
           ++                 F + + +I   ++RI S RD + KMSKSD SD SRINL D+
Sbjct: 183 EL-----------------FTLPDPIIPKESARIMSFRDGTAKMSKSDPSDMSRINLTDD 225

Query: 236 PDIIAKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQ 295
            D I +K++KAKTD + LP    GL  R EA NL+ I+AT+     +    +F GK F  
Sbjct: 226 DDAIMQKVKKAKTDPEPLPETAEGLAGRPEANNLVGIYATLEGRTADAVCAEFAGKGFGA 285

Query: 296 FKLALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           FK AL + ++E + PI  +   L  D + LD IL +GA +A   A+ T++   + +GL
Sbjct: 286 FKPALGELLVETLRPIRSRFMELRTDDAALDAILEKGAAKASAAAEPTLRAAYDAMGL 343


>gi|58578773|ref|YP_196985.1| tryptophanyl-tRNA synthetase [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58417399|emb|CAI26603.1| Tryptophanyl-tRNA synthetase [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 339

 Score =  288 bits (736), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 156/345 (45%), Positives = 215/345 (62%), Gaps = 22/345 (6%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQ-ENLRYQSRLF 67
           +SG+QPTG +HLGNYLG IRN +  Q +  +   +F+ADLH +T+     + L+  S   
Sbjct: 14  LSGIQPTGSIHLGNYLGFIRNGVSLQNS--YKCFFFLADLHTLTSETYNPDELKKNSINT 71

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
           +A++LA G+DP  +++F QS +  H +L WI SC+   G +N M QFKEKS+ NK  TAS
Sbjct: 72  LATYLACGIDPENSVLFSQSFIPAHTELLWIFSCITSTGQLNRMTQFKEKSR-NKVSTAS 130

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           LGL+ YPVLMAADILLY+A  VPVG DQ+QHLE+ R IAQ FNT                
Sbjct: 131 LGLYSYPVLMAADILLYQANIVPVGIDQKQHLELARDIAQAFNT---------------- 174

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
            +Y+  +F + E LI   +++I SLRD  KKMSKSD SD+SRINL D+ D+IA+KI KA 
Sbjct: 175 -KYNTQYFQLPEPLIVQESAKIMSLRDGKKKMSKSDVSDYSRINLEDSNDLIAQKINKAT 233

Query: 248 TDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
           TD  ++  + + L NR   KNL+ I+AT+  I IE+           QFK  L + +I  
Sbjct: 234 TDS-IVGFDFTSLNNRPAVKNLVNIYATLSNISIEQTCTNIASFTTKQFKEELTELIINN 292

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVG 352
           I PI QK++ LL+D  YL +IL+ G N+A   A + +  + +I G
Sbjct: 293 IAPIRQKLRELLEDIEYLRSILMTGNNKAASIAHKHIIEIKKIAG 337


>gi|57238843|ref|YP_179979.1| tryptophanyl-tRNA synthetase [Ehrlichia ruminantium str.
           Welgevonden]
 gi|57160922|emb|CAH57827.1| tryptophanyl-tRNA synthetase [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 332

 Score =  288 bits (736), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 156/345 (45%), Positives = 215/345 (62%), Gaps = 22/345 (6%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQ-ENLRYQSRLF 67
           +SG+QPTG +HLGNYLG IRN +  Q +  +   +F+ADLH +T+     + L+  S   
Sbjct: 7   LSGIQPTGSIHLGNYLGFIRNGVSLQNS--YKCFFFLADLHTLTSETYNPDELKKNSINT 64

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
           +A++LA G+DP  +++F QS +  H +L WI SC+   G +N M QFKEKS+ NK  TAS
Sbjct: 65  LATYLACGIDPENSVLFSQSFIPAHTELLWIFSCITSTGQLNRMTQFKEKSR-NKVSTAS 123

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           LGL+ YPVLMAADILLY+A  VPVG DQ+QHLE+ R IAQ FNT                
Sbjct: 124 LGLYSYPVLMAADILLYQANIVPVGIDQKQHLELARDIAQAFNT---------------- 167

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
            +Y+  +F + E LI   +++I SLRD  KKMSKSD SD+SRINL D+ D+IA+KI KA 
Sbjct: 168 -KYNTQYFQLPEPLIVQESAKIMSLRDGKKKMSKSDVSDYSRINLEDSNDLIAQKINKAT 226

Query: 248 TDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
           TD  ++  + + L NR   KNL+ I+AT+  I IE+           QFK  L + +I  
Sbjct: 227 TDS-IVGFDFTSLNNRPAVKNLVNIYATLSNISIEQTCTNIASFTTKQFKEELTELIINN 285

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVG 352
           I PI QK++ LL+D  YL +IL+ G N+A   A + +  + +I G
Sbjct: 286 IAPIRQKLRELLEDIEYLRSILMTGNNKAASIAHKHIIEIKKIAG 330


>gi|58616832|ref|YP_196031.1| tryptophanyl-tRNA synthetase [Ehrlichia ruminantium str. Gardel]
 gi|58416444|emb|CAI27557.1| Tryptophanyl-tRNA synthetase [Ehrlichia ruminantium str. Gardel]
          Length = 340

 Score =  287 bits (734), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 156/345 (45%), Positives = 216/345 (62%), Gaps = 22/345 (6%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQ-ENLRYQSRLF 67
           +SG+QPTG +HLGNYLG IRN +  Q +  +   +F+ADLH +T+     + L+  S   
Sbjct: 14  LSGIQPTGSIHLGNYLGFIRNGVSLQNS--YKCFFFLADLHTLTSEAYNPDELKKNSINT 71

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
           +A++LA G+DP  +++F QS +  H +L WI SC+   G +N M QFKEKS+ NK  TAS
Sbjct: 72  LATYLACGIDPENSVLFSQSFIPAHTELLWIFSCITSTGQLNRMTQFKEKSR-NKVSTAS 130

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           LGL+ YPVLMAADILLY+A  VPVG DQ+QHLE+ R IAQ FNT                
Sbjct: 131 LGLYSYPVLMAADILLYQANIVPVGIDQKQHLELARDIAQAFNT---------------- 174

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
            +Y+  +F + E LI   +++I SLRD  KKMSKSD SD+SRINL D+ D+IA+KI KA 
Sbjct: 175 -KYNTQYFQLPEPLIVQESAKIMSLRDGKKKMSKSDVSDYSRINLEDSNDLIAQKINKAT 233

Query: 248 TDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
           TD  ++  +++ L NR   KNL+ I+AT+  I IE+           QFK  L + VI  
Sbjct: 234 TDS-IVGFDLTSLNNRPAIKNLVNIYATLSNISIEQTCTNIASFTTKQFKEELTELVINN 292

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVG 352
           I PI Q+++ LL+D  YL +IL+ G N+A   A + +  + +I G
Sbjct: 293 IAPIRQRLRELLEDIEYLRSILMTGNNKAASIAHKHIIEIKKIAG 337


>gi|67459216|ref|YP_246840.1| tryptophanyl-tRNA synthetase [Rickettsia felis URRWXCal2]
 gi|75536352|sp|Q4UL98|SYW_RICFE RecName: Full=Tryptophanyl-tRNA synthetase; AltName:
           Full=Tryptophan--tRNA ligase; Short=TrpRS
 gi|67004749|gb|AAY61675.1| Tryptophanyl-tRNA synthetase [Rickettsia felis URRWXCal2]
          Length = 330

 Score =  285 bits (730), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 162/345 (46%), Positives = 217/345 (62%), Gaps = 22/345 (6%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQ TG LHLGNYLG IRN ++ QE  N    +F+ADLHAIT +I    L       +
Sbjct: 6   LSGVQATGSLHLGNYLGSIRNWVKMQEEYN--CFFFLADLHAITVDIKPSELNNSIMGVL 63

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LAAG++P +  IF QS V  HA+L+W+L+CV  +GW+  M QFK+K+  ++E+ A L
Sbjct: 64  AVYLAAGLNPDKVTIFAQSMVKEHAELAWLLNCVTPLGWLKRMTQFKDKAGSDQEK-ACL 122

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GLF YPVLMAADIL+Y+A  VPVGEDQ+QHLE+TR IA   N  F+++I +V        
Sbjct: 123 GLFSYPVLMAADILIYKADIVPVGEDQKQHLELTRDIAGVINRRFDKEILKVP------- 175

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                     E LI  + +RI SLRD  KKMSKSD SDFSRINL D+ D+I +KI+KAKT
Sbjct: 176 ----------EVLISETGTRIMSLRDGLKKMSKSDISDFSRINLKDDNDLIHQKIKKAKT 225

Query: 249 DGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
           D     S     E R E  NL++I+ ++ +  +E+ +  +  + FS+FK  LA+ +I  +
Sbjct: 226 DHLSFVS--YDKETRPEISNLLDIYRSLSEESLEKIINNYQNQGFSKFKEDLAEIIITNL 283

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            PI  K   L+ DK YL  IL +GA +AR RA ET+  V E  G 
Sbjct: 284 QPIRDKYLELMNDKEYLLKILHKGAEKARIRASETVNEVKEQFGF 328


>gi|229586829|ref|YP_002845330.1| tryptophanyl-tRNA synthetase [Rickettsia africae ESF-5]
 gi|228021879|gb|ACP53587.1| Tryptophanyl-tRNA synthetase [Rickettsia africae ESF-5]
          Length = 330

 Score =  284 bits (727), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 160/345 (46%), Positives = 217/345 (62%), Gaps = 22/345 (6%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQ TG LHLGNYLG I+N ++ QE  N    +F+ADLHAIT +I    L       +
Sbjct: 6   LSGVQATGSLHLGNYLGAIKNWVKMQEEYN--CFFFLADLHAITVDIKPSELNNSIMEVL 63

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LAAG++P +  IF QS V  H +L+W+L+CV  +GW+  M QFK+K+  ++E+ A L
Sbjct: 64  AVYLAAGLNPDKVTIFAQSMVKEHTELAWLLNCVTPLGWLKRMTQFKDKAGSDQEK-ACL 122

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GLF YPVLMAADIL+Y+A  VPVGEDQ+QHLE+TR IA   N +F ++I +V        
Sbjct: 123 GLFSYPVLMAADILIYKADIVPVGEDQKQHLELTRDIAGVINRKFNKEILKVP------- 175

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                     E LI  + +RI SLRD  KKMSKSD SDFSRINL DN D+I +KI+KAKT
Sbjct: 176 ----------EVLISETGTRIMSLRDGLKKMSKSDISDFSRINLKDNNDLIHQKIKKAKT 225

Query: 249 DGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
           D     S     E R E  NL++I++++ +  +E+ +  +  + F++FK  LA+ +I  +
Sbjct: 226 DHLSFVS--YDQETRPEISNLLDIYSSLSEESLEKIIGNYQNQGFAKFKEDLAEIIITNL 283

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            PI  K   L+ DK YL  IL +GA +AR RA ET+  V E  G 
Sbjct: 284 QPIRNKYLELMNDKEYLLKILHKGAEKARIRASETVNEVKEQFGF 328


>gi|157828584|ref|YP_001494826.1| tryptophanyl-tRNA synthetase [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165933296|ref|YP_001650085.1| tryptophanyl-tRNA synthetase [Rickettsia rickettsii str. Iowa]
 gi|157801065|gb|ABV76318.1| tryptophanyl-tRNA synthetase [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165908383|gb|ABY72679.1| tryptophanyl-tRNA synthetase [Rickettsia rickettsii str. Iowa]
          Length = 330

 Score =  284 bits (726), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 159/345 (46%), Positives = 218/345 (63%), Gaps = 22/345 (6%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQ TG LHLGNYLG I+N ++ QE  N    +F+ADLHAIT +I    L       +
Sbjct: 6   LSGVQATGSLHLGNYLGAIKNWVKMQEEYN--CFFFLADLHAITVDIKPSELNNSIMEVL 63

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LAAG++P +  IF QS V  H +L+W+L+CV  +GW+  M QFK+K+  ++E+ A L
Sbjct: 64  AVYLAAGLNPDKVTIFAQSMVKEHTELAWLLNCVTPLGWLKRMTQFKDKAGSDQEK-ACL 122

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GLF YPVLMAADIL+Y+A  VPVGEDQ+QHLE+TR IA   N +F ++I +V        
Sbjct: 123 GLFSYPVLMAADILIYKADIVPVGEDQKQHLELTRDIAGVINRKFNKEILKVP------- 175

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                     E LI  + +RI SLRD SKKMSKSD SDF+RINL D+ D+I +KI+KAKT
Sbjct: 176 ----------EVLISETGTRIMSLRDGSKKMSKSDISDFARINLKDDNDLIHQKIKKAKT 225

Query: 249 DGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
           D     S     E R E  NL++I++++ +  +E+ +  +  + F++FK  LA+ +I  +
Sbjct: 226 DHLSFVS--YDQETRPEISNLLDIYSSLSEESLEKIIGNYQNQGFAKFKEDLAEIIITNL 283

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            PI  K   L+ DK YL  IL +GA +AR RA ET+  V E  G 
Sbjct: 284 QPIRDKYLELMNDKGYLLKILHKGAEKARIRASETVNEVKEQFGF 328


>gi|15892633|ref|NP_360347.1| tryptophanyl-tRNA synthetase [Rickettsia conorii str. Malish 7]
 gi|20178129|sp|Q92HR1|SYW_RICCN RecName: Full=Tryptophanyl-tRNA synthetase; AltName:
           Full=Tryptophan--tRNA ligase; Short=TrpRS
 gi|15619802|gb|AAL03248.1| tryptophanyl-tRNA synthetase [Rickettsia conorii str. Malish 7]
          Length = 330

 Score =  283 bits (724), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 159/345 (46%), Positives = 217/345 (62%), Gaps = 22/345 (6%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQ TG LHLGNYLG I+N ++ QE  N    +F+ADLHAIT +I    L       +
Sbjct: 6   LSGVQATGSLHLGNYLGAIKNWVKMQEEYN--CFFFLADLHAITVDIKPSELNNSIMEVL 63

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LAAG++P +  IF QS V  H +L+W+L+CV  +GW+  M QFK+K+  ++E+ A L
Sbjct: 64  AVYLAAGLNPDKVTIFAQSMVKEHTELAWLLNCVTPLGWLKRMTQFKDKAGSDQEK-ACL 122

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GLF YPVLMAADIL+Y+A  VPVGEDQ+QHLE+TR IA   N +F ++I +V        
Sbjct: 123 GLFSYPVLMAADILIYKADIVPVGEDQKQHLELTRDIAGVINRKFNKEILKVP------- 175

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                     E LI  + +RI SLRD  KKMSKSD SDFSRINL D+ D+I +KI+KAKT
Sbjct: 176 ----------EVLISETGTRIMSLRDGLKKMSKSDISDFSRINLKDDNDLIHQKIKKAKT 225

Query: 249 DGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
           D     S     E R E  NL++I++++ +  +E+ +  +  + F++FK  LA+ +I  +
Sbjct: 226 DHLSFVS--YDQETRPEISNLLDIYSSLSEESLEQIIGNYQNQGFAKFKEDLAEIIITNL 283

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            PI  K   L+ DK YL  IL +GA +AR RA ET+  V E  G 
Sbjct: 284 QPIRDKYLELMNDKEYLLKILHKGAEKARIRASETVNEVKEQFGF 328


>gi|238650775|ref|YP_002916630.1| tryptophanyl-tRNA synthetase [Rickettsia peacockii str. Rustic]
 gi|238624873|gb|ACR47579.1| tryptophanyl-tRNA synthetase [Rickettsia peacockii str. Rustic]
          Length = 330

 Score =  283 bits (724), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 159/345 (46%), Positives = 218/345 (63%), Gaps = 22/345 (6%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQ TG LHLGNYLG I+N ++ QE  N    +F+ADLHAIT +I    L       +
Sbjct: 6   LSGVQATGSLHLGNYLGAIKNWVKMQEEYN--CFFFLADLHAITVDIKPSELNNSIMEVL 63

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LAAG++P +  IF QS V  H +L+W+L+CV  +GW+  M QFK+K+  ++E+ A L
Sbjct: 64  AVYLAAGLNPDKVTIFAQSMVKEHTELAWLLNCVTPLGWLKRMTQFKDKAGSDQEK-ACL 122

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GLF YPVLMAADIL+Y+A  VPVGEDQ+QHLE+TR IA   N +F+++I +V        
Sbjct: 123 GLFSYPVLMAADILIYKADIVPVGEDQKQHLELTRDIAGVINRKFKKEILKVP------- 175

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                     E LI  + +RI SLRD  KKMSKSD SDFSRINL D+ D+I +KI+KAKT
Sbjct: 176 ----------EILISETGTRIMSLRDGLKKMSKSDISDFSRINLKDDNDLIHQKIKKAKT 225

Query: 249 DGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
           D     S     E R E  NL++I++++ +  +E+ +  +  + F++FK  LA+ +I  +
Sbjct: 226 DHLSFVS--YDQETRPEISNLLDIYSSLSEESLEKIIGNYQNQGFAKFKEDLAEIIITNL 283

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            PI  K   L+ DK YL  IL +GA +AR RA ET+  V E  G 
Sbjct: 284 QPIRDKYLELMNDKEYLLKILHKGAEKARIRASETVNEVKEQFGF 328


>gi|167999805|ref|XP_001752607.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162696138|gb|EDQ82478.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 415

 Score =  282 bits (722), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 151/346 (43%), Positives = 216/346 (62%), Gaps = 13/346 (3%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           VSGVQPTG +HLGNYLG I++ +  Q+  + L  + + DLHAIT     E L   +R   
Sbjct: 70  VSGVQPTGSIHLGNYLGAIKSWVGLQDLYDTL--FLVVDLHAITMPHDVEQLTKSTRTSA 127

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A ++A G+DP+++ IF QS V  HA+L+W+LSCV  + W+N MIQFKEKS+++ E+  + 
Sbjct: 128 ALYIACGIDPTKSSIFVQSHVSAHAELTWLLSCVTPISWLNKMIQFKEKSRKSGEDVGT- 186

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEF-ERKIKEVAQKYAQE 187
           GL  YP+LMA+DI+LY++  VPVGEDQRQHLE+TR +A R N  +  RK K++  +  + 
Sbjct: 187 GLLTYPLLMASDIILYQSDLVPVGEDQRQHLELTRDVADRVNHLYGGRKWKKLGGRGGK- 245

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F + E L+  + +R+ SL D + KMSKS  SD SRINLLD PD IA KI++ K
Sbjct: 246 ------IFKVPEALVPETCARVMSLTDGTAKMSKSAPSDLSRINLLDTPDQIANKIKRCK 299

Query: 248 TDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
           TD   L  E   +E R E  NL+ I+  +     +E + + G  ++ QFK  L DA++  
Sbjct: 300 TD-SALGMEFGNVE-RPECNNLLSIYQQVTGKTQQEVIAECGEMSWGQFKPVLTDALVAH 357

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + PI +    ++ D+SYLD+IL EGA +A   A  T+K V   +G 
Sbjct: 358 LQPIQKTYSEVIADQSYLDSILGEGAAKANLIANSTLKNVYSAMGF 403


>gi|239947353|ref|ZP_04699106.1| tryptophanyl-tRNA synthetase [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239921629|gb|EER21653.1| tryptophanyl-tRNA synthetase [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 330

 Score =  281 bits (720), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 161/345 (46%), Positives = 217/345 (62%), Gaps = 22/345 (6%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQ TG LHLGNYLG IRN ++ QE  N    +F+ADLHAIT NI    L       +
Sbjct: 6   LSGVQATGSLHLGNYLGSIRNWVKIQEEYN--CFFFLADLHAITVNIKPSELNNSIMGGL 63

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LAAG++P +  IF QS V  H +L+W+L+CV  +GW+  M+QFK+K+  ++E+   L
Sbjct: 64  AVYLAAGLNPDKVTIFAQSMVKEHTELAWLLNCVTPLGWLKRMMQFKDKAGSDQEKVC-L 122

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GLF YPVLMAADIL+Y+A  VPVGEDQ+QHLE+TR IA   N  F+++I +V        
Sbjct: 123 GLFSYPVLMAADILIYKADMVPVGEDQKQHLELTRDIAGVINRRFDKEILKV-------- 174

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                  P I  LI  + +RI SLRD  KKMSKSD SDFSRINL D+ D+I +KI+KAKT
Sbjct: 175 -------PDI--LISETGTRIMSLRDGLKKMSKSDISDFSRINLKDDNDLIHQKIKKAKT 225

Query: 249 DGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
           D   L       E R E  NL++I+ ++ +  +E+ +  +  + F++FK  LA+ +I  +
Sbjct: 226 DH--LSFVSYDKETRPEISNLLDIYRSLSEESLEKIIDNYQNQGFAKFKEDLAEIIITNL 283

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            PI  K   L+ DK YL  IL +GA +AR RA ET+  V E  G 
Sbjct: 284 QPIRDKYLELMNDKEYLLKILHKGAEKARIRASETVNEVKEQFGF 328


>gi|157803666|ref|YP_001492215.1| tryptophanyl-tRNA synthetase [Rickettsia canadensis str. McKiel]
 gi|157784929|gb|ABV73430.1| tryptophanyl-tRNA synthetase [Rickettsia canadensis str. McKiel]
          Length = 330

 Score =  281 bits (720), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 159/345 (46%), Positives = 218/345 (63%), Gaps = 22/345 (6%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQ TG LHLGNYLG IRN ++ QE  N    +F+ADLH+IT +I    L       +
Sbjct: 6   LSGVQATGSLHLGNYLGSIRNWVKMQEEYN--CFFFLADLHSITVDIKPSELNNSIMEVI 63

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A ++AAG++  +  IF QS V  H++L+W+LSCV  +GW+  MIQFK+K+  ++E+ A L
Sbjct: 64  ALYIAAGLEADKVTIFAQSMVKEHSELAWLLSCVTSLGWLKRMIQFKDKAGSDQEK-ACL 122

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GLF YPVLMAADIL+Y+A  VPVGEDQ+QHLE+TR IA   N +F ++I +V        
Sbjct: 123 GLFSYPVLMAADILIYKADIVPVGEDQKQHLELTRDIAGMINRKFNKEILKVP------- 175

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                     E LI+ S +RI SLRD  KKMSKSD SDFSRINL D+ D+I +KI+KAKT
Sbjct: 176 ----------EPLINGSGTRIMSLRDGLKKMSKSDISDFSRINLKDDNDLIHQKIKKAKT 225

Query: 249 DGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
           D     S     E R E  NL++I+ ++ +  +E+ +  +  + F++FK  LA+ +I  +
Sbjct: 226 DHLSFVS--YDKETRPEISNLLDIYRSLSKESLEKIIANYQNQGFAKFKEDLAEIIITNL 283

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            PI  K   L+ +K YL  IL +GA +AR RA ET+  V E  G 
Sbjct: 284 QPIRDKYLELMNNKEYLLKILHKGAEKARIRASETVNEVKEQFGF 328


>gi|157964648|ref|YP_001499472.1| tryptophanyl-tRNA synthetase [Rickettsia massiliae MTU5]
 gi|157844424|gb|ABV84925.1| Tryptophanyl-tRNA synthetase [Rickettsia massiliae MTU5]
          Length = 330

 Score =  281 bits (718), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 158/345 (45%), Positives = 216/345 (62%), Gaps = 22/345 (6%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQ TG LHLGNYLG I+N ++ QE  N    +F+ADLHAIT +I    L       +
Sbjct: 6   LSGVQATGALHLGNYLGAIKNWVKMQEEYN--CFFFLADLHAITVDIKPSELNNSIMEVL 63

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LAAG++P +  IF QS V  H +L+W+L+CV  +GW+  M QFK+K+  ++E+ A L
Sbjct: 64  AFYLAAGLNPDKVTIFAQSMVKEHTELAWLLNCVTPLGWLKRMTQFKDKAGSDQEK-ACL 122

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GL  YPVLMAADIL+Y+A  VPVGEDQ+QHLE+TR IA   N +F ++I +V        
Sbjct: 123 GLLSYPVLMAADILIYKADIVPVGEDQKQHLELTRDIAGVINRKFNKEILKVP------- 175

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                     E LI ++ +RI SLRD  KKMSKSD SDFSRINL D+ D+I +KI+KAKT
Sbjct: 176 ----------EVLISATGTRIMSLRDGLKKMSKSDISDFSRINLKDDNDLIHQKIKKAKT 225

Query: 249 DGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
           D   L       E R E  NL++I+ ++ +  +E+ +  +  + F++FK  LA+ +I  +
Sbjct: 226 DH--LSFASYDKETRPEISNLLDIYRSLSEESLEKIIGNYQNQGFAKFKEDLAEIIITNL 283

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            PI  K   L+ DK YL  IL +GA +AR RA ET+  V E  G 
Sbjct: 284 QPIRDKYLELMNDKEYLLKILHKGAEKARIRASETVNAVKEHFGF 328


>gi|34581589|ref|ZP_00143069.1| tryptophanyl-tRNA synthetase [Rickettsia sibirica 246]
 gi|28262974|gb|EAA26478.1| tryptophanyl-tRNA synthetase [Rickettsia sibirica 246]
          Length = 330

 Score =  281 bits (718), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 158/345 (45%), Positives = 217/345 (62%), Gaps = 22/345 (6%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQ TG LHLGNYLG I+N ++ QE  N    +F+ADLHAIT +I    L       +
Sbjct: 6   LSGVQATGSLHLGNYLGAIKNWVKMQEEYN--CFFFLADLHAITVDIKPSELNNSIMEVL 63

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LAAG++P +  IF QS V  H +L+W+L+CV  +GW+  M QFK+K+  ++E+ A L
Sbjct: 64  AVYLAAGLNPDKVTIFAQSMVKEHTELAWLLNCVTPLGWLKRMTQFKDKAGSDQEK-ACL 122

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GLF YPVLMAADIL+Y+A  VPVGEDQ+QHLE+TR IA   N +F  +I +V        
Sbjct: 123 GLFSYPVLMAADILIYKADIVPVGEDQKQHLELTRDIAGVINRKFNTEILKVP------- 175

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                     E LI  + +RI SLRD  KKMSKSD SDFSRINL D+ D+I +KI+KAKT
Sbjct: 176 ----------EVLISETGTRIMSLRDGLKKMSKSDISDFSRINLKDDNDLIHQKIKKAKT 225

Query: 249 DGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
           D     S     E R E  NL++I++++ +  +++ + ++  + F++FK  LA+ +I  +
Sbjct: 226 DHLSFVS--YDQETRPEISNLLDIYSSLSEESLDKIIGKYQNQGFAKFKEDLAEIIITNL 283

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            PI  K   L+ DK YL  IL +GA +AR RA ET+  V E  G 
Sbjct: 284 QPIRDKYLELMNDKEYLLKILHKGAEKARIRASETVNEVKEQFGF 328


>gi|157825842|ref|YP_001493562.1| tryptophanyl-tRNA synthetase [Rickettsia akari str. Hartford]
 gi|157799800|gb|ABV75054.1| tryptophanyl-tRNA synthetase [Rickettsia akari str. Hartford]
          Length = 330

 Score =  275 bits (704), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 156/345 (45%), Positives = 216/345 (62%), Gaps = 22/345 (6%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQ TG LHLGNYLG IR+ ++ QE  N    +F+ADLH+IT +I    L       +
Sbjct: 6   LSGVQATGSLHLGNYLGSIRHWVKMQEEYN--CFFFLADLHSITVDIKPSELNNSIIGVL 63

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LAAG++P +  IF QS V  HA+ +W+L+CV  +GW+  M QFK+K+  ++E+ A L
Sbjct: 64  AVYLAAGLNPDKVTIFAQSMVKEHAEFAWLLNCVTPLGWLKRMTQFKDKAGSDQEK-AYL 122

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GLF YPVLMAADIL+Y+A  VPVGEDQ+QHLE+TR IA   N +F+++I +V +      
Sbjct: 123 GLFSYPVLMAADILIYKADIVPVGEDQKQHLELTRDIAGVINRKFDKEILKVPE------ 176

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                  P+I G    S +RI SLRD   KMSKSD SDF+RINL D+ D+I +KI+KAKT
Sbjct: 177 -------PLISG----SGTRIMSLRDGLNKMSKSDISDFARINLKDDNDLIHQKIKKAKT 225

Query: 249 DGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
           D   L       E R E  NL++I+ ++ +  +E+ +  +  + F++FK  LA+ +I  +
Sbjct: 226 DH--LSFVSYDKETRPEISNLLDIYRSLSEESLEKIINNYQNQGFTKFKEDLAEIIITNL 283

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            PI  K   L+ DK YL  IL  GA +A  RA ET+  V E  G 
Sbjct: 284 QPIRDKYLELMNDKEYLLKILRSGAEKASIRASETVNAVKEQFGF 328


>gi|269958265|ref|YP_003328052.1| tryptophanyl-tRNA synthetase [Anaplasma centrale str. Israel]
 gi|269848094|gb|ACZ48738.1| tryptophanyl-tRNA synthetase [Anaplasma centrale str. Israel]
          Length = 329

 Score =  275 bits (704), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 147/353 (41%), Positives = 218/353 (61%), Gaps = 28/353 (7%)

Query: 7   LFVSGVQPTG-VLHLGNYLGMIRNVIRRQ--ETCNHLGMYFIADLHAIT-NNIVQENLRY 62
           +  SG+QP+G V HLGNYLG IR  +  Q  + C    ++ + DLHA+T  N   + L  
Sbjct: 1   MIFSGIQPSGGVPHLGNYLGAIRRWVGLQGSDQC----LFCVVDLHALTAGNATTDALHL 56

Query: 63  QSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENK 122
           ++   +A+++A G+DP ++++F QS V  H++L WIL CV  MGW+N M QFK+KS+   
Sbjct: 57  RAVSLLATYIACGIDPEKSVLFVQSSVPEHSELCWILGCVTPMGWLNRMTQFKDKSRSGC 116

Query: 123 EETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQ 182
             T ++GL+ YPVLMAADILLY+A  VPVG DQ QH+E+T+ IA+ FN            
Sbjct: 117 --TPNMGLYGYPVLMAADILLYKADTVPVGNDQMQHIELTQDIAKAFNA----------- 163

Query: 183 KYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKK 242
                  Y+  +FPI   L    ++RI SLRD+ KKMSKSD+SD SRINL D+ D IA+K
Sbjct: 164 ------AYAVDYFPIPRALSLDDSARIMSLRDSQKKMSKSDASDASRINLDDDDDSIAQK 217

Query: 243 IQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALAD 302
           I++A TD  +    ++ L+ R E +NL+ IFA +  +  +E   +F   +  +FK ALAD
Sbjct: 218 IRRATTDS-IHGLSLASLDERPEMRNLVNIFAALAGMTKKEVCSEFATSSTKEFKEALAD 276

Query: 303 AVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLSH 355
            ++ EI PI ++I+ L+ D  Y++ ++  G++ AR  A + +  V  IVGL+ 
Sbjct: 277 LLVREISPIRERIRELVCDTPYMNKVMAAGSDAARALASKHIAEVKRIVGLTQ 329


>gi|15604331|ref|NP_220847.1| tryptophanyl-tRNA synthetase [Rickettsia prowazekii str. Madrid E]
 gi|6226203|sp|Q9ZD76|SYW_RICPR RecName: Full=Tryptophanyl-tRNA synthetase; AltName:
           Full=Tryptophan--tRNA ligase; Short=TrpRS
 gi|3861023|emb|CAA14923.1| TRYPTOPHANYL-TRNA SYNTHETASE (trpS) [Rickettsia prowazekii]
 gi|292572084|gb|ADE29999.1| Tryptophanyl-tRNA synthetase [Rickettsia prowazekii Rp22]
          Length = 330

 Score =  275 bits (704), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 159/345 (46%), Positives = 215/345 (62%), Gaps = 22/345 (6%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQ TG LHLGNYLG IRN I+ QE  N    +F+ADLHAIT +I    L       +
Sbjct: 6   LSGVQTTGALHLGNYLGSIRNWIKMQEEYN--CFFFLADLHAITIDIKTSELNDAIMEVL 63

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LAAG++P +  IF QS V  H +LSW+L+CV  +GW+  M QFK+K+  + +  A L
Sbjct: 64  AIYLAAGLNPDKVTIFAQSMVKEHVELSWLLNCVTPLGWLKRMTQFKDKAG-SAQCKACL 122

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GLF YP+LMAADIL+Y+A  VPVGEDQ+QHLE+TR IA+  N  F+++I +V        
Sbjct: 123 GLFAYPILMAADILIYKADIVPVGEDQKQHLELTRDIAEVINRRFDKEILKV-------- 174

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                  P I  LI  + +RI SLR+  KKMSKSD SDFSRINL D+ D+I +KI+KAKT
Sbjct: 175 -------PDI--LISETGTRIMSLRNGLKKMSKSDISDFSRINLKDSNDLIHQKIKKAKT 225

Query: 249 DGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
           D     S     + R E  NL++I+ +  +  IE+ +  +  + F++FK  LA+ +I  +
Sbjct: 226 DHLSFIS--YNKKTRPEISNLLDIYKSFSKESIEKIIDNYQNQGFAKFKEDLAEIIITNL 283

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            PI  K   L+ DK YL  IL +GA +AR RA ET+  V +  G 
Sbjct: 284 QPIRNKCLELMNDKEYLLKILHKGAQKARIRASETVNEVKKQFGF 328


>gi|298706521|emb|CBJ29491.1| tryptophanyl-tRNA synthetase [Ectocarpus siliculosus]
          Length = 399

 Score =  275 bits (702), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 149/351 (42%), Positives = 212/351 (60%), Gaps = 27/351 (7%)

Query: 8   FVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
            VSGVQPTG LH GNYLG I+  +  Q+  ++   +F+ DLHAIT     +NL+      
Sbjct: 66  IVSGVQPTGNLHFGNYLGAIKQWVDNQDKYDNF--FFVVDLHAITVPQDPKNLKAGVINA 123

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A++LAAG+DP ++ +F QS VG HA+L+W+L+C   + W+  MIQFKEK K  + E   
Sbjct: 124 AATYLAAGIDPEKSKVFVQSHVGAHAELTWLLTCATPINWLEKMIQFKEK-KTKQGENVG 182

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
            GL  YPVLMA+DILLYR   VPVGEDQRQHLE+TR +A+RFN +F ++ ++        
Sbjct: 183 TGLLTYPVLMASDILLYRPDLVPVGEDQRQHLELTRDLARRFNDQFCKRRRKT------- 235

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F   + LI    +R+ SL D + KMSKSD  + SRINL D+PD+IAKK+++ K
Sbjct: 236 -------FKDPQALIVKEGARVMSLTDGTSKMSKSDPVEGSRINLTDSPDVIAKKLRRCK 288

Query: 248 TDGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           TD         GLE    +R E  NL+ I+  +     EE   + G  ++  FK  LADA
Sbjct: 289 TDMH------QGLEWDNPDRPECTNLLTIYQAVTGKTREEVSLEVGDMSWGTFKPLLADA 342

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
            +E + P+  + + +L+D+SYL+ +L +GA  A   A ET+ +  E +G+S
Sbjct: 343 TVEHLRPLQARYKDILEDRSYLNKVLRDGAEAADEVASETLGWAKEAMGIS 393


>gi|190570941|ref|YP_001975299.1| tryptophanyl-tRNA synthetase [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213019456|ref|ZP_03335262.1| tryptophanyl-tRNA synthetase [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|190357213|emb|CAQ54630.1| tryptophanyl-tRNA synthetase [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212994878|gb|EEB55520.1| tryptophanyl-tRNA synthetase [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 332

 Score =  275 bits (702), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 148/346 (42%), Positives = 213/346 (61%), Gaps = 24/346 (6%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF-- 67
           SG+QP+GVLHLGNYLG I+  I  Q+   +  ++ + DLHAIT N +  N   ++ +F  
Sbjct: 7   SGIQPSGVLHLGNYLGAIKQWIGLQD--KYKSLFCVVDLHAITANKLPAN-ELKNNIFKA 63

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A+++A G+DP ++IIF QS V  HA+L W+L C   +GW+N M QFK+K+  ++++ AS
Sbjct: 64  AATYIACGIDPEKSIIFNQSAVSGHAELGWLLGCYTPIGWLNRMTQFKDKAGSDRQK-AS 122

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           LGL+ YPVLMAADILLY+  +VPVG+DQ+QHLE+ R IA  FN                 
Sbjct: 123 LGLYSYPVLMAADILLYQTKYVPVGDDQKQHLELARDIASAFNN---------------- 166

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
             Y    F I E L     SRI SLRD + KMSKSDSS++S INL D  D+I KKI+KAK
Sbjct: 167 -HYKCSHFIIPEILTLDCTSRIMSLRDGASKMSKSDSSEYSCINLDDTDDLIVKKIEKAK 225

Query: 248 TDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
           TD  +L  + + L+ R E  NL+ +++ +  + +E+  ++    +   FK  LAD +I  
Sbjct: 226 TDS-ILGFDFATLKCRPEVNNLVNVYSVLSDLNVEKVCEEVNKHDMKHFKKELADLIISV 284

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           I PI +K+  LL+D+ +L  IL EG  +A   A   +K + +I+G 
Sbjct: 285 ISPIREKLNGLLRDQLHLHKILKEGTEKAAEIANNNIKKIKDIIGF 330


>gi|302773305|ref|XP_002970070.1| hypothetical protein SELMODRAFT_92189 [Selaginella moellendorffii]
 gi|300162581|gb|EFJ29194.1| hypothetical protein SELMODRAFT_92189 [Selaginella moellendorffii]
          Length = 358

 Score =  273 bits (699), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 153/351 (43%), Positives = 214/351 (60%), Gaps = 18/351 (5%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           VSGVQPTG +HLGNYLG I+N I  QE  +    +F+ DLHAIT   V E L   ++   
Sbjct: 18  VSGVQPTGTIHLGNYLGAIKNWIELQELYDT--YFFVVDLHAITLPHVPEELLKATKAAA 75

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA GVDPS+  +F QS V  HA+L+W+LSCV  + W+N MIQFKEKS+   E+  + 
Sbjct: 76  AMYLACGVDPSKAAMFVQSHVKAHAELTWLLSCVTPISWLNKMIQFKEKSRRQGEDVGT- 134

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEF-ERKIKEVAQKYAQE 187
           GL  YP+LMA+DILLY+   VPVG+DQRQHLE+TR +A+R N+ +  RK K    K    
Sbjct: 135 GLLTYPLLMASDILLYQTDLVPVGDDQRQHLELTRDVAERINSTYGGRKWK----KLGGP 190

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
              SK  F + E LI  + +RI SL D + KMSKS +SD SRIN+LD  D IA KI++ K
Sbjct: 191 TLSSKKMFQVPEALIPKTGARIMSLTDGTSKMSKSAASDQSRINMLDTRDDIAYKIKRCK 250

Query: 248 TDGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           TD       ++G+E     R E  NL+ ++  +     +E   +     +  FK+ L DA
Sbjct: 251 TDS------LTGMEFDNPERPECSNLLSVYQLVSGKSRQEVEAECKDLTWGAFKILLTDA 304

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
           ++E + PI +    ++ D+SYLD +L +GA +A   A+ T+  + E +G +
Sbjct: 305 LVEHLDPIQKSYTEVMSDESYLDQVLCDGAAKANAIAKRTLTDLYEAMGFA 355


>gi|51473655|ref|YP_067412.1| tryptophanyl-tRNA synthetase [Rickettsia typhi str. Wilmington]
 gi|81610790|sp|Q68WR2|SYW_RICTY RecName: Full=Tryptophanyl-tRNA synthetase; AltName:
           Full=Tryptophan--tRNA ligase; Short=TrpRS
 gi|51459967|gb|AAU03930.1| L-tryptophan-tRNATrp ligase (AMP-forming) [Rickettsia typhi str.
           Wilmington]
          Length = 330

 Score =  273 bits (699), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 155/345 (44%), Positives = 218/345 (63%), Gaps = 22/345 (6%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQ TG LHLGNYLG I+N ++ QE  N    +F+ADLHAIT +I    L       +
Sbjct: 6   LSGVQTTGALHLGNYLGSIKNWVKMQEEYN--CFFFLADLHAITIDIKTSELNNSIMEVL 63

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LAAG++P +  IF QS V  HA+LSW+L+CV  +GW+  M QFK+K+  ++ + A L
Sbjct: 64  AIYLAAGLNPDKVTIFAQSMVKEHAELSWLLNCVTPLGWLKRMTQFKDKAGSDQCK-ACL 122

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GLF YP+LMAADIL+Y+A  VPVGEDQ+QHLE+TR IA+  N  F+++I +V        
Sbjct: 123 GLFAYPILMAADILIYKADIVPVGEDQKQHLELTRDIAEVINRRFDKEILKV-------- 174

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                  P I  LI  + +RI SLR+  KKMSKSD +DFSRINL D+ D+I +KI+KAKT
Sbjct: 175 -------PDI--LISETGTRIMSLRNGLKKMSKSDIADFSRINLKDSNDLIYQKIKKAKT 225

Query: 249 DGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
           D     S     + R E  NL++I+ ++ +  +E+ +  +  + F++FK  LA+ +I  +
Sbjct: 226 DHLSFIS--YDKKTRPEISNLLDIYKSLSKESMEKIINNYQNQGFAKFKEDLAEIIITNL 283

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            PI  K   L+ DK YL  IL +GA +A+ RA ET+  V +  G 
Sbjct: 284 QPIRDKCLELMNDKEYLLKILHKGAEKAKIRASETVNEVKKQFGF 328


>gi|302843547|ref|XP_002953315.1| hypothetical protein VOLCADRAFT_63500 [Volvox carteri f.
           nagariensis]
 gi|300261412|gb|EFJ45625.1| hypothetical protein VOLCADRAFT_63500 [Volvox carteri f.
           nagariensis]
          Length = 393

 Score =  273 bits (697), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 150/349 (42%), Positives = 209/349 (59%), Gaps = 19/349 (5%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQPTG   LGNYLG ++N +  QE  ++   + + DLHAIT       LR  +R   
Sbjct: 51  LSGVQPTGRPTLGNYLGAMKNWVALQEQYDNF--FCVVDLHAITVPHDPRELRAATRSMA 108

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A+++AAG+DP R  IF QS V  H +L+W+LSCV  +GW+  MIQFKEKS++  E+  + 
Sbjct: 109 ATYIAAGIDPDRATIFVQSHVPAHTELAWLLSCVTPVGWLGRMIQFKEKSRKQGEDVRT- 167

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GL  YPVLMAADILLY+A  VPVGEDQ+QHLE+TR IA++ N EF  K  +         
Sbjct: 168 GLMTYPVLMAADILLYQADLVPVGEDQKQHLELTRDIAEKVNLEFGGKGWKKRGGRGGR- 226

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                 F + E  +  + +RI SL+D + KMSKS  +D SRINL D+P++IA KI++ KT
Sbjct: 227 -----VFKVPEVFLPPAGARIMSLQDGTAKMSKSAENDNSRINLTDSPEVIAAKIKRCKT 281

Query: 249 DGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           D       V GLE    +R EA NL+ I++       +E + +     +  FK  LADA+
Sbjct: 282 D------TVEGLEWGNTDRPEATNLLAIYSLCTGKSKDEVVSECASMRWGTFKPLLADAI 335

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           IE + P+  K   L+ D+SY+D +L +GA  A   A  T+  V + +G 
Sbjct: 336 IEHLKPLQVKYGELMSDQSYIDAVLAKGAEAASATADRTLADVRDAMGF 384


>gi|255081788|ref|XP_002508116.1| predicted protein [Micromonas sp. RCC299]
 gi|226523392|gb|ACO69374.1| predicted protein [Micromonas sp. RCC299]
          Length = 389

 Score =  271 bits (692), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 154/354 (43%), Positives = 216/354 (61%), Gaps = 18/354 (5%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQ-ENLRYQSRLF 67
           +SGVQPTG +HLGNY G I+N ++ QE  +    Y + DLHAIT      + L   +R  
Sbjct: 40  LSGVQPTGSIHLGNYFGAIKNWVKMQEEFD--AFYCVVDLHAITAGAHDPKELIKSTRSS 97

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A +LAAG+DP R+ +F QS V  H++L W+L+C   +GW+  MIQFKEK+++  E+  S
Sbjct: 98  AAIYLAAGLDPERSNVFVQSHVSAHSELCWLLNCATPIGWLEKMIQFKEKARKAGEDV-S 156

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEF-ERKIKEVAQK--Y 184
           +GL  YPVLMA+DILLY A  VPVGEDQRQHLE+TR IA R N  +   K K++  K   
Sbjct: 157 VGLLDYPVLMASDILLYNADIVPVGEDQRQHLELTRDIAGRVNNLYGGGKWKKMGPKGSR 216

Query: 185 AQEEQYSKG-FFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
           A   ++  G    + +  I  + +R+ SL D S KMSKS+ ++ SRIN+LD PD IAKKI
Sbjct: 217 APSGRFRGGDILRVPDAYIPEAGARVMSLTDGSAKMSKSNPAEGSRINVLDTPDEIAKKI 276

Query: 244 QKAKTDGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLA 299
           ++ KTD       V GLE     R EA NL+ I+     +  EE LK+ G   +  FK A
Sbjct: 277 KRCKTDA------VEGLEFGDPTRPEATNLLTIYQLCTGMTKEEVLKECGSMRWGDFKPA 330

Query: 300 LADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           L DAV+E + PI  +   +++++ YLD +L  GA+ A   A++T+  V + +G 
Sbjct: 331 LTDAVVEHLSPIQARYAEIMQEEGYLDGVLKRGADAANEVAEKTVADVRDAMGF 384


>gi|88607522|ref|YP_504669.1| tryptophanyl-tRNA synthetase [Anaplasma phagocytophilum HZ]
 gi|88598585|gb|ABD44055.1| tryptophanyl-tRNA synthetase [Anaplasma phagocytophilum HZ]
          Length = 331

 Score =  271 bits (692), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 152/351 (43%), Positives = 211/351 (60%), Gaps = 27/351 (7%)

Query: 7   LFVSGVQPTG-VLHLGNYLGMIRNVIRRQET--CNHLGMYFIADLHAITNNIVQE-NLRY 62
           +  S VQP+G  LHLGNYLG ++  +  Q+   C    ++ I D+HA+T+   +  ++R 
Sbjct: 1   MIFSAVQPSGGSLHLGNYLGAVKKWVALQDAGKC----VFCIVDMHALTSGSAETLSIRA 56

Query: 63  QSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENK 122
            +   +AS++A G+DP++ ++F QS V  HA+L WIL C+  +GW+N M QFK+KS+ + 
Sbjct: 57  NTLSLLASYIACGIDPAKAVVFLQSSVPEHAELCWILGCLTPVGWLNRMTQFKDKSRSDS 116

Query: 123 EETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQ 182
              A+LGL+ YPVLMAADILLY+A  VPVG DQ+QHLE+ + IA+ FNT           
Sbjct: 117 YR-ANLGLYSYPVLMAADILLYKADLVPVGNDQKQHLELAQSIARTFNT----------- 164

Query: 183 KYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKK 242
                  Y   FF I E +   SA+RI SL+  +KKMSKSD SDFSRINL D+ D+IA K
Sbjct: 165 ------IYGVDFFCIPEAMPFDSAARIMSLKTGTKKMSKSDPSDFSRINLSDDNDVIALK 218

Query: 243 IQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALAD 302
           I+KA TD         GL  R E  NL+ IFA +   +  E   +F   +   FK AL +
Sbjct: 219 IKKATTDS-ATGFCYGGLNQRPEVNNLVNIFAALSDSEPREVCVRFTNSSNKDFKDALTE 277

Query: 303 AVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            +IE I PI  K + LL D  YL++IL  G  +AR  A + ++ V EI+GL
Sbjct: 278 LLIERISPIRTKTRELLDDPGYLNSILSSGNEQARSIAGKNLREVKEIIGL 328


>gi|225429361|ref|XP_002273029.1| PREDICTED: similar to putative tryptophanyl-tRNA synthetase [Vitis
           vinifera]
 gi|296081565|emb|CBI20570.3| unnamed protein product [Vitis vinifera]
          Length = 416

 Score =  271 bits (692), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 154/350 (44%), Positives = 207/350 (59%), Gaps = 20/350 (5%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           VSGVQPTG +HLGNYLG I+N I  Q T +    +FI DLHAIT     + L   +R   
Sbjct: 79  VSGVQPTGTIHLGNYLGAIKNWIPLQNTYDTF--FFIVDLHAITLPYETQQLFKATRDTA 136

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA GVD S+  +F QS V  H++L W+LS    +GW+N MIQFKEKS++  +E   +
Sbjct: 137 AIYLACGVDTSKASVFVQSHVRAHSELMWLLSSATPIGWLNKMIQFKEKSRKVGDENVGV 196

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEF-ERKIKEVAQKYAQE 187
            L  YPVLMA+DILLY++  VPVGEDQ+QHLE+TR +A+R N  +  RK K++  +    
Sbjct: 197 ALLTYPVLMASDILLYQSDFVPVGEDQKQHLELTRELAERVNYLYGGRKWKKLGGR---- 252

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F + E LI    +R+ SL D   KMSKS SSD SRINLLD  D+IA KI++ K
Sbjct: 253 ---GGAIFKVPEPLIPPEGARVMSLTDGCSKMSKSASSDQSRINLLDPKDVIANKIKRCK 309

Query: 248 TDGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           TD         GLE     R E  NL+ I+  M     EE  ++  G N+  FK  L DA
Sbjct: 310 TD------SFPGLEFDNPERPECNNLLTIYQLMSGRTKEEVAQECQGMNWGVFKRILTDA 363

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           +I+ + PI  + + ++ D +YLD +L EGA +A   A  T+  V + +G 
Sbjct: 364 LIDHLHPIQVRYEEIMSDSAYLDRLLAEGATKAADIADATLNNVYQAMGF 413


>gi|325182959|emb|CCA17414.1| unnamed protein product [Albugo laibachii Nc14]
          Length = 376

 Score =  270 bits (689), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 156/357 (43%), Positives = 215/357 (60%), Gaps = 32/357 (8%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQ-ETCNHLG----MYFIADLHAITNNIVQE 58
           S N  +SG+QPTG+ HLGNY G I +  + Q E  N L     M+ I DLHAIT     +
Sbjct: 41  SCNRILSGIQPTGIPHLGNYCGAISHWAKFQKENKNGLKRSDLMFTIVDLHAITVPYDPK 100

Query: 59  NLRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKS 118
           N++ + R  +A+ LA G+DP +  +FKQSD+  HADLSW L C+  + W+  M Q+K K+
Sbjct: 101 NMQSRVRDTLATLLAVGLDPLKCTMFKQSDILLHADLSWRLGCITPLKWLQRMTQYKCKT 160

Query: 119 KENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIK 178
            E +++ A  GL  YP+LMAADILLYRAT VPVG+DQ+QHLE+ R+IA  FN  F+  + 
Sbjct: 161 -EQQQKDADFGLLAYPILMAADILLYRATLVPVGDDQQQHLELARMIATAFNHRFKCSL- 218

Query: 179 EVAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDI 238
                          F P +  L +    RI SLRDASKKMSKSD S ++RINL D+  +
Sbjct: 219 ---------------FDPPMPHLSEHEMCRIMSLRDASKKMSKSDPSAWARINLNDSEKM 263

Query: 239 IAKKIQKAKTDGDVLPSEVSGLE-NRLEAK---NLIEIFATMRQIKIEEALKQFGGKNFS 294
           I KKI KA++DG      +SG+  N+LE     NL+ I + + +  I   + Q+     S
Sbjct: 264 IQKKISKAQSDG------ISGITFNKLERPAISNLLSILSAVTESTIPSLVSQYENYQTS 317

Query: 295 QFKLALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIV 351
            FK  +ADAVI +I PI ++I+   KD  YLDT+L  GA++A   A ETM  V +++
Sbjct: 318 AFKKVVADAVISKISPIRRRIREYQKDSGYLDTVLENGASKASIIAAETMDRVRKVM 374


>gi|42520639|ref|NP_966554.1| tryptophanyl-tRNA synthetase [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|42410378|gb|AAS14488.1| tryptophanyl-tRNA synthetase [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 332

 Score =  269 bits (687), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 149/351 (42%), Positives = 212/351 (60%), Gaps = 26/351 (7%)

Query: 6   NLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSR 65
           ++  SG+QP+GVLHLGNYLG I+  I  Q+   +  ++ I DLHAIT N +  +   +S 
Sbjct: 3   SIVFSGIQPSGVLHLGNYLGAIKQWIDLQD--KYKSLFCIVDLHAITANKLPAS-ELKSN 59

Query: 66  LF--VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           +F   A+++A G+DP ++IIF QS V  HA+L W+L C   +GW+N M QFK+K+  +K+
Sbjct: 60  IFKTAAAYIACGIDPEKSIIFNQSTVSGHAELGWLLGCYTPIGWLNRMTQFKDKAGSDKQ 119

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
           + ASLGL+ YPVLMAADILLY+  +VPVG+DQ+QHLE+ R IA  FN             
Sbjct: 120 K-ASLGLYSYPVLMAADILLYQTKYVPVGDDQKQHLELARDIASAFNN------------ 166

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
                 Y    F + E L     SRI SLRD + KMSKSD S+ S INL D  D+I KKI
Sbjct: 167 -----HYKLDHFIVPEILTLDCTSRIMSLRDGTSKMSKSDPSEHSCINLDDTDDLIVKKI 221

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           +KAKTD  +     + LE R E  NLI I++ +  + +++  ++    +   FK  LAD 
Sbjct: 222 EKAKTDSIL---GFATLECRPEISNLINIYSVLSNVNVKKVCEEVNKHDMKHFKKELADL 278

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
           +I  I PI +K+  LLKD+ +L  IL +G  +A   A   +K + +I+G +
Sbjct: 279 IISIISPIREKMNDLLKDQFHLHEILKKGTKKAAEIATHNIKEIKDIIGFA 329


>gi|307153410|ref|YP_003888794.1| tryptophanyl-tRNA synthetase [Cyanothece sp. PCC 7822]
 gi|306983638|gb|ADN15519.1| tryptophanyl-tRNA synthetase [Cyanothece sp. PCC 7822]
          Length = 336

 Score =  268 bits (686), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 149/349 (42%), Positives = 205/349 (58%), Gaps = 27/349 (7%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQPTG LHLGNYLG IRN +  Q   ++   + + DLHAIT     + L + +    
Sbjct: 7   LSGVQPTGNLHLGNYLGAIRNWVDLQHEYDNF--FCVVDLHAITVPHDPKKLAHDTYNIA 64

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+D   + IF QS V  H++L+W+L+C+  + W+  MIQFKEK+K+ + E   +
Sbjct: 65  ALYLACGIDLQYSTIFVQSHVSAHSELTWLLNCITPLNWLERMIQFKEKAKK-QGENVGV 123

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GL  YPVLMAADILLY A  VPVGEDQ+QHLE+TR IA R N +F    + V +      
Sbjct: 124 GLLDYPVLMAADILLYDADKVPVGEDQKQHLELTRDIAARINDQFGSPTQPVLK------ 177

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                   + E LI    +R+ SL D + KMSKSD SD SRINLLD P++I KKI++ KT
Sbjct: 178 --------VPEPLIRKEGARVMSLTDGTSKMSKSDPSDMSRINLLDPPELIEKKIKRCKT 229

Query: 249 DGDVLPSEVSGL----ENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           D       V GL      R E  NL+ ++A +     EE   + G   + QFK  L +AV
Sbjct: 230 D------PVRGLTFDDPERPECNNLLNLYAILSGKTKEEVATECGDLGWGQFKPLLTEAV 283

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           I  + PI +K   ++ D+ YLD++L EG ++A   A +T+  V E +G 
Sbjct: 284 INSLSPIQEKYTEIINDRGYLDSVLREGRHKANLVAHQTLTRVKEALGF 332


>gi|73666743|ref|YP_302759.1| tryptophanyl-tRNA synthetase [Ehrlichia canis str. Jake]
 gi|72393884|gb|AAZ68161.1| tryptophanyl-tRNA synthetase [Ehrlichia canis str. Jake]
          Length = 333

 Score =  268 bits (686), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 155/350 (44%), Positives = 223/350 (63%), Gaps = 22/350 (6%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQE-NLRY 62
           S  + +SG+QPTG +HLGNYLG IRN +  Q +  +   +F+ADLH +T+       L+ 
Sbjct: 2   STPIALSGIQPTGSIHLGNYLGSIRNWVSLQNS--YKCFFFLADLHTLTSQSYNPAELKQ 59

Query: 63  QSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENK 122
            S   +A++LA G+DP+++++F QS +  H++L WILSC+   G +N M QFKEKS+ NK
Sbjct: 60  NSINTLATYLACGIDPNKSVLFIQSSINAHSELLWILSCITSTGQLNRMTQFKEKSR-NK 118

Query: 123 EETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQ 182
              + LGL+ YPVLMAADIL+Y+A  VPVG DQ+QHLE+TR IA  FN+           
Sbjct: 119 ASASCLGLYSYPVLMAADILIYKANIVPVGVDQKQHLELTRDIAISFNST---------- 168

Query: 183 KYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKK 242
                  Y+  +F I E LI   +++I SLR+  KKMSKSDSSDF+RINL D+ D+I+KK
Sbjct: 169 -------YNTQYFQIPEPLIVQESAKIMSLRNGKKKMSKSDSSDFTRINLYDSNDMISKK 221

Query: 243 IQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALAD 302
           I KA TD  ++  + + L++R E KNL+ I+AT+  I IE+A       +  QFK  LA+
Sbjct: 222 ISKATTDS-IMGFDFNTLDSRPEVKNLVSIYATLLNINIEQACANIENLDTKQFKEQLAE 280

Query: 303 AVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVG 352
            +I  + PI QK++  L+D+ +L  I+V G N+A   A + +  + EIVG
Sbjct: 281 LIISNVAPIQQKVKEFLEDQEHLHNIIVSGNNKAASIANKHILEIKEIVG 330


>gi|225631095|ref|ZP_03787824.1| tryptophanyl-tRNA synthetase [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
 gi|225591210|gb|EEH12363.1| tryptophanyl-tRNA synthetase [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
          Length = 332

 Score =  268 bits (686), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 149/351 (42%), Positives = 212/351 (60%), Gaps = 26/351 (7%)

Query: 6   NLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSR 65
           ++  SG+QP+GVLHLGNYLG I+  I  Q+   +  ++ I DLHAIT N +  +   +S 
Sbjct: 3   SIVFSGIQPSGVLHLGNYLGAIKQWIDLQD--KYKSLFSIVDLHAITANKLPAS-ELKSN 59

Query: 66  LF--VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           +F   A+++A G+DP ++IIF QS V  HA+L W+L C   +GW+N M QFK+K+  +K+
Sbjct: 60  IFKTAAAYIACGIDPEKSIIFSQSTVSGHAELGWLLGCYTPIGWLNRMTQFKDKAGSDKQ 119

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
           + ASLGL+ YPVLMAADILLY+  +VPVG+DQ+QHLE+ R IA  FN             
Sbjct: 120 K-ASLGLYSYPVLMAADILLYQTKYVPVGDDQKQHLELARDIASAFNN------------ 166

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
                 Y   +F + E L     SRI SLRD + KMSKSD S+ S INL D  D+I KKI
Sbjct: 167 -----HYKLDYFIVPEILTLDCTSRIMSLRDGTSKMSKSDPSEHSCINLDDTDDLIVKKI 221

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           +KAKTD  +     + L+ R E  NLI I++ +  +  E+  ++    +   FK  LAD 
Sbjct: 222 EKAKTDSIL---GFATLKCRPEISNLINIYSVLSNVNAEKVCEEVNKHDMKHFKKELADL 278

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
           +I  I PI +K+  LLKD+ +L  IL +G  +A   A   +K + +I+G +
Sbjct: 279 IISVISPIREKMNDLLKDQFHLHEILKKGTKKAAEIATHNIKEIKDIIGFA 329


>gi|224075399|ref|XP_002304617.1| predicted protein [Populus trichocarpa]
 gi|222842049|gb|EEE79596.1| predicted protein [Populus trichocarpa]
          Length = 403

 Score =  268 bits (686), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 151/346 (43%), Positives = 206/346 (59%), Gaps = 12/346 (3%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           VSGVQPTG +HLGNYLG I+N I  Q T   L  +FI DLHAIT     + L   +R   
Sbjct: 66  VSGVQPTGSVHLGNYLGAIKNWIALQNTYETL--FFIVDLHAITLPYDTKELSKATRDTA 123

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+D S+  +F QS V  H +L W+LS    +GW+N MIQFKEKS++  +E   +
Sbjct: 124 AIYLACGIDASKASVFVQSHVHAHVELMWLLSSATPIGWLNRMIQFKEKSRKAGDENVGV 183

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEF-ERKIKEVAQKYAQE 187
            L  YPVLMA+DILLY++  VPVGEDQ+QHLE+TR +A+R N  +  RK K++  +    
Sbjct: 184 ALLTYPVLMASDILLYQSDFVPVGEDQKQHLELTRELAERVNYLYGGRKWKKLGGR---- 239

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F + E LI  + +R+ SL D   KMSKS  SD SRINLLD  D+IA KI++ K
Sbjct: 240 ---GGAIFKVPEPLIPPAGARVMSLTDGLSKMSKSAPSDQSRINLLDPKDVIANKIKRCK 296

Query: 248 TDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
           TD    P+       R E  NL+ ++  +     E+  K+  G N+  FK  L DA+IE 
Sbjct: 297 TDS--FPALEFDNPERPECNNLLSVYQLVSGKTKEDVAKECQGLNWGSFKPLLTDALIEH 354

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + PI  + + +  D +YLD++L EGA +A   A  T+K V + +G 
Sbjct: 355 LHPIQVRYEEIHSDSAYLDSVLEEGARKASEIADATLKNVYQAMGF 400


>gi|68171298|ref|ZP_00544698.1| Tryptophanyl-tRNA synthetase, class Ib [Ehrlichia chaffeensis str.
           Sapulpa]
 gi|88658497|ref|YP_506992.1| tryptophanyl-tRNA synthetase [Ehrlichia chaffeensis str. Arkansas]
 gi|67999279|gb|EAM85928.1| Tryptophanyl-tRNA synthetase, class Ib [Ehrlichia chaffeensis str.
           Sapulpa]
 gi|88599954|gb|ABD45423.1| tryptophanyl-tRNA synthetase [Ehrlichia chaffeensis str. Arkansas]
          Length = 333

 Score =  268 bits (686), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 155/347 (44%), Positives = 220/347 (63%), Gaps = 22/347 (6%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAIT-NNIVQENLRYQSR 65
           + +SG+QP+G +HLGNYLG IRN +  Q +  +   +F+ADLH +T NN     L+  S 
Sbjct: 5   IVLSGIQPSGGIHLGNYLGSIRNWVSLQSS--YKCFFFLADLHTLTSNNYNSAELKQNSI 62

Query: 66  LFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEET 125
             +A++LA G+DP+++++F QS +  HA+L WI SC+   G +N M QFKEKS+ NK  T
Sbjct: 63  NTLATYLACGIDPNKSVLFVQSSIHAHAELLWIFSCITSTGQLNRMTQFKEKSR-NKVST 121

Query: 126 ASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYA 185
           A LGL+ YPVLMAADIL+Y+A  VPVG DQ+QHLE+TR IA  FN+              
Sbjct: 122 ACLGLYSYPVLMAADILIYKANIVPVGIDQKQHLELTRDIAMNFNS-------------- 167

Query: 186 QEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQK 245
               Y+  +F I E LI   +++I +LR+  KKMSKSDSSD++RINL D+ D+I+KKI K
Sbjct: 168 ---TYNTQYFQIPEPLIMQESAKIMNLRNGKKKMSKSDSSDYTRINLYDSNDVISKKISK 224

Query: 246 AKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVI 305
           A TD  ++    S L++R E KNL+ I+AT+  I IE+A       +  QFK  L + +I
Sbjct: 225 ATTDS-IVGFNFSTLDSRPEVKNLVSIYATLLNINIEQACTNIENFSTKQFKEQLTELLI 283

Query: 306 EEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVG 352
           + I PI  K+   L+DK +L  I+V G N+A   A + +  + EI+G
Sbjct: 284 DNIAPIRHKVTEFLEDKEHLHNIIVSGNNKAASIANKHILEIKEIIG 330


>gi|222474751|ref|YP_002563166.1| tryptophanyl-tRNA synthetase (trpS) [Anaplasma marginale str.
           Florida]
 gi|255002720|ref|ZP_05277684.1| tryptophanyl-tRNA synthetase (trpS) [Anaplasma marginale str.
           Puerto Rico]
 gi|222418887|gb|ACM48910.1| tryptophanyl-tRNA synthetase (trpS) [Anaplasma marginale str.
           Florida]
          Length = 329

 Score =  268 bits (684), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 146/351 (41%), Positives = 212/351 (60%), Gaps = 28/351 (7%)

Query: 7   LFVSGVQPTG-VLHLGNYLGMIRNVIRRQ--ETCNHLGMYFIADLHAIT-NNIVQENLRY 62
           +  SG+QP+G V HLGNYLG IR  +  Q  + C    ++ + DLHA+T  N     L  
Sbjct: 1   MIFSGIQPSGGVPHLGNYLGAIRRWVGLQGSDQC----LFCVVDLHALTAGNAATATLHS 56

Query: 63  QSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENK 122
           ++   +A+++A G+DP ++++F QS V  H++L WIL CV  MGW+N M QFK+KS+   
Sbjct: 57  RAISLLATYIACGIDPEKSVLFVQSSVPEHSELCWILGCVTPMGWLNRMTQFKDKSRSG- 115

Query: 123 EETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQ 182
             T ++GL+ YPVLMAADILLY+AT VPVG+DQ QH+E+T+ IA+ FN            
Sbjct: 116 -STPNMGLYGYPVLMAADILLYKATLVPVGDDQMQHIELTQDIARAFNA----------- 163

Query: 183 KYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKK 242
                  +   +FP+   L   S++RI SLRD  KKMSKSD+SD +RINL D+ D I +K
Sbjct: 164 ------MHKVDYFPVPRPLSLDSSARIMSLRDGKKKMSKSDASDAARINLDDDDDSIVQK 217

Query: 243 IQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALAD 302
           I +A TD  +    + GL+ R E  NL+ IFA +  +   E   +F      +FK ALA 
Sbjct: 218 IMRATTD-SIRGLSLEGLDERPEMHNLVNIFAALSGMTKAEVCNEFAASGTKEFKEALAG 276

Query: 303 AVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            ++ EI PI +KI+ L++D +Y+D I+  G   AR  A + +  + +I+GL
Sbjct: 277 LLVREISPIREKIRELVRDVAYVDKIIATGNGAARELAGKHIVEIKKIIGL 327


>gi|58584791|ref|YP_198364.1| tryptophanyl-tRNA synthetase [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
 gi|58419107|gb|AAW71122.1| Tryptophanyl-tRNA synthetase [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
          Length = 332

 Score =  267 bits (683), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 147/346 (42%), Positives = 211/346 (60%), Gaps = 24/346 (6%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF-- 67
           SG QP+GVLHLGNYLG I+  +  Q+   +  ++ I DL+AIT N +  +   +S +F  
Sbjct: 7   SGTQPSGVLHLGNYLGAIKQWVTLQD--KYKSIFCIVDLYAITANKLSAS-ELKSNIFKT 63

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A+++A G+DP ++IIF QS +  H +LSW+L C   +GW+N M QFK+K+  +K++ AS
Sbjct: 64  AAAYIACGIDPEKSIIFNQSTISSHTELSWLLGCYTPVGWLNRMTQFKDKAGSDKQK-AS 122

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           LGL+ YPVLMAADILLYR  +VPVG+DQ+QHLE+ R IA  FN                 
Sbjct: 123 LGLYSYPVLMAADILLYRTKYVPVGDDQKQHLELARDIALAFNN---------------- 166

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
             Y  G F I E L+   ASRI SLRD + KMSKS  S++S INL D  D+I KK+ KAK
Sbjct: 167 -HYKLGHFVIPEILVLDHASRIMSLRDGTSKMSKSPPSEYSCINLDDTDDLIVKKVGKAK 225

Query: 248 TDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
           TD  +L  + + L+ R E  NLI I++ +  + +++  ++    +   FK  LAD +I  
Sbjct: 226 TDS-ILGFDFATLKCRPEISNLINIYSVLSNLDVDKVCEEMNKYDMQHFKGELADLIISV 284

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           I PI ++I  LLKD+S+L  +L +G  +A       +K +  I+G 
Sbjct: 285 ISPIREEINDLLKDQSHLYRVLKKGTEKAAEIVGHNIKEIKNIIGF 330


>gi|91205605|ref|YP_537960.1| tryptophanyl-tRNA synthetase [Rickettsia bellii RML369-C]
 gi|157827320|ref|YP_001496384.1| tryptophanyl-tRNA synthetase [Rickettsia bellii OSU 85-389]
 gi|122425560|sp|Q1RIE3|SYW_RICBR RecName: Full=Tryptophanyl-tRNA synthetase; AltName:
           Full=Tryptophan--tRNA ligase; Short=TrpRS
 gi|91069149|gb|ABE04871.1| Tryptophanyl-tRNA synthetase [Rickettsia bellii RML369-C]
 gi|157802624|gb|ABV79347.1| tryptophanyl-tRNA synthetase [Rickettsia bellii OSU 85-389]
          Length = 328

 Score =  266 bits (680), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 164/345 (47%), Positives = 223/345 (64%), Gaps = 24/345 (6%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQ TG LHLGNYLG IRN ++ QE  N    +F+ADLH+IT +I    L+      +
Sbjct: 6   LSGVQATGSLHLGNYLGSIRNWVKMQEEYN--CFFFLADLHSITVDIAPSELKRSVIETL 63

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LAAG+DP++  IF QS V  HA+L+W+L+CV  +GW+  M QFK+K+ +++E+ A L
Sbjct: 64  AIYLAAGLDPNKVTIFAQSMVKEHAELAWLLNCVTPLGWLKRMTQFKDKAGKDQEK-ACL 122

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GLF YPVLMAADIL+Y+A  VPVGEDQ+QHLE+TR IA   N +F ++I +V        
Sbjct: 123 GLFSYPVLMAADILIYKADIVPVGEDQKQHLELTRDIAGVINRKFNKEILKVP------- 175

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                     E LI  S +RI SLRD SKKMSKSDSSDFSRINL D+ D+I +KI+KAKT
Sbjct: 176 ----------EVLIGGSGTRIMSLRDGSKKMSKSDSSDFSRINLRDDNDLIHQKIKKAKT 225

Query: 249 DGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
           D     S     E R E  NL++I+ T+ + K+E  ++ + G  F++FK  LA+ +I  +
Sbjct: 226 DHLSFVS--YDKEARPEISNLLDIYTTLSEEKLENIIQNYEG--FAKFKEDLAEIIITNL 281

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            P+  K   L+ D+ YL  IL +GA +AR RA ET+  + E  G 
Sbjct: 282 QPMRDKYLELMNDQEYLLKILHQGAEKARVRASETVNELKEQFGF 326


>gi|56416381|ref|YP_153455.1| tryptophanyl-tRNA synthetase [Anaplasma marginale str. St. Maries]
 gi|56387613|gb|AAV86200.1| tryptophanyl-tRNA synthetase [Anaplasma marginale str. St. Maries]
          Length = 329

 Score =  266 bits (680), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 146/351 (41%), Positives = 212/351 (60%), Gaps = 28/351 (7%)

Query: 7   LFVSGVQPTG-VLHLGNYLGMIRNVIRRQ--ETCNHLGMYFIADLHAIT-NNIVQENLRY 62
           +  SG+QP+G V HLGNYLG IR  +  Q  + C    ++ + DLHA+T  N     L  
Sbjct: 1   MIFSGIQPSGGVPHLGNYLGAIRRWVGLQGSDQC----LFCVVDLHALTAGNAATATLHS 56

Query: 63  QSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENK 122
           ++   +A+++A G+DP ++++F QS V  H++L WIL CV  MGW+N M QFK+KS+   
Sbjct: 57  RAISLLATYIACGIDPEKSVLFVQSSVPEHSELCWILGCVTPMGWLNRMTQFKDKSRSG- 115

Query: 123 EETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQ 182
             T ++GL+ YPVLMAADILLY+AT VPVG+DQ QH+E+T+ IA+ FN            
Sbjct: 116 -STPNMGLYGYPVLMAADILLYKATLVPVGDDQMQHIELTQDIARAFNA----------- 163

Query: 183 KYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKK 242
                  Y   +FP+ + L   S++RI SLRD  KKMSKSD+SD +RINL D+ D I +K
Sbjct: 164 ------MYKVDYFPVPKPLSLDSSARIMSLRDGKKKMSKSDASDAARINLDDDDDSIVQK 217

Query: 243 IQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALAD 302
           I +A TD  +    +  L+ R E  NL+ IFA +  +   E   +F      +FK ALA 
Sbjct: 218 IMRATTD-SIRGLSLEVLDERPEMHNLVNIFAALSGMTKAEVCNEFAASGTKEFKEALAG 276

Query: 303 AVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            ++ EI PI +KI+ L++D +Y+D I+  G   AR  A + +  + +I+GL
Sbjct: 277 LLVREISPIREKIRELVRDVAYVDKIIATGNGAARELAGKHIVEIKKIIGL 327


>gi|58696809|ref|ZP_00372338.1| tryptophanyl-tRNA synthetase [Wolbachia endosymbiont of Drosophila
           simulans]
 gi|225630518|ref|YP_002727309.1| tryptophanyl-tRNA synthetase [Wolbachia sp. wRi]
 gi|58536992|gb|EAL60144.1| tryptophanyl-tRNA synthetase [Wolbachia endosymbiont of Drosophila
           simulans]
 gi|225592499|gb|ACN95518.1| tryptophanyl-tRNA synthetase [Wolbachia sp. wRi]
          Length = 332

 Score =  265 bits (678), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 148/351 (42%), Positives = 211/351 (60%), Gaps = 26/351 (7%)

Query: 6   NLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSR 65
           ++  SG+QP+GVLHLGNYLG I+  I  Q+   +  ++ I DLHAIT N +  +   +S 
Sbjct: 3   SIVFSGIQPSGVLHLGNYLGAIKQWIDLQD--KYKSLFCIVDLHAITANKLPAS-ELKSN 59

Query: 66  LF--VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           +F   A+++A G+D  ++IIF QS V  HA+L W+L C   +GW+N M QFK+K+  +K+
Sbjct: 60  IFKTAAAYIACGIDTEKSIIFSQSTVSGHAELGWLLGCYTPIGWLNRMTQFKDKAGSDKQ 119

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
           + ASLGL+ YPVLMAADILLY+  +VPVG+DQ+QHLE+ R IA  FN             
Sbjct: 120 K-ASLGLYSYPVLMAADILLYQTKYVPVGDDQKQHLELARDIASAFNN------------ 166

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
                 Y   +F + E L     SRI SLRD + KMSKSD S+ S INL D  D+I KKI
Sbjct: 167 -----HYKLDYFIVPEILTLDCTSRIMSLRDGTSKMSKSDPSEHSCINLDDTDDLIVKKI 221

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           +KAKTD  +     + L+ R E  NLI I++ +  +  E+  ++    +   FK  LAD 
Sbjct: 222 EKAKTDSIL---GFATLKCRPEISNLINIYSVLSNVNAEKVCEEVNKHDMKHFKKELADL 278

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
           +I  I PI +K+  LLKD+ +L  IL +G  +A   A   +K + +I+G +
Sbjct: 279 IISVISPIREKMNDLLKDQFHLHEILKKGTKKAAEIATHNIKEIKDIIGFA 329


>gi|291570455|dbj|BAI92727.1| tryptophanyl-tRNA synthetase [Arthrospira platensis NIES-39]
          Length = 336

 Score =  265 bits (676), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 146/351 (41%), Positives = 207/351 (58%), Gaps = 27/351 (7%)

Query: 8   FVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
            +SGVQPTG LHLGNYLG IRN +  Q+  ++   + + DLHAIT       L   +   
Sbjct: 6   ILSGVQPTGNLHLGNYLGAIRNWVEGQKQYDNF--FCVVDLHAITVPHNPATLAADTYTI 63

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A +LA G+DP  + IF QS +  H++L+W+L+C+  + W+ +MIQFKEK+ + + E  S
Sbjct: 64  AALYLACGIDPEDSTIFVQSHISAHSELTWLLNCLTPINWLQDMIQFKEKAVK-QGENVS 122

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
            GL  YPVLMAADILLY A  VPVGEDQ+QHLE+TR IA RFN  F +  +E+ +     
Sbjct: 123 TGLLDYPVLMAADILLYDADRVPVGEDQKQHLELTRDIAGRFNHLFGQPDQEILK----- 177

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                    I E LI +  +R+ SL D +KKMSKSD S+ SRINLLD PD I KKI++ K
Sbjct: 178 ---------IPEPLIRTEGARVMSLTDGTKKMSKSDPSELSRINLLDPPDAIVKKIKRCK 228

Query: 248 TDGDVLPSEVSGL----ENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           TD       V GL     +R E  NL+ ++A +      +   +     + QFK  L + 
Sbjct: 229 TDS------VRGLAFDVPDRPECHNLLSLYALLSNQTKAQVAAECAEMGWGQFKPLLTET 282

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
            I  + PI ++ + ++ D+SYL++IL  G  +A+  A +T+  V + +G S
Sbjct: 283 AIAALTPIQERYKEVMSDRSYLESILRRGREQAQAVANQTLTRVKDALGYS 333


>gi|83313507|ref|YP_423771.1| tryptophanyl-tRNA synthetase [Magnetospirillum magneticum AMB-1]
 gi|82948348|dbj|BAE53212.1| Tryptophanyl-tRNA synthetase [Magnetospirillum magneticum AMB-1]
          Length = 268

 Score =  264 bits (674), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 139/282 (49%), Positives = 188/282 (66%), Gaps = 18/282 (6%)

Query: 72  LAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLGLF 131
           +AAGVDP+++I+F QS V  HA L+WI +CVARMGW+N M QFK+K+ ++KE  AS+GLF
Sbjct: 2   IAAGVDPAKHIVFNQSMVPAHAQLAWIFNCVARMGWLNRMTQFKDKAGKHKE-NASVGLF 60

Query: 132 MYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQYS 191
            YP LM+ADIL Y+ATHVPVGEDQ+QHLE+ R  AQ+FN +F  +               
Sbjct: 61  AYPNLMSADILTYKATHVPVGEDQKQHLELARDTAQKFNNDFGVE--------------- 105

Query: 192 KGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTDGD 251
             FFP+ E +I   A+RI SLRD SKKMSKSD SD+SRIN+ D+ D IA KI+KAKTD +
Sbjct: 106 --FFPLPEPIIPPEAARIMSLRDGSKKMSKSDESDYSRINMTDDADTIALKIRKAKTDLE 163

Query: 252 VLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIVPI 311
            LP  + GLE R EA NL+ I+A +   +  + + QF G+ FS FK  L D  +  + PI
Sbjct: 164 PLPGAMEGLEGRPEASNLLGIYAALSGKEKAQVVTQFEGQQFSDFKKELVDLAVSVLGPI 223

Query: 312 SQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + +++ L+ D +++D +L  GA RA   A   +K V +IVG 
Sbjct: 224 NTEMKRLMTDTAHIDAVLRSGAERADAIAAPIIKDVYDIVGF 265


>gi|57899972|dbj|BAD87908.1| putative tryptophanyl-tRNA synthetase [Oryza sativa Japonica Group]
 gi|125527667|gb|EAY75781.1| hypothetical protein OsI_03697 [Oryza sativa Indica Group]
 gi|125571983|gb|EAZ13498.1| hypothetical protein OsJ_03415 [Oryza sativa Japonica Group]
          Length = 399

 Score =  264 bits (674), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 149/350 (42%), Positives = 204/350 (58%), Gaps = 20/350 (5%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           VSGVQPTG++HLGNYLG I+N +  Q+    L  +FI DLHAIT       L   +R   
Sbjct: 62  VSGVQPTGLVHLGNYLGAIKNWVSLQDLYETL--FFIVDLHAITLPYEAPQLSKATRSTA 119

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+D S+  IF QS V  H +L W+LS    +GW+N MIQFKEKS++  +E   +
Sbjct: 120 AIYLACGIDSSKASIFVQSHVRAHVELMWLLSSSTPIGWLNRMIQFKEKSRKAGDENVGV 179

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEF-ERKIKEVAQKYAQE 187
            L  YPVLMA+DILLY++  VPVGEDQ QHLE+TR IA+R N  +  RK K++  +    
Sbjct: 180 ALLTYPVLMASDILLYQSDLVPVGEDQTQHLELTREIAERVNNLYGGRKWKKMGGR---- 235

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F + E LI  + +R+ SL D   KMSKS  SD SRINLLD  D+I  KI++ K
Sbjct: 236 ---GGSLFKVPEALIPPAGARVMSLTDGLSKMSKSAPSDQSRINLLDPKDVIMNKIKRCK 292

Query: 248 TDGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           TD         GLE     R E  NL+ I+  +     EE +++    N+  FK  L DA
Sbjct: 293 TD------SFPGLEFDNPERPECNNLLSIYQIITGKTKEEVIRECENMNWGSFKTTLTDA 346

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           +I+ + PI  + + ++ D  YLD +L+EG+ +A   A  T+  V + +G 
Sbjct: 347 LIDHLQPIQVRYEEIMSDPGYLDGVLLEGSGKAAEIADITLNNVYQAMGF 396


>gi|240948101|ref|ZP_04752511.1| tryptophanyl-tRNA synthetase [Actinobacillus minor NM305]
 gi|240297581|gb|EER48073.1| tryptophanyl-tRNA synthetase [Actinobacillus minor NM305]
          Length = 342

 Score =  263 bits (672), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 148/350 (42%), Positives = 211/350 (60%), Gaps = 11/350 (3%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  +  SGVQP+G L +GNYLG +RN ++ Q+  + L  + I DLHAIT     + LR  
Sbjct: 2   SKPIVFSGVQPSGELTIGNYLGALRNWVKMQDDYDCL--FCIVDLHAITVRQDPQALRKA 59

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           S   +A +LA G+DP+++ IF QS V  H  L+WIL+C    G M+ M QFK+KS    E
Sbjct: 60  SLDVLALYLACGIDPNKSTIFIQSHVPEHTQLAWILNCYTYFGEMSRMTQFKDKSAR-YE 118

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
           E  ++GLF YPVLMAADILLY+A  VPVG+DQ+QHLEITR IA RFN  + +K       
Sbjct: 119 ENVNVGLFTYPVLMAADILLYQANQVPVGDDQKQHLEITRDIANRFNALYGQK------- 171

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
             QE    +  F I E  I  + +R+ SL + +KKMSKSD +  + I LL++P  +AKKI
Sbjct: 172 -DQEGNLVQPVFAIPEVFIGKAGARVMSLLEPTKKMSKSDDNRNNVIGLLEDPKAVAKKI 230

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           ++A TDGD  P      +N+    NL++I + +    I E   +F GK +   K  +AD 
Sbjct: 231 KRAMTDGDEPPMVKYDQKNKAGVSNLLDILSAVTGKSIAELEAEFEGKMYGHLKTEVADR 290

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           V E +  + ++  H  +D++ L+ I  EGA +AR RA++T+  V ++VG 
Sbjct: 291 VSELLTELQERYNHFRQDEALLEKIFREGAEKARARAKKTLDEVYKLVGF 340


>gi|169334541|ref|ZP_02861734.1| hypothetical protein ANASTE_00944 [Anaerofustis stercorihominis DSM
           17244]
 gi|169259258|gb|EDS73224.1| hypothetical protein ANASTE_00944 [Anaerofustis stercorihominis DSM
           17244]
          Length = 333

 Score =  263 bits (671), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 142/345 (41%), Positives = 213/345 (61%), Gaps = 23/345 (6%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SG+Q +G   +GNY G I+N + RQ+  N +  YFIAD+HAIT N V  +LR +S    
Sbjct: 9   LSGIQSSGEFTIGNYFGAIKNWVERQDDYNCI--YFIADMHAITVNQVPADLRRRSFECA 66

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A  LA+G+DP ++++F QS V  HA+L WIL+C A MG ++ M Q+K+KSK ++ E   +
Sbjct: 67  AMLLASGIDPKKSLLFIQSHVPAHAELQWILNCNAHMGELSRMTQYKDKSK-SQGENIKV 125

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GLF YPVLMAADILLY+A  VPVG+DQ+QHLE+TR IA RFN  +               
Sbjct: 126 GLFDYPVLMAADILLYQADLVPVGDDQKQHLELTRTIANRFNNNYSPT------------ 173

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                 F + EG    + +RI SL+D  KKMSKSD +    I+++D+ D+I  K ++A T
Sbjct: 174 ------FKVPEGYYGENGARIMSLQDPLKKMSKSDENKNGFISMIDSKDVIMSKCKRAVT 227

Query: 249 DGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
           D D+  + +   EN+    NL+EI++      +EEA+K F GKN++ FK A+ +++ + +
Sbjct: 228 DSDM--NIIYDKENKPGVSNLLEIYSCAANKTMEEAVKDFEGKNYAYFKNAVGESIADRL 285

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            PI  +   L KDK+Y++ +L +  + A   A +T++ V + VG 
Sbjct: 286 SPIQNEFDRLCKDKTYVNEVLKDSRDSASYIANKTLRKVKKKVGF 330


>gi|254361195|ref|ZP_04977339.1| tryptophan--tRNA ligase [Mannheimia haemolytica PHL213]
 gi|153092686|gb|EDN73735.1| tryptophan--tRNA ligase [Mannheimia haemolytica PHL213]
          Length = 343

 Score =  262 bits (669), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 146/350 (41%), Positives = 211/350 (60%), Gaps = 11/350 (3%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  +  SGVQP+G L +GNYLG +RN ++ Q+  ++  +Y I D HAIT     E+LR  
Sbjct: 2   SKPIVFSGVQPSGELTIGNYLGALRNWVKMQD--DYDCVYCIVDQHAITVRQDPESLRKS 59

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           +   +A +LA G+DP+++ IF QS V  HA L+W+L+C    G M  M QFK+KS    E
Sbjct: 60  TLDVLALYLACGIDPNKSTIFIQSHVPEHAQLAWVLNCYTYFGEMGRMTQFKDKSAR-YE 118

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
           E  ++GLF YPVLMAADILLY+A  VPVG+DQ+QHLEITR IA RFN  + +K       
Sbjct: 119 ENVNVGLFTYPVLMAADILLYQANQVPVGDDQKQHLEITRDIANRFNALYGKK------- 171

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
              E    +  F + E  I  S +R+ SL + +KKMSKSD +  + I LL++P  +AKKI
Sbjct: 172 -DSEGNLIEPVFAVPEVFIAKSGARVMSLLEPTKKMSKSDDNRNNVIGLLEDPKAVAKKI 230

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           ++A TDGD  P     ++N+    NL++I + +    I E   +F GK +   K  +AD 
Sbjct: 231 KRAMTDGDEPPVVRYDVQNKAGVSNLLDILSAITGKTIAELETEFEGKMYGHLKTEVADK 290

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           V E +  + ++  H  +D++ L+ I  EGA +AR +A+ T+  V E+VG 
Sbjct: 291 VSELLTNLQERYHHYRQDEALLEKIYREGAEKARAQAKATLDKVYELVGF 340


>gi|261492942|ref|ZP_05989487.1| tryptophan--tRNA ligase [Mannheimia haemolytica serotype A2 str.
           BOVINE]
 gi|261495085|ref|ZP_05991551.1| tryptophan--tRNA ligase [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261309251|gb|EEY10488.1| tryptophan--tRNA ligase [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261311394|gb|EEY12552.1| tryptophan--tRNA ligase [Mannheimia haemolytica serotype A2 str.
           BOVINE]
          Length = 366

 Score =  262 bits (669), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 146/350 (41%), Positives = 211/350 (60%), Gaps = 11/350 (3%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  +  SGVQP+G L +GNYLG +RN ++ Q+  ++  +Y I D HAIT     E+LR  
Sbjct: 25  SKPIVFSGVQPSGELTIGNYLGALRNWVKMQD--DYDCVYCIVDQHAITVRQDPESLRKS 82

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           +   +A +LA G+DP+++ IF QS V  HA L+W+L+C    G M  M QFK+KS    E
Sbjct: 83  TLDVLALYLACGIDPNKSTIFIQSHVPEHAQLAWVLNCYTYFGEMGRMTQFKDKSAR-YE 141

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
           E  ++GLF YPVLMAADILLY+A  VPVG+DQ+QHLEITR IA RFN  + +K       
Sbjct: 142 ENVNVGLFTYPVLMAADILLYQANQVPVGDDQKQHLEITRDIANRFNALYGKK------- 194

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
              E    +  F + E  I  S +R+ SL + +KKMSKSD +  + I LL++P  +AKKI
Sbjct: 195 -DSEGNLIEPVFAVPEVFIAKSGARVMSLLEPTKKMSKSDDNRNNVIGLLEDPKAVAKKI 253

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           ++A TDGD  P     ++N+    NL++I + +    I E   +F GK +   K  +AD 
Sbjct: 254 KRAMTDGDEPPVVRYDVQNKAGVSNLLDILSAITGKTIAELETEFEGKMYGHLKTEVADK 313

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           V E +  + ++  H  +D++ L+ I  EGA +AR +A+ T+  V E+VG 
Sbjct: 314 VSELLTNLQERYHHYRQDEALLEKIYREGAEKARAQAKATLDKVYELVGF 363


>gi|119512222|ref|ZP_01631311.1| tryptophanyl-tRNA synthetase [Nodularia spumigena CCY9414]
 gi|119463120|gb|EAW44068.1| tryptophanyl-tRNA synthetase [Nodularia spumigena CCY9414]
          Length = 336

 Score =  262 bits (669), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 149/352 (42%), Positives = 207/352 (58%), Gaps = 29/352 (8%)

Query: 8   FVSGVQPTGVLHLGNYLGMIRNVIRRQ-ETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
            +SGVQPTG  HLGNYLG IRN +  Q E  N+L   F+ADLHAIT     + L   +  
Sbjct: 6   ILSGVQPTGNYHLGNYLGAIRNWVEGQSEYDNYL---FVADLHAITVPHDPKLLASDTYT 62

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
            VA +LA G+D + + IF QS V  H++L+W+ +C+  + W+ +MIQFKEK+ + + E  
Sbjct: 63  LVALYLACGLDLNHSTIFVQSHVSAHSELTWLFNCITPLNWLQDMIQFKEKAIK-QGENV 121

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           ++GL  YPVLMAADILLY+A  VPVGEDQ+QHLE+TR I  RFN +F +  + V +    
Sbjct: 122 NVGLLDYPVLMAADILLYQADKVPVGEDQKQHLELTRDIVNRFNHQFGKPDQPVIK---- 177

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                     + E LI    +R+ SL D ++KMSKSD SD SRINLLD PD I  KI++ 
Sbjct: 178 ----------LPEPLIRKEGARVMSLADGTRKMSKSDPSDLSRINLLDPPDQIQYKIKRC 227

Query: 247 KTDGDVLPSEVSGL----ENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALAD 302
           KTD      +V GL      R E  NL+ ++  +   K  E   +     + QFK  L +
Sbjct: 228 KTD------QVRGLTFDDPERPECNNLLSLYMLLSGKKKNEVAAECQDMGWGQFKPLLTE 281

Query: 303 AVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
             I  + PI +K Q ++ DK+YLD++L EG  +A   A +T+  V   +G +
Sbjct: 282 TTINALTPIQEKYQAVMADKAYLDSVLREGRQKAEAIANQTLTEVKTALGYT 333


>gi|39932189|sp|Q8DHG3|SYW_THEEB RecName: Full=Tryptophanyl-tRNA synthetase; AltName:
           Full=Tryptophan--tRNA ligase; Short=TrpRS
 gi|22295722|dbj|BAC09548.1| tryptophanyl-tRNA synthetase [Thermosynechococcus elongatus BP-1]
          Length = 330

 Score =  262 bits (669), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 148/351 (42%), Positives = 199/351 (56%), Gaps = 27/351 (7%)

Query: 8   FVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
            +SGVQPTG LHLGNYLG IRN +  Q    +   + + DLHAIT       L   +   
Sbjct: 1   MLSGVQPTGSLHLGNYLGAIRNWVAGQ--AEYENYFCVVDLHAITVPHDPAELAANTYTV 58

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A +LA G+DP+   IF QS V  HA+L+W+L+C+  + W+ +MIQFKEK+ +  E  A+
Sbjct: 59  AALYLACGIDPAHATIFVQSHVSAHAELTWLLNCITPLNWLEDMIQFKEKAVKQGENVAA 118

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
            GL  YPVLMAADILLY A  VPVGEDQ+QHLE+TR IA R N  F R    + +     
Sbjct: 119 -GLLDYPVLMAADILLYDADLVPVGEDQKQHLELTRDIAARVNYLFARNQPPILK----- 172

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                    + E LI  + +R+ SL D +KKMSKSD S+ SRINLLD+PD I KKI++ K
Sbjct: 173 ---------LPEPLIPKAGARVMSLTDGTKKMSKSDPSELSRINLLDSPDEIRKKIKRCK 223

Query: 248 TDGDVLPSEVSGL----ENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           TD       + GL     +R EA NL+ ++  +     E    +     + QFK  L DA
Sbjct: 224 TD------PIRGLAFDDPDRPEANNLLSLYQVLTGKTKEAVAAECADMGWGQFKPLLTDA 277

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
           VI  + PI Q+   ++ D SYL  +L +G  +A   A  T++ V    G +
Sbjct: 278 VIATLEPIQQRYNEIMADPSYLKDLLKKGQEQAATVANATLERVKLAFGFT 328


>gi|161485761|ref|NP_682786.2| tryptophanyl-tRNA synthetase [Thermosynechococcus elongatus BP-1]
          Length = 335

 Score =  261 bits (668), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 148/350 (42%), Positives = 199/350 (56%), Gaps = 27/350 (7%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQPTG LHLGNYLG IRN +  Q    +   + + DLHAIT       L   +    
Sbjct: 7   LSGVQPTGSLHLGNYLGAIRNWVAGQ--AEYENYFCVVDLHAITVPHDPAELAANTYTVA 64

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+DP+   IF QS V  HA+L+W+L+C+  + W+ +MIQFKEK+ +  E  A+ 
Sbjct: 65  ALYLACGIDPAHATIFVQSHVSAHAELTWLLNCITPLNWLEDMIQFKEKAVKQGENVAA- 123

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GL  YPVLMAADILLY A  VPVGEDQ+QHLE+TR IA R N  F R    + +      
Sbjct: 124 GLLDYPVLMAADILLYDADLVPVGEDQKQHLELTRDIAARVNYLFARNQPPILK------ 177

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                   + E LI  + +R+ SL D +KKMSKSD S+ SRINLLD+PD I KKI++ KT
Sbjct: 178 --------LPEPLIPKAGARVMSLTDGTKKMSKSDPSELSRINLLDSPDEIRKKIKRCKT 229

Query: 249 DGDVLPSEVSGL----ENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           D       + GL     +R EA NL+ ++  +     E    +     + QFK  L DAV
Sbjct: 230 D------PIRGLAFDDPDRPEANNLLSLYQVLTGKTKEAVAAECADMGWGQFKPLLTDAV 283

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
           I  + PI Q+   ++ D SYL  +L +G  +A   A  T++ V    G +
Sbjct: 284 IATLEPIQQRYNEIMADPSYLKDLLKKGQEQAATVANATLERVKLAFGFT 333


>gi|152977906|ref|YP_001343535.1| tryptophanyl-tRNA synthetase [Actinobacillus succinogenes 130Z]
 gi|150839629|gb|ABR73600.1| tryptophanyl-tRNA synthetase [Actinobacillus succinogenes 130Z]
          Length = 334

 Score =  261 bits (668), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 141/347 (40%), Positives = 208/347 (59%), Gaps = 21/347 (6%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           + +SGVQP+G L +GNYLG +R  +  Q+  ++  ++ I DLHAIT     E LR  +  
Sbjct: 5   VVLSGVQPSGELTIGNYLGALRQWVNMQD--DYECLFCIVDLHAITVRQDPETLRKATLD 62

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
            +A +LA G+DP ++ IF QS V  H  L+W+L+C    G M  M QFK+KS ++ +   
Sbjct: 63  VLALYLACGIDPEKSTIFIQSHVPEHTQLAWVLNCYTYFGEMGRMTQFKDKSAKHADNI- 121

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           ++GLF YPVLMAADILLY+A  VPVGEDQRQHLEI+R IAQRFN  +  +          
Sbjct: 122 NVGLFTYPVLMAADILLYQANQVPVGEDQRQHLEISRDIAQRFNALYGER---------- 171

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F + E  I  + +RI +L++ +KKMSKSD +  + I LL++P  + KKI++A
Sbjct: 172 --------FVVPEAFIPKAGARIMALQEPTKKMSKSDDNRNNVITLLEDPKSVEKKIKRA 223

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
            TDGD  P     ++N+    NL+E+ A M +  I E  K+F GK +   K A+A+  ++
Sbjct: 224 LTDGDEPPVVRYDVQNKAGVSNLLEMLAVMSEKSISELEKEFEGKMYGHLKSAVAEETVK 283

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            +  + ++  H   D++ L  I  EGA +A+ RAQ+T+K V + VG 
Sbjct: 284 MLTALQERFHHYRNDEALLTRIAAEGAQKAKVRAQKTLKAVYDAVGF 330


>gi|226491928|ref|NP_001140250.1| hypothetical protein LOC100272291 [Zea mays]
 gi|194698694|gb|ACF83431.1| unknown [Zea mays]
          Length = 405

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 149/350 (42%), Positives = 207/350 (59%), Gaps = 20/350 (5%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           VSGVQPTG +HLGNYLG I+N +  Q++  +   +FI DLHAIT       L   +R   
Sbjct: 68  VSGVQPTGSVHLGNYLGAIKNWVALQDS--YETFFFIVDLHAITLPYEAPLLSKATRSTA 125

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA GVD S+  IF QS V  H +L W+LS    +GW+N MIQFKEKS++  +E   +
Sbjct: 126 AIYLACGVDSSKASIFVQSHVRAHVELMWLLSSSTPIGWLNRMIQFKEKSRKAGDENVGV 185

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEF-ERKIKEVAQKYAQE 187
            L  YPVLMA+DILLY++  VPVGEDQ QHLE+TR IA+R N  +  RK K++  +    
Sbjct: 186 ALLTYPVLMASDILLYQSDLVPVGEDQTQHLELTREIAERVNNLYGGRKWKKLGGRGGL- 244

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F + E LI  + +R+ SL D   KMSKS  SD SRINLLD  D+IA KI++ K
Sbjct: 245 ------LFKVPEALIPPAGARVMSLTDGLSKMSKSAPSDQSRINLLDPKDVIANKIKRCK 298

Query: 248 TDGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           TD         G+E     R E +NL+ I+  + +   EE + +    N+  FK  L +A
Sbjct: 299 TD------SFPGMEFDNPERPECRNLLSIYQIITEKTKEEVVSECQHMNWGTFKTTLTEA 352

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           +I+ + PI  + + ++ D +YLD +L+EGA +A   A  T+  V + +G 
Sbjct: 353 LIDHLQPIQVRYEEIMSDPAYLDNVLLEGAVKAAEIADITLNNVYQAMGF 402


>gi|170076672|ref|YP_001733310.1| tryptophanyl-tRNA synthetase [Synechococcus sp. PCC 7002]
 gi|169884341|gb|ACA98054.1| tryptophanyl-tRNA synthetase [Synechococcus sp. PCC 7002]
          Length = 336

 Score =  260 bits (665), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 146/350 (41%), Positives = 205/350 (58%), Gaps = 27/350 (7%)

Query: 8   FVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
            +SGVQPTG LHLGNYLG I+N +  Q+  ++   + + DLHAIT     + L   ++  
Sbjct: 6   ILSGVQPTGNLHLGNYLGAIQNWVEIQQ--DYDSFFCVVDLHAITVPHDPKVLANNTKAI 63

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A +LA G+D + + IF QS V  H++L+W+L+CV  + W+  MIQFKEK+++ + E  S
Sbjct: 64  AALYLACGIDLTHSTIFVQSHVKAHSELAWLLNCVTPLNWLERMIQFKEKAQK-QGENVS 122

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GL  YPVLMAADILLY A  VPVGEDQ+QHLE+TR I  R N +F  K   V +     
Sbjct: 123 VGLLDYPVLMAADILLYDADKVPVGEDQKQHLELTRDIVIRINDKFGTKKNPVLK----- 177

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                    + + LI ++ +R+ SL D +KKMSKSD S+ SRINLLD PD++ KKI+K K
Sbjct: 178 ---------MPDPLIRTTGARVMSLTDGTKKMSKSDPSELSRINLLDPPDVLTKKIKKCK 228

Query: 248 TDGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           TD +       GLE    NR E  NL+ ++A +     E    +     + QFK  L + 
Sbjct: 229 TDPE------RGLEFDNPNRPECNNLLGLYALLSGKPKETVAAECADMGWGQFKPLLTET 282

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           VI  + PI  K   ++ +  YLD +L EG  +A   A  T+K V + +G 
Sbjct: 283 VIAALEPIQTKYHDIMANPDYLDQVLREGREKADTVANATLKQVKDALGF 332


>gi|52426387|ref|YP_089524.1| tryptophanyl-tRNA synthetase [Mannheimia succiniciproducens
           MBEL55E]
 gi|52308439|gb|AAU38939.1| TrpS protein [Mannheimia succiniciproducens MBEL55E]
          Length = 335

 Score =  260 bits (664), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 140/347 (40%), Positives = 205/347 (59%), Gaps = 20/347 (5%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           + +SGVQP+G L +GNYLG +R  ++ Q+  ++  ++ I DLHAIT     E LR  +  
Sbjct: 5   VVLSGVQPSGELTIGNYLGALRQWVKMQD--DYECLFCIVDLHAITVRQDPEQLRKATLD 62

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
            +A +LA G+DP ++ IF QS V  H  L+W+L+C    G MN M QFK+KS    E   
Sbjct: 63  VLALYLACGIDPEKSTIFIQSHVPEHTQLAWVLNCYTYFGEMNRMTQFKDKSARYAENI- 121

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           ++GLF YPVLMAADILLY+A  VPVGEDQRQHLEITR IAQRFN                
Sbjct: 122 NVGLFTYPVLMAADILLYQAAQVPVGEDQRQHLEITRDIAQRFNA--------------- 166

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
              Y +  F + +  I  + +++ +L++ +KKMSKSD +  + I LL++P  +AKKI++A
Sbjct: 167 --IYGENQFTVPQAFIPKAGAKVMALQEPTKKMSKSDDNRNNVITLLEDPKSVAKKIKRA 224

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
            TDGD  P     ++N+    NL+EI + +    I +  K+F GK +   K  +AD V+ 
Sbjct: 225 MTDGDEPPLVKYDVQNKAGVSNLLEILSVITDKPIPQLEKEFEGKMYGHLKTTVADEVVA 284

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            +  +  +  H   ++  L+ I  EGA +AR RA+ET++ V   +G 
Sbjct: 285 MLTQLQDRFAHYRNNEELLNKIAAEGAKKARARAKETLEKVYNAIGF 331


>gi|242058649|ref|XP_002458470.1| hypothetical protein SORBIDRAFT_03g034270 [Sorghum bicolor]
 gi|241930445|gb|EES03590.1| hypothetical protein SORBIDRAFT_03g034270 [Sorghum bicolor]
          Length = 405

 Score =  259 bits (663), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 149/350 (42%), Positives = 206/350 (58%), Gaps = 20/350 (5%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           VSGVQPTG++HLGNYLG I+N +  Q+   +   +FI DLHAIT       L   +R   
Sbjct: 68  VSGVQPTGLVHLGNYLGAIKNWVALQDL--YETFFFIVDLHAITLPYEAPLLSKATRSTA 125

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA GVD S+  IF QS V  H +L W+LS    +GW+N MIQFKEKS++  +E   +
Sbjct: 126 AIYLACGVDSSKASIFVQSHVRAHVELMWLLSSSTPIGWLNRMIQFKEKSRKAGDENVGV 185

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEF-ERKIKEVAQKYAQE 187
            L  YPVLMA+DILLY++  VPVGEDQ QHLE+TR IA+R N  +  RK K++  +    
Sbjct: 186 ALLTYPVLMASDILLYQSDLVPVGEDQTQHLELTREIAERVNNLYGGRKWKKLGGRGGL- 244

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F + E LI  + +R+ SL D   KMSKS  SD SRINLLD  D+IA KI++ K
Sbjct: 245 ------LFKVPEALIPPAGARVMSLTDGLSKMSKSAPSDQSRINLLDPKDVIANKIKRCK 298

Query: 248 TDGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           TD         G+E     R E +NL+ I+  +     EE + +    N+  FK  L +A
Sbjct: 299 TD------SFPGMEFDNPERPECRNLLSIYQIITGKTKEEVVSECQHMNWGAFKTNLTEA 352

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           +I+ + PI  + + ++ D +YLD +L+EGA +A   A  T+  V + +G 
Sbjct: 353 LIDHLQPIQVRYEEIMSDPAYLDNVLLEGAGKAAEIADITLNNVYQAMGF 402


>gi|209523504|ref|ZP_03272058.1| tryptophanyl-tRNA synthetase [Arthrospira maxima CS-328]
 gi|209495909|gb|EDZ96210.1| tryptophanyl-tRNA synthetase [Arthrospira maxima CS-328]
          Length = 336

 Score =  259 bits (663), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 143/351 (40%), Positives = 205/351 (58%), Gaps = 27/351 (7%)

Query: 8   FVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
            +SGVQPTG LHLGNYLG IRN +  Q+  ++   + + DLHAIT       L   +   
Sbjct: 6   ILSGVQPTGNLHLGNYLGAIRNWVEGQKQYDNF--FCVVDLHAITVPHNPATLAADTYTI 63

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A +LA G+DP  + IF QS +  H++L+W+L+C+  + W+ +MIQFKEK+ + + E  S
Sbjct: 64  AALYLACGIDPEDSTIFVQSHISAHSELTWLLNCLTPINWLQDMIQFKEKAVK-QGENVS 122

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
            GL  YPVLMAADILLY A  VPVGEDQ+QHLE+TR IA RFN  F +  +E+ +     
Sbjct: 123 TGLLDYPVLMAADILLYDADRVPVGEDQKQHLELTRDIAGRFNHLFGQPDQEILK----- 177

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                    I + LI +  +R+ SL D ++KMSKSD S+ SRINLLD PD I KKI++ K
Sbjct: 178 ---------IPQPLIRTEGARVMSLTDGTRKMSKSDPSELSRINLLDPPDAIVKKIKRCK 228

Query: 248 TDGDVLPSEVSGL----ENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           TD       V GL     +R E  NL+ ++A +      +   +     + QFK  L + 
Sbjct: 229 TD------SVRGLAFDVPDRPECHNLLSLYALLSNQTKAQVAAECADMGWGQFKPLLTET 282

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
            I  + PI ++ + ++ D+ YL++IL  G  +A   A +T+  V + +G S
Sbjct: 283 AIAALKPIQERYKEVMSDRGYLESILRTGRQQAEAVANQTLSRVKDALGYS 333


>gi|119492799|ref|ZP_01623885.1| tryptophanyl-tRNA synthetase [Lyngbya sp. PCC 8106]
 gi|119452952|gb|EAW34124.1| tryptophanyl-tRNA synthetase [Lyngbya sp. PCC 8106]
          Length = 336

 Score =  259 bits (662), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 144/350 (41%), Positives = 205/350 (58%), Gaps = 27/350 (7%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQPTG LHLGNYLG IRN +  Q   ++   + + DLHAIT       L   +    
Sbjct: 7   LSGVQPTGNLHLGNYLGAIRNWVEGQSQYDNF--FCVVDLHAITVPHNPATLATDTYTIA 64

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+D   + IF QS +  H++L+W+L+C+  + W+ +MIQFKEK+ + + E  S 
Sbjct: 65  ALYLACGIDLEHSTIFVQSHISAHSELTWLLNCITPINWLQDMIQFKEKAIK-QGENVST 123

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GL  YPVLMAADILLY A  VPVGEDQ+QHLE+TR IA RFN  F +  +E+ +      
Sbjct: 124 GLLDYPVLMAADILLYDADQVPVGEDQKQHLELTRDIAARFNHMFGQDEEEILK------ 177

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                   I E +I +  +RI SL D ++KMSKSD S+ SRINLLD P+ I KKI++ KT
Sbjct: 178 --------IPEPMIRTEGARIMSLTDGTRKMSKSDPSELSRINLLDPPEAITKKIKRCKT 229

Query: 249 DGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           D       V GLE     R E  NL+ ++  +     +E   +     + +FK  L +  
Sbjct: 230 DS------VRGLELGNPERPECNNLLMLYGILSGKTKDEVTAECQDMGWGKFKPLLTETT 283

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
           IE + PI ++ + ++ D++YLD++L +G  +A   A  T+K V   +G S
Sbjct: 284 IEALKPIQEQYKAVMDDRTYLDSVLKDGREKAEAVANATLKRVKTALGYS 333


>gi|67921080|ref|ZP_00514599.1| Tryptophanyl-tRNA synthetase, class Ib [Crocosphaera watsonii WH
           8501]
 gi|67857197|gb|EAM52437.1| Tryptophanyl-tRNA synthetase, class Ib [Crocosphaera watsonii WH
           8501]
          Length = 375

 Score =  259 bits (661), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 153/348 (43%), Positives = 203/348 (58%), Gaps = 26/348 (7%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQPTG LHLGNYLG IR  +  Q+  N+   + + DLHAIT     + L   +    
Sbjct: 42  LSGVQPTGNLHLGNYLGAIRTWVDMQD--NYDNFFCVVDLHAITVPHNPKTLAQDTYTIA 99

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+D     IF QS V  H++L+W+L+C+  + W+  MIQFKEK+ + + E  S+
Sbjct: 100 ALYLACGIDLDHATIFVQSHVTAHSELAWLLNCITPLNWLERMIQFKEKALK-QGENVSV 158

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GL  YPVLMAADILLY A  VPVGEDQ+QHLE+TR IA RFN +F    +    K     
Sbjct: 159 GLLDYPVLMAADILLYDADQVPVGEDQKQHLELTRDIAIRFNDQFATDKENPVLK----- 213

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                   + E LI    +R+ SL D ++KMSKSD SD SRINLLD PD+I KKI+K KT
Sbjct: 214 --------LPEPLIRKQGARVMSLTDGTRKMSKSDPSDLSRINLLDPPDLIKKKIKKCKT 265

Query: 249 DGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           D       V GLE     R E  NL+ ++  +     EE  K+     + QFK  L +  
Sbjct: 266 D------PVKGLEFDNQERPECNNLLGLYTLLSGKSKEEVAKECQNMGWGQFKPLLTETT 319

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVG 352
           IE + PI +K Q ++ DK YLD++L EG  +A   A ET+  V + +G
Sbjct: 320 IEALKPIQEKYQSIMNDKDYLDSVLREGKEKAETVAHETLTRVKDALG 367


>gi|218437358|ref|YP_002375687.1| tryptophanyl-tRNA synthetase [Cyanothece sp. PCC 7424]
 gi|218170086|gb|ACK68819.1| tryptophanyl-tRNA synthetase [Cyanothece sp. PCC 7424]
          Length = 336

 Score =  259 bits (661), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 149/349 (42%), Positives = 200/349 (57%), Gaps = 27/349 (7%)

Query: 8   FVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
            +SGVQPTG LHLGNYLG IRN +  Q   ++   + + DLHAIT     + L   +   
Sbjct: 6   ILSGVQPTGNLHLGNYLGAIRNWVDIQREYDNF--FCVVDLHAITVPHNPQTLANDTYTI 63

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A +LA G+D   + IF QS V  H++L+W+L+C+  + W+  MIQFKEK+ + + E  S
Sbjct: 64  AALYLACGIDLRYSTIFVQSHVTAHSELAWLLNCITPLNWLERMIQFKEKAVK-QGENVS 122

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GL  YPVLMAADILLY A  VPVGEDQ+QHLE+TR IA R N +F    K + +     
Sbjct: 123 VGLLDYPVLMAADILLYDADKVPVGEDQKQHLELTRDIAVRINDQFGTPEKPILK----- 177

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                    I + LI    +R+ SL D ++KMSKSD SD SRINLLD P++I KKI++ K
Sbjct: 178 ---------IPDPLIRKEGARVMSLTDGTRKMSKSDPSDLSRINLLDPPELIEKKIKRCK 228

Query: 248 TDGDVLPSEVSGL----ENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           TD       + GL      R E  NL+ ++  +     EE  +  G   + QFK  L  A
Sbjct: 229 TD------PIRGLTFDDPERPECNNLLNLYTILSGKTKEEVAQMCGDMGWGQFKPLLTSA 282

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVG 352
           VIE +  I  K Q ++ DK YLD++L EG  +A   A  T+  V E  G
Sbjct: 283 VIESLSQIQTKYQEIMNDKGYLDSVLREGRYKASQVANATLTRVKESFG 331


>gi|42570919|ref|NP_973533.1| OVA4 (ovule abortion 4); ATP binding / aminoacyl-tRNA ligase/
           nucleotide binding / tryptophan-tRNA ligase [Arabidopsis
           thaliana]
 gi|330252666|gb|AEC07760.1| tryptophanyl-tRNA synthetase [Arabidopsis thaliana]
          Length = 412

 Score =  259 bits (661), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 152/349 (43%), Positives = 204/349 (58%), Gaps = 16/349 (4%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           VSGVQPTG +HLGNYLG I+N +  Q+T   L  + I D HAIT       L   +    
Sbjct: 68  VSGVQPTGSVHLGNYLGAIKNWVALQDTYETL--FIIVDHHAITLPYDTRQLGKATTDTA 125

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+D S+  +F QS V  H +L W+L     +GW+  MIQFKEKS++   E AS+
Sbjct: 126 ALYLACGIDVSKASVFVQSHVPAHVELMWLLCSSTPIGWLQKMIQFKEKSRKEGVENASV 185

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GLF YP LM ADILLY++  VPVGEDQ+QH+E+ R IAQR N  +  K  +    Y   E
Sbjct: 186 GLFTYPDLMTADILLYQSDFVPVGEDQKQHIELAREIAQRVNHLYGGKKWKKLGGY---E 242

Query: 189 QYSKG-FFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
            +  G  F I E LI  + +R+ SL D   KMSKS  SD SRINLLD+ D+I  KI++ K
Sbjct: 243 IFRGGSLFKIPEPLIPQAGARVMSLTDGLSKMSKSAPSDQSRINLLDSKDLIVDKIKRCK 302

Query: 248 TDGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           TD        +GLE     R E  NL+ I+  +   K EE +++    ++  FK  LADA
Sbjct: 303 TD------SFAGLEFDNAERPECNNLLSIYQIVSGKKKEEVMEECKDMSWGTFKPLLADA 356

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVG 352
           +IE + PI  + Q ++ +  YLD IL EGA+RA      TM+ + + +G
Sbjct: 357 LIEHLSPIQARYQEIIAEPEYLDKILSEGADRAEELGAVTMRNMYQAMG 405


>gi|303285454|ref|XP_003062017.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226456428|gb|EEH53729.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 413

 Score =  258 bits (660), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 150/369 (40%), Positives = 214/369 (57%), Gaps = 33/369 (8%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAIT-NNIVQENLRYQSRLF 67
           +SGVQPTG +HLGNY G I+N +  QE  +    Y + DLHAIT  N     L+  +R  
Sbjct: 49  LSGVQPTGSIHLGNYFGAIKNWVDLQEEFD--AFYCVVDLHAITPGNHDAAALKASTRSS 106

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQ------------FK 115
            A +LAAG+DP ++ +F QS V  H++L W+L+C   +GW+  MIQ            FK
Sbjct: 107 AAIYLAAGLDPEKSNVFVQSHVAAHSELCWLLNCATPIGWLEKMIQARSISHWSPYDRFK 166

Query: 116 EKSKENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEF-E 174
           EK+++  E+  S+GL  YPVLMAADILLY A  VPVGEDQRQHLE+TR +A R N  +  
Sbjct: 167 EKARKAGEDV-SVGLLDYPVLMAADILLYNADVVPVGEDQRQHLELTRDVAARVNNLYGG 225

Query: 175 RKIKEVAQKYAQEEQYSKGFF------PIIEGLIDSSASRIRSLRDASKKMSKSDSSDFS 228
            K K++  K     +   G F       + E  I  + +R+ SL D + KMSKS+ ++ S
Sbjct: 226 NKWKKLGPKKGDGARAPSGRFRGGDVLKVPEAYIPKAGARVMSLTDGTSKMSKSNPAEGS 285

Query: 229 RINLLDNPDIIAKKIQKAKTDGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEA 284
           RIN+LD+PD IAKKI++ KTD         GLE    +R EA NL+ ++    ++  EE 
Sbjct: 286 RINVLDSPDEIAKKIKRCKTDA------FEGLEFRNPDRPEATNLLTMYQLCTELSEEEV 339

Query: 285 LKQFGGKNFSQFKLALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETM 344
           +   G   +  FK AL +AVIE + PI  +   ++ ++ YLD +L  GA+ A   A++T+
Sbjct: 340 IAACGDMRWGDFKPALTEAVIEHLRPIQSRYDEIVSEEGYLDGVLKRGADAANEVAEKTV 399

Query: 345 KYVNEIVGL 353
             V + +G 
Sbjct: 400 ADVRDAMGF 408


>gi|81300117|ref|YP_400325.1| tryptophanyl-tRNA synthetase [Synechococcus elongatus PCC 7942]
 gi|81168998|gb|ABB57338.1| tryptophanyl-tRNA synthetase [Synechococcus elongatus PCC 7942]
          Length = 355

 Score =  258 bits (660), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 147/350 (42%), Positives = 204/350 (58%), Gaps = 27/350 (7%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQPTG LHLGNYLG IRN +  Q+  ++   + + DLHAIT      +L   +    
Sbjct: 25  LSGVQPTGNLHLGNYLGAIRNWVEGQQQYDNF--FCVVDLHAITVPHEAASLAENTYRTA 82

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+D S + IF QS V  H++L+W+L+C+  + W+  MIQFKEK+ + + E  S 
Sbjct: 83  ALYLACGIDLSCSTIFVQSHVPAHSELTWLLNCITPLNWLEGMIQFKEKALK-QGENVST 141

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GL  YPVLMAADILLY A  VPVGEDQ+QHLE+TR IA R N  F R    +        
Sbjct: 142 GLLDYPVLMAADILLYDADRVPVGEDQKQHLELTRDIAVRINHLFGRDDTPI-------- 193

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                 F + E LI  + +R+ SL D +KKMSKSD ++ SRINLLD P++I KK+++ KT
Sbjct: 194 ------FKLPEPLIPKAGARVMSLTDGTKKMSKSDPTELSRINLLDPPELIEKKVKRCKT 247

Query: 249 DGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           D         GLE    +R E  NL+ ++A +     E    +     + QFK  LA+A 
Sbjct: 248 DPQ------RGLEFDNPDRPECNNLLSLYAILSGRSRETVAAECADMGWGQFKPLLAEAA 301

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
           IE + PI  K + +  +  YLD++L +G  RA   A  T++ V + +G S
Sbjct: 302 IEALRPIQTKYEEVRSEPGYLDSVLKQGRERASEVANATLRRVQDALGFS 351


>gi|290958020|ref|YP_003489202.1| tryptophanyl-tRNA synthetase [Streptomyces scabiei 87.22]
 gi|260647546|emb|CBG70651.1| tryptophanyl-tRNA synthetase [Streptomyces scabiei 87.22]
          Length = 337

 Score =  258 bits (659), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 146/358 (40%), Positives = 204/358 (56%), Gaps = 32/358 (8%)

Query: 2   LSSDNLFV-SGVQPT-GVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQEN 59
           ++SD L V SG+QPT G  HLGNYLG +R  +  QE+  H   Y + DLHAIT      +
Sbjct: 1   MASDRLRVLSGIQPTAGSFHLGNYLGAVRQWVALQES--HDAFYMVVDLHAITIAQDPAD 58

Query: 60  LRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSK 119
           LR  +RL VA  LAAG+DP R  +F QS V  HA L+W+++C+   G  + M QFK+KS 
Sbjct: 59  LRANTRLAVAQLLAAGLDPERCTLFVQSHVPEHAQLAWVMNCLTGFGEASRMTQFKDKSA 118

Query: 120 ENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKE 179
           +   + AS+GLF YP+L  ADILLY+A  VPVGEDQRQH+E+TR +A+RFN  F      
Sbjct: 119 KQGADRASVGLFTYPILQVADILLYQANEVPVGEDQRQHIELTRDLAERFNGRFGET--- 175

Query: 180 VAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDII 239
                          F I +  I    ++I  L+D + KMSKS S+    INLLD+P   
Sbjct: 176 ---------------FTIPKPYILKETAKIYDLQDPAIKMSKSASTPKGLINLLDDPKAT 220

Query: 240 AKKIQKAKTDGDVL----PSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQ 295
           AKK++ A TD D +     +E  G+       NL+ I++T+    I E  +++ GK +  
Sbjct: 221 AKKVKSAVTDTDTVIRYDAAEKPGV------SNLLSIYSTLTGAGIAELEQKYAGKGYGA 274

Query: 296 FKLALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            K  LA+ ++E + P  ++ Q  L D   LD+IL +GA +AR  A ET+    + VG 
Sbjct: 275 LKTDLAEVMVEFVTPFRERTQQYLDDPETLDSILAKGAEKARAVAAETLAQAYDRVGF 332


>gi|308048052|ref|YP_003911618.1| tryptophanyl-tRNA synthetase [Ferrimonas balearica DSM 9799]
 gi|307630242|gb|ADN74544.1| tryptophanyl-tRNA synthetase [Ferrimonas balearica DSM 9799]
          Length = 335

 Score =  258 bits (659), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 143/347 (41%), Positives = 199/347 (57%), Gaps = 21/347 (6%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           + +SG QP+G L LGNY+G +R  ++ QET  H  +Y I DLHAIT     E LR     
Sbjct: 5   VVLSGAQPSGGLTLGNYMGALRQWVKLQET--HDALYCIVDLHAITVRQDPEKLRNACMD 62

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
            +A +LA GVDP ++ +F QS V  H  L WIL+C  +MG +N M QFK+KS  +     
Sbjct: 63  TLALYLACGVDPKKSTVFVQSHVQEHTQLGWILNCYTQMGELNRMTQFKDKSARHASNI- 121

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           + GLF YPVLMAADILLY+A  VPVG DQ+QHLE+ R IA RFN  +             
Sbjct: 122 NAGLFSYPVLMAADILLYQANEVPVGNDQKQHLELARDIATRFNNLY------------- 168

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F + E  I  + +R+ SL+D SKKMSKSD +  +R+ LL++P  I KK +KA
Sbjct: 169 -----GDVFTVPEPHIPEAGARVMSLQDPSKKMSKSDDNANNRVGLLEDPKTITKKFKKA 223

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
            TD D  P     L+N+    NL+ I++        E   +F GK +   K+A A++V+ 
Sbjct: 224 VTDSDEPPVVRFDLDNKAGVSNLMSIYSATSGKSFAEIEAEFEGKMYGHLKVATAESVVA 283

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + P+ Q+   +  D++YLD ++  GA  AR RA +T+  V + VGL
Sbjct: 284 LLEPMQQRFAEIRADQAYLDEVMKAGAEGARERAAKTLAKVYDAVGL 330


>gi|56750254|ref|YP_170955.1| tryptophanyl-tRNA synthetase [Synechococcus elongatus PCC 6301]
 gi|56685213|dbj|BAD78435.1| tryptophanyl-tRNA synthetase [Synechococcus elongatus PCC 6301]
          Length = 337

 Score =  258 bits (659), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 147/350 (42%), Positives = 204/350 (58%), Gaps = 27/350 (7%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQPTG LHLGNYLG IRN +  Q+  ++   + + DLHAIT      +L   +    
Sbjct: 7   LSGVQPTGNLHLGNYLGAIRNWVEGQQQYDNF--FCVVDLHAITVPHEAASLAENTYRTA 64

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+D S + IF QS V  H++L+W+L+C+  + W+  MIQFKEK+ + + E  S 
Sbjct: 65  ALYLACGIDLSCSTIFVQSHVPAHSELTWLLNCITPLNWLEGMIQFKEKALK-QGENVST 123

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GL  YPVLMAADILLY A  VPVGEDQ+QHLE+TR IA R N  F R    +        
Sbjct: 124 GLLDYPVLMAADILLYDADRVPVGEDQKQHLELTRDIAVRINHLFGRDDTPI-------- 175

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                 F + E LI  + +R+ SL D +KKMSKSD ++ SRINLLD P++I KK+++ KT
Sbjct: 176 ------FKLPEPLIPKAGARVMSLTDGTKKMSKSDPTELSRINLLDPPELIEKKVKRCKT 229

Query: 249 DGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           D         GLE    +R E  NL+ ++A +     E    +     + QFK  LA+A 
Sbjct: 230 DPQ------RGLEFDNPDRPECNNLLSLYAILSGRSRETVAAECADMGWGQFKPLLAEAA 283

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
           IE + PI  K + +  +  YLD++L +G  RA   A  T++ V + +G S
Sbjct: 284 IEALRPIQTKYEEVRSEPGYLDSVLKQGRERASEVANATLRRVQDALGFS 333


>gi|148242544|ref|YP_001227701.1| tryptophanyl-tRNA synthetase [Synechococcus sp. RCC307]
 gi|147850854|emb|CAK28348.1| Tryptophanyl-tRNA synthetase [Synechococcus sp. RCC307]
          Length = 340

 Score =  258 bits (659), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 146/351 (41%), Positives = 207/351 (58%), Gaps = 28/351 (7%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQPTG LHLGN+LG IRN +  Q +  H   + + DLHAIT     + L   +R   
Sbjct: 7   LSGVQPTGSLHLGNWLGAIRNWVDLQRS--HDTFFCVVDLHAITVPHDPKQLAADTRSTA 64

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+DP +  +F QS V  HA+L+W+L+CV  + W+  MIQFKEK+ + + +  S+
Sbjct: 65  ALYLACGIDPEQATVFVQSQVPAHAELAWLLNCVTPLNWLERMIQFKEKAVK-QGDNVSV 123

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIA-QRFNTEFERKIKEVAQKYAQE 187
           GL  YPVLMAADILLY A  VPVGEDQ+QHLE+ R IA QR N+ F  +   V +     
Sbjct: 124 GLLDYPVLMAADILLYDADQVPVGEDQKQHLELARDIAQQRINSRFGSEETPVLK----- 178

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                    + + +I    +R+ SL D S KMSKSD ++ +RINLLD P++I KKI++AK
Sbjct: 179 ---------VPKPMIMKEGARVMSLTDGSAKMSKSDPNEGARINLLDPPELITKKIKRAK 229

Query: 248 TDGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           TD       V GLE     R EA NL+ ++A +     E+   +     + +FK  LA+ 
Sbjct: 230 TD------PVMGLEFGNPERPEADNLLGLYALLSGQSREQVSSECAEMGWGRFKPLLAET 283

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
            +E + PI Q+   +  D+S LD +L  G  RA   A++T++ V E +G +
Sbjct: 284 TVEALRPIQQRYSEISADRSGLDQVLAAGRERASAVAEQTLQRVQEAMGFA 334


>gi|255550960|ref|XP_002516528.1| tryptophanyl-tRNA synthetase, putative [Ricinus communis]
 gi|223544348|gb|EEF45869.1| tryptophanyl-tRNA synthetase, putative [Ricinus communis]
          Length = 412

 Score =  257 bits (657), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 152/351 (43%), Positives = 202/351 (57%), Gaps = 20/351 (5%)

Query: 8   FVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
            VSGVQPTG +HLGNYLG I+N I  Q T   L  +FI DLHAIT       L   +R  
Sbjct: 74  IVSGVQPTGSIHLGNYLGAIKNWIALQNTYETL--FFIVDLHAITLPYDTPQLSKATRNT 131

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A +LA GVD SR  +F QS V  H +L W+LS    +GW+N MIQFKEKS++  +E   
Sbjct: 132 AAIYLACGVDNSRASVFVQSHVRAHVELMWLLSSATPIGWLNRMIQFKEKSRKAGDENVG 191

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEF-ERKIKEVAQKYAQ 186
           + L  YPVLMA+DILLY++  VPVGEDQ+QHLE+TR +A+R N  +  RK K++  +   
Sbjct: 192 VALLTYPVLMASDILLYQSDFVPVGEDQKQHLELTRELAERVNYLYGGRKWKKLGGR--- 248

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F + E LI  + +R+ SL D   KMSKS  SD SRINLLD  D+IA KI++ 
Sbjct: 249 ----GGAIFKVPEPLIPPAGARVMSLTDGLAKMSKSAPSDQSRINLLDPKDVIANKIKRC 304

Query: 247 KTDGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALAD 302
           KTD         GLE     R E  NL+ ++  +     EE  ++    N+  FK  L D
Sbjct: 305 KTD------SFPGLEFDNPERPECNNLLSVYQLVSGKTKEEVAQECQDMNWGTFKPLLTD 358

Query: 303 AVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           A+I  + PI  + + ++ D +YLD +L EGA  A   A  T+  V + +G 
Sbjct: 359 ALIGHLHPIQVQYEEIISDSAYLDRVLEEGAANAAEIADATLNNVYQAMGF 409


>gi|145638003|ref|ZP_01793638.1| tryptophanyl-tRNA synthetase [Haemophilus influenzae PittHH]
 gi|145268797|gb|EDK08765.1| tryptophanyl-tRNA synthetase [Haemophilus influenzae PittHH]
          Length = 334

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 145/344 (42%), Positives = 203/344 (59%), Gaps = 21/344 (6%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQP+G L +GNYLG +RN ++ QE  N+  ++ + DLHAIT       LR  +   +A
Sbjct: 8   SGVQPSGELTIGNYLGALRNWVKMQE--NYECIFCVVDLHAITVRQDPVALRKATLDVLA 65

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LA G+DP+++ IF QS V  H  LSW+L+C    G M+ M QFK+KS    EE  ++G
Sbjct: 66  LYLACGIDPNKSTIFVQSHVPEHTQLSWVLNCYTYFGEMSRMTQFKDKSAR-YEENINVG 124

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YPVLMAADILLY+A  VPVG+DQ+QHLEITR IA RFN  +                
Sbjct: 125 LFDYPVLMAADILLYQAKSVPVGDDQKQHLEITRDIANRFNALY---------------- 168

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                F I E  I  + +RI SL+D  KKMSKSD +  + + LL++P  +AKKI++A TD
Sbjct: 169 --GNIFTIPEIFIGKAGARIMSLQDPEKKMSKSDDNRNNVVTLLEDPKSVAKKIKRAVTD 226

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            D  P     ++N+    NL++I + +    I +  K+F GK +   K A+AD V   + 
Sbjct: 227 SDEPPVVRYDVQNKAGVSNLLDILSAVTDKPIADLEKEFEGKMYGHLKTAVADEVSTLLA 286

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + ++      D++ LD IL +GA +AR +AQET+  V E VG 
Sbjct: 287 GLQERFHQYRNDEALLDNILRQGAEKARAKAQETLAKVYEAVGF 330


>gi|229845627|ref|ZP_04465752.1| tryptophanyl-tRNA synthetase [Haemophilus influenzae 6P18H1]
 gi|229811427|gb|EEP47131.1| tryptophanyl-tRNA synthetase [Haemophilus influenzae 6P18H1]
          Length = 334

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 145/344 (42%), Positives = 204/344 (59%), Gaps = 21/344 (6%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQP+G L +GNYLG +RN ++ QE  ++  ++ + DLHAIT       LR  +   +A
Sbjct: 8   SGVQPSGELTIGNYLGALRNWVKMQE--DYECIFCVVDLHAITVRQDPVALRKATLDVLA 65

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LA G+DP+++ IF QS V  H+ LSW+L+C    G M+ M QFK+KS    EE  ++G
Sbjct: 66  LYLACGIDPNKSTIFVQSHVPEHSQLSWVLNCYTYFGEMSRMTQFKDKSAR-YEENINVG 124

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YPVLMAADILLY+A  VPVG+DQ+QHLEITR IA RFN  +                
Sbjct: 125 LFDYPVLMAADILLYQAKSVPVGDDQKQHLEITRDIANRFNALY---------------- 168

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                F I E  I  + +RI SL+D  KKMSKSD +  + + LL++P  +AKKI++A TD
Sbjct: 169 --GNIFTIPEIFIGKAGARIMSLQDPEKKMSKSDDNRNNVVTLLEDPKSVAKKIKRAVTD 226

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            D  P     ++N+    NL++I + +    I E  K+F GK +   K A+AD V   + 
Sbjct: 227 SDEPPVVRYDVQNKAGVSNLLDILSAVTDKPIAELEKEFEGKMYGHLKTAVADEVSTLLA 286

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + ++      D++ LD IL +GA +AR +AQET+  V E VG 
Sbjct: 287 GLQERFHQYRNDEALLDNILRQGAEKARAKAQETLAKVYEAVGF 330


>gi|126658151|ref|ZP_01729302.1| tryptophanyl-tRNA synthetase [Cyanothece sp. CCY0110]
 gi|126620522|gb|EAZ91240.1| tryptophanyl-tRNA synthetase [Cyanothece sp. CCY0110]
          Length = 339

 Score =  256 bits (655), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 150/348 (43%), Positives = 205/348 (58%), Gaps = 27/348 (7%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQPTG LHLGNYLG IR  +  Q+  N+   + + DLHAIT     + L   +    
Sbjct: 7   LSGVQPTGNLHLGNYLGAIRTWVDIQD--NYDNFFCVVDLHAITVPHNPKTLAQDTYTIA 64

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+D     IF QS V  H++L+W+L+C+  + W+  MIQFKEK+ + + E  S+
Sbjct: 65  ALYLACGIDLDHATIFVQSHVSAHSELAWLLNCITPLNWLERMIQFKEKAVK-QGENVSV 123

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GL  YPVLMAADILLY A  VPVGEDQ+QHLE+TR IA R N +F  K   + +      
Sbjct: 124 GLLDYPVLMAADILLYNADKVPVGEDQKQHLELTRDIAIRINDQFGSKKTPILK------ 177

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                   + E LI    +R+ SL D ++KMSKSD SD SRINLLD PD+I KKI+K KT
Sbjct: 178 --------LPEPLIRKEGARVMSLADGTRKMSKSDPSDLSRINLLDPPDLIKKKIKKCKT 229

Query: 249 DGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           D       + GLE     R E  NL+ +++ + Q   EE   +     + QFK  L +  
Sbjct: 230 D------PIKGLEFDNKERPECNNLLGLYSLLSQKSKEEVATECQDMGWGQFKPLLTETT 283

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVG 352
           IE + PI +K Q ++ DK+YLD++L +G  +A   A ET+  V + +G
Sbjct: 284 IEALKPIQEKYQAIMDDKNYLDSVLRDGKEKAETVANETLTRVKDALG 331


>gi|297822027|ref|XP_002878896.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gi|297324735|gb|EFH55155.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
          Length = 411

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 148/350 (42%), Positives = 202/350 (57%), Gaps = 16/350 (4%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           VSGVQPTG +HLGNYLG I+N +  Q+T   L  + I D HAIT       L   +    
Sbjct: 68  VSGVQPTGSIHLGNYLGAIKNWVALQDTYETL--FIIVDCHAITLPYDTHQLGKATTDTA 125

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+D S+  +F QS V  HA L W+LS    +GW+  M QFKEKS++   E AS+
Sbjct: 126 ALYLACGIDVSKASVFVQSHVPAHAQLMWLLSASTPIGWLKKMTQFKEKSRKEGAEDASV 185

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEF-ERKIKEVAQKYAQE 187
            LF YP LM ADILLY++  VPVGEDQ+QH+E+ R IAQR N  +  RK K++       
Sbjct: 186 ALFTYPDLMTADILLYQSDFVPVGEDQKQHIELAREIAQRVNHLYGGRKWKKLG---GYR 242

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F I E LI  + +R+ SL D   KMSKS  SD SRINLLD+ D+I  KI++ K
Sbjct: 243 TLRGGSLFKIPEPLIPQAGARVMSLTDGLSKMSKSAPSDQSRINLLDSKDLIVDKIKRCK 302

Query: 248 TDGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           TD        +GLE     R E  NL+ ++  +     EE  ++    ++  FK  LADA
Sbjct: 303 TD------SFAGLEFDNAERPECNNLLSVYQIVSGKTKEEVTEECKDMSWGTFKPLLADA 356

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           +IE + PI  + Q ++ + +YLD +L EGA+RA      TM+ +++ +G 
Sbjct: 357 LIEHLSPIQARYQEIIAEPAYLDKVLSEGADRAAELGDVTMRNMHQAMGF 406


>gi|17228764|ref|NP_485312.1| tryptophanyl-tRNA synthetase [Nostoc sp. PCC 7120]
 gi|25009437|sp|Q8YXE4|SYW_ANASP RecName: Full=Tryptophanyl-tRNA synthetase; AltName:
           Full=Tryptophan--tRNA ligase; Short=TrpRS
 gi|17130616|dbj|BAB73226.1| tryptophanyl-tRNA synthetase [Nostoc sp. PCC 7120]
          Length = 335

 Score =  256 bits (653), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 144/350 (41%), Positives = 198/350 (56%), Gaps = 28/350 (8%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQPTG LHLGNYLG IRN +  Q+  ++   + + DLHAIT       L   +    
Sbjct: 7   LSGVQPTGNLHLGNYLGAIRNWVEIQDQYDNF--FCVVDLHAITVPHNPATLAADTYAIA 64

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+D   + IF QS V  H++L+W L+C+  + W+ +MIQFKEK+ +  E   + 
Sbjct: 65  ALYLACGIDLKYSNIFVQSHVSAHSELAWFLNCITPLNWLQDMIQFKEKAVKQGENVGA- 123

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GL +YPVLMAADILLY+A  VPVGEDQ+QHLE+TR I  RFN +F +             
Sbjct: 124 GLLIYPVLMAADILLYQADKVPVGEDQKQHLELTRDIVNRFNHQFAK------------- 170

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
              K    + E LI    +R+ SL D ++KMSKSD S+ SRINLLD PD IA KI++ KT
Sbjct: 171 --DKPVMKLPEPLIRKEGARVMSLTDGTRKMSKSDPSELSRINLLDPPDQIANKIKRCKT 228

Query: 249 DGDVLPSEVSGL----ENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           D       V GL      R E  NL+ ++  +   K EE   +     + QFK    +  
Sbjct: 229 D------PVKGLTFDDPERPECNNLLTLYMLLSGKKKEEVAAECQDMGWGQFKPLFTETA 282

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
           I  + PI +K Q +  DK YL+++L +G  +A   A +T+  V   +G S
Sbjct: 283 INALKPIQEKYQEITADKGYLESVLRDGREKAETVANQTLADVKAALGYS 332


>gi|307257998|ref|ZP_07539751.1| Tryptophanyl-tRNA synthetase [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|306863545|gb|EFM95475.1| Tryptophanyl-tRNA synthetase [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
          Length = 342

 Score =  255 bits (652), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 143/344 (41%), Positives = 207/344 (60%), Gaps = 11/344 (3%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQP+G L +GNYLG +RN ++ Q+  + L  + I DLHAIT       LR  S   +A
Sbjct: 8   SGVQPSGELTIGNYLGALRNWVKMQDDYDCL--FCIVDLHAITVRQDPAALRKASLDVLA 65

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LA G+DP+++ IF QS V  H  L+W+L+C    G M+ M QFK+KS    EE  ++G
Sbjct: 66  LYLACGIDPNKSTIFIQSHVPEHTQLAWVLNCYTYFGEMSRMTQFKDKSAR-YEENVNVG 124

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YPVLMAADILLY+A  VPVG+DQ+QHLEITR IA RFN  + +K          E  
Sbjct: 125 LFTYPVLMAADILLYQANQVPVGDDQKQHLEITRDIANRFNALYSKK--------DAEGN 176

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
             +  F + E  I  + +R+ SL + +KKMSKSD +  + I+LL++P  +AKKI++A TD
Sbjct: 177 VLEPVFQVPEVFIGKAGARVMSLLEPTKKMSKSDENRNNVISLLEDPKAVAKKIKRAMTD 236

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
           GD  P      EN+    NL++I + +    I E   +F GK +   K  +A+ V   + 
Sbjct: 237 GDDPPVVRYDRENKAGVSNLLDILSAVSGKAIAELEAEFEGKMYGHLKTEVAEQVSSLLT 296

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + ++  H  +D++ L+ I  EGA +AR RA++T+  V ++VG 
Sbjct: 297 DLQERYNHFRQDEALLERIFREGAEKARVRARKTLDEVYKLVGF 340


>gi|145639385|ref|ZP_01794990.1| tryptophanyl-tRNA synthetase [Haemophilus influenzae PittII]
 gi|145271432|gb|EDK11344.1| tryptophanyl-tRNA synthetase [Haemophilus influenzae PittII]
          Length = 334

 Score =  255 bits (652), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 144/344 (41%), Positives = 204/344 (59%), Gaps = 21/344 (6%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQP+G L +GNYLG +RN ++ QE  ++  ++ + DLHAIT       LR  +   +A
Sbjct: 8   SGVQPSGELTIGNYLGALRNWVKMQE--DYECIFCVVDLHAITVRQDPVALRKATLDVLA 65

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LA G+DP+++ IF QS V  H+ LSW+L+C    G M+ M QFK+KS    EE  ++G
Sbjct: 66  LYLACGIDPNKSTIFVQSHVPEHSQLSWVLNCYTYFGEMSRMTQFKDKSAR-YEENINVG 124

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YPVLMAADILLY+A  VPVG+DQ+QHLEITR IA RFN  +                
Sbjct: 125 LFDYPVLMAADILLYQAKSVPVGDDQKQHLEITRDIANRFNALY---------------- 168

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                F I E  I  + +RI SL+D  KKMSKSD +  + + LL++P  +AKKI++A TD
Sbjct: 169 --GNIFTIPEIFIGKAGARIMSLQDPEKKMSKSDDNRNNVVTLLEDPKSVAKKIKRAVTD 226

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            D  P     ++N+    NL++I + +    I +  K+F GK +   K A+AD V   + 
Sbjct: 227 SDEPPVVRYDVQNKAGVSNLLDILSAVTDKPIADLEKEFEGKMYGHLKTAVADEVSTLLA 286

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + ++      D++ LD IL +GA +AR +AQET+  V E VG 
Sbjct: 287 GLQERFHQYRNDEALLDNILRQGAEKARAKAQETLAKVYEAVGF 330


>gi|126313569|ref|XP_001366880.1| PREDICTED: similar to Tryptophanyl tRNA synthetase 2
           (mitochondrial) [Monodelphis domestica]
          Length = 362

 Score =  255 bits (652), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 141/347 (40%), Positives = 214/347 (61%), Gaps = 29/347 (8%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQEN-LRYQSRL-F 67
           SG+QPTG+ HLGNYLG I + +  QE C+ + ++ I DLH+IT  + Q+  + +QS L  
Sbjct: 42  SGIQPTGIPHLGNYLGAIESWVSLQEKCSSV-LFSIVDLHSIT--VPQDPAVLHQSILDI 98

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A  LA G++P ++I+F+QS V  H++L WI  C+ RM W+ N+ Q+K K+   K+E  +
Sbjct: 99  TAVLLACGINPEKSILFQQSQVPEHSELGWIFGCLVRMSWLQNLPQWKRKNASLKQE-GT 157

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GLF YPVL AADILLY++THVPVGEDQ  H+E+ R +AQRFN           +KY + 
Sbjct: 158 VGLFTYPVLQAADILLYKSTHVPVGEDQVTHMELARDLAQRFN-----------KKYGE- 205

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                 FFP+   L+ ++  R++SLRD S KMSKSD    + + + D+P+ I  K +KA 
Sbjct: 206 ------FFPVPTSLL-TTMKRVKSLRDPSAKMSKSDPDKLATVRVTDSPEEIMMKFRKAV 258

Query: 248 TDGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
           TD     SEV+     RL   N+++I A +  + IEE + Q  G + +Q+K+ +A+AVI+
Sbjct: 259 TD---FTSEVTYDPSTRLGVSNMVDIHAAVTGLTIEEVICQSVGLDTAQYKVVVAEAVIQ 315

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           +  PI  +I+ L  D+ YL  +L  G  +A+  A+   + V ++VG 
Sbjct: 316 KFAPIKNEIERLKMDEGYLRKVLQVGTEKAKELAKPVCQEVKKLVGF 362


>gi|75909202|ref|YP_323498.1| tryptophanyl-tRNA synthetase [Anabaena variabilis ATCC 29413]
 gi|75702927|gb|ABA22603.1| tryptophanyl-tRNA synthetase [Anabaena variabilis ATCC 29413]
          Length = 335

 Score =  255 bits (652), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 143/350 (40%), Positives = 198/350 (56%), Gaps = 28/350 (8%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQPTG LHLGNYLG IRN +  Q+  ++   + + DLHAIT       L   +    
Sbjct: 7   LSGVQPTGNLHLGNYLGAIRNWVEIQDQYDNF--FCVVDLHAITVPHNPATLAADTYAIA 64

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+D   + +F QS V  H +L+W L+C+  + W+ +MIQFKEK+ +  E   + 
Sbjct: 65  ALYLACGIDLKYSNVFVQSHVSAHTELAWFLNCITPLNWLQDMIQFKEKAVKQGENVGA- 123

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GL +YPVLMAADILLY+A  VPVGEDQ+QHLE+TR I  RFN +F +             
Sbjct: 124 GLLIYPVLMAADILLYQADKVPVGEDQKQHLELTRDIVNRFNHQFAK------------- 170

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
              K    + E LI    +R+ SL D ++KMSKSD S+ SRIN+LD PD IA KI++ KT
Sbjct: 171 --DKPVLKLPEPLIRKEGARVMSLTDGTRKMSKSDPSELSRINVLDPPDQIANKIKRCKT 228

Query: 249 DGDVLPSEVSGL----ENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           D       V GL      R E  NL+ ++  +   K EE   +     + QFK  L +  
Sbjct: 229 D------PVKGLTFDDPERPECNNLLTLYMLLSGKKKEEVAAECQDMGWGQFKPLLTETA 282

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
           I  + PI +K Q +  DK YL+++L +G  +A   A +T+  V   +G S
Sbjct: 283 INALKPIQEKYQEITADKGYLESVLRDGREKAEAVANQTLADVRAALGYS 332


>gi|307246826|ref|ZP_07528892.1| Tryptophanyl-tRNA synthetase [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307255810|ref|ZP_07537612.1| Tryptophanyl-tRNA synthetase [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307260262|ref|ZP_07541970.1| Tryptophanyl-tRNA synthetase [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|306852297|gb|EFM84536.1| Tryptophanyl-tRNA synthetase [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306861273|gb|EFM93265.1| Tryptophanyl-tRNA synthetase [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306865709|gb|EFM97589.1| Tryptophanyl-tRNA synthetase [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
          Length = 342

 Score =  255 bits (652), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 143/344 (41%), Positives = 207/344 (60%), Gaps = 11/344 (3%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQP+G L +GNYLG +RN ++ Q+  + L  + I DLHAIT       LR  S   +A
Sbjct: 8   SGVQPSGELTIGNYLGALRNWVKMQDDYDCL--FCIVDLHAITVRQDPAALRKASLDVLA 65

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LA G+DP+++ IF QS V  H  L+W+L+C    G M+ M QFK+KS    EE  ++G
Sbjct: 66  LYLACGIDPNKSTIFIQSHVPEHTQLAWVLNCYTYFGEMSRMTQFKDKSAR-YEENVNVG 124

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YPVLMAADILLY+A  VPVG+DQ+QHLEITR IA RFN  + +K          E  
Sbjct: 125 LFTYPVLMAADILLYQANQVPVGDDQKQHLEITRDIANRFNALYGKK--------DAEGN 176

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
             +  F + E  I  + +R+ SL + +KKMSKSD +  + I LL++P  +AKKI++A TD
Sbjct: 177 VLEPVFQVPEVFIGKAGARVMSLLEPTKKMSKSDENRNNVIGLLEDPKAVAKKIKRAMTD 236

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
           GD  P      EN+    NL++I + +    I E   +F GK +   K  +A+ V   + 
Sbjct: 237 GDEPPVVRYDRENKAGVSNLLDILSAVSGKTIAELEAEFEGKMYGHLKTEVAEQVSSLLT 296

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + ++  H  +D++ L+ I  EGA +AR RA++T++ V ++VG 
Sbjct: 297 DLQERYNHFRQDEALLERIFREGAEKARARARKTLEEVYKLVGF 340


>gi|30682913|ref|NP_850070.1| OVA4 (ovule abortion 4); ATP binding / aminoacyl-tRNA ligase/
           nucleotide binding / tryptophan-tRNA ligase [Arabidopsis
           thaliana]
 gi|19698905|gb|AAL91188.1| putative trytophanyl-tRNA synthetase [Arabidopsis thaliana]
 gi|24899787|gb|AAN65108.1| putative trytophanyl-tRNA synthetase [Arabidopsis thaliana]
 gi|330252664|gb|AEC07758.1| tryptophanyl-tRNA synthetase [Arabidopsis thaliana]
          Length = 408

 Score =  255 bits (652), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 149/348 (42%), Positives = 202/348 (58%), Gaps = 18/348 (5%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           VSGVQPTG +HLGNYLG I+N +  Q+T   L  + I D HAIT       L   +    
Sbjct: 68  VSGVQPTGSVHLGNYLGAIKNWVALQDTYETL--FIIVDHHAITLPYDTRQLGKATTDTA 125

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+D S+  +F QS V  H +L W+L     +GW+  MIQFKEKS++   E AS+
Sbjct: 126 ALYLACGIDVSKASVFVQSHVPAHVELMWLLCSSTPIGWLQKMIQFKEKSRKEGVENASV 185

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GLF YP LM ADILLY++  VPVGEDQ+QH+E+ R IAQR N  +        +K+ +  
Sbjct: 186 GLFTYPDLMTADILLYQSDFVPVGEDQKQHIELAREIAQRVNHLY------GGKKWKKLG 239

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                 F I E LI  + +R+ SL D   KMSKS  SD SRINLLD+ D+I  KI++ KT
Sbjct: 240 GRGGSLFKIPEPLIPQAGARVMSLTDGLSKMSKSAPSDQSRINLLDSKDLIVDKIKRCKT 299

Query: 249 DGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           D        +GLE     R E  NL+ I+  +   K EE +++    ++  FK  LADA+
Sbjct: 300 DS------FAGLEFDNAERPECNNLLSIYQIVSGKKKEEVMEECKDMSWGTFKPLLADAL 353

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVG 352
           IE + PI  + Q ++ +  YLD IL EGA+RA      TM+ + + +G
Sbjct: 354 IEHLSPIQARYQEIIAEPEYLDKILSEGADRAEELGAVTMRNMYQAMG 401


>gi|255327368|ref|ZP_05368442.1| tryptophan--tRNA ligase [Rothia mucilaginosa ATCC 25296]
 gi|255295648|gb|EET74991.1| tryptophan--tRNA ligase [Rothia mucilaginosa ATCC 25296]
          Length = 354

 Score =  255 bits (652), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 141/346 (40%), Positives = 203/346 (58%), Gaps = 23/346 (6%)

Query: 10  SGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           SG QP+   +HLGNY+G + N +  Q+  N+  ++FI D+HAIT     E LR ++RL  
Sbjct: 24  SGAQPSADSMHLGNYIGAVNNWVALQDDPNNECLFFIPDMHAITVPQNPEELRERTRLTA 83

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A ++A+G+DP+R  +F QS V  HA L+W+L+C    G  + M QFK+KS++   E AS+
Sbjct: 84  AQYIASGIDPTRTPLFVQSHVPEHAQLAWVLNCFTGFGEASRMTQFKDKSQKQGAENASV 143

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GLF YP+LMAADILLY+   VPVGEDQRQHLE+TR +AQRFN+ F               
Sbjct: 144 GLFTYPILMAADILLYQVDGVPVGEDQRQHLELTRNLAQRFNSRFGET------------ 191

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                 F + E +I    ++I  L+D + KMSKS  SD   I LLD P    KKI+ A T
Sbjct: 192 ------FVVPEPVILKETAKIYDLQDPTSKMSKSAVSDKGLIKLLDTPKTTQKKIKSAVT 245

Query: 249 -DGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
            DG V+  +    E +    NL+ I++ M    I+E + ++ GK +   K+ LAD V+E 
Sbjct: 246 DDGSVIAYD---REAKPGVSNLLSIYSAMTGESIDEIVARYEGKMYGHLKVDLADIVVER 302

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + P+ ++   L+ D + LD +L  GA+ AR  A  T++ V + VG 
Sbjct: 303 LTPVRERTLELMDDPAELDRLLAVGASAAREIATVTIENVYKKVGF 348


>gi|300743783|ref|ZP_07072803.1| tryptophan--tRNA ligase [Rothia dentocariosa M567]
 gi|300380144|gb|EFJ76707.1| tryptophan--tRNA ligase [Rothia dentocariosa M567]
          Length = 354

 Score =  255 bits (651), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 141/346 (40%), Positives = 205/346 (59%), Gaps = 23/346 (6%)

Query: 10  SGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           SG QP+   +HLGNY+G + N +  QE   +  ++FI D+HAIT     ++LR ++RL  
Sbjct: 24  SGAQPSADSMHLGNYIGAVNNWVALQEDPANECLFFIPDMHAITVPQDPQSLRERTRLTA 83

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A ++AAG+DP+R+  F QS V  HA L+W+L+C    G  + M QFK+KS++   + AS+
Sbjct: 84  AQYIAAGIDPARSPFFVQSQVPEHAQLAWVLNCFTGFGEASRMTQFKDKSQKQGADNASV 143

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GLF YPVLMAADILLY+   VPVGEDQRQHLE+TR +AQRFN+ F               
Sbjct: 144 GLFTYPVLMAADILLYQVDGVPVGEDQRQHLELTRNLAQRFNSRFGET------------ 191

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                 F + E +I    ++I  L+D + KMSKS +SD   I LLD P    KKI+ A T
Sbjct: 192 ------FVVPEPIIMKETAKIYDLQDPTSKMSKSAASDKGLIKLLDEPKATVKKIKSAVT 245

Query: 249 -DGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
            DG V+  +    E +    NL+ I++ M    I+  +K++ GK +   K+ LAD V+E+
Sbjct: 246 DDGSVIAYD---REAKPGVSNLLSIYSAMTGESIDSLVKRYEGKMYGHLKVDLADVVVEK 302

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + P+ ++   L+ D + LD +L  GA +AR  A  T++ V + VG 
Sbjct: 303 LSPLRERTLELMADPAELDRLLALGAQKAREIATVTIENVYDKVGF 348


>gi|283458669|ref|YP_003363304.1| tryptophanyl-tRNA synthetase [Rothia mucilaginosa DY-18]
 gi|283134719|dbj|BAI65484.1| tryptophanyl-tRNA synthetase [Rothia mucilaginosa DY-18]
          Length = 371

 Score =  255 bits (651), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 140/346 (40%), Positives = 204/346 (58%), Gaps = 23/346 (6%)

Query: 10  SGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           SG QP+   +HLGNY+G + N +  Q+  N+  ++FI D+HAIT     E LR ++RL  
Sbjct: 41  SGAQPSADSMHLGNYIGAVNNWVALQDDPNNECLFFIPDMHAITVPQNPEELRERTRLTA 100

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A ++A+G+DP+R  +F QS V  HA L+W+L+C    G  + M QFK+KS++   E AS+
Sbjct: 101 AQYIASGIDPTRTPLFVQSHVPEHAQLAWVLNCFTGFGEASRMTQFKDKSQKQGAENASV 160

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GLF YP+LMAADILLY+   VPVGEDQRQHLE+TR +AQRFN+ F               
Sbjct: 161 GLFTYPILMAADILLYQVDGVPVGEDQRQHLELTRNLAQRFNSRFGET------------ 208

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                 F + E +I    ++I  L+D + KMSKS ++D   I LLD P    KKI+ A T
Sbjct: 209 ------FVVPEPVILKETAKIYDLQDPTSKMSKSAATDKGLIKLLDTPKATQKKIKSAVT 262

Query: 249 -DGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
            DG V+  +    E +    NL+ I++ M    I+E + ++ GK +   K+ LAD V+E 
Sbjct: 263 DDGSVIAYD---REAKPGVSNLLSIYSAMTGESIDEIVARYEGKMYGHLKVDLADIVVER 319

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + P+ ++   L+ D + LD +L  GA+ AR  A  T++ V + VG 
Sbjct: 320 LTPVRERTLELMDDPAELDRLLAVGASAAREIATVTIENVYKKVGF 365


>gi|303249680|ref|ZP_07335885.1| tryptophanyl-tRNA synthetase [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307253582|ref|ZP_07535450.1| Tryptophanyl-tRNA synthetase [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|302651492|gb|EFL81643.1| tryptophanyl-tRNA synthetase [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306858962|gb|EFM91007.1| Tryptophanyl-tRNA synthetase [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
          Length = 342

 Score =  255 bits (651), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 143/344 (41%), Positives = 206/344 (59%), Gaps = 11/344 (3%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQP+G L +GNYLG +RN ++ Q+  + L  + I DLHAIT       LR  S   +A
Sbjct: 8   SGVQPSGELTIGNYLGALRNWVKMQDDYDCL--FCIVDLHAITVRQDPAALRKASLDVLA 65

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LA G+DP+++ IF QS V  H  L+W+L+C    G M+ M QFK+KS    EE  ++G
Sbjct: 66  LYLACGIDPNKSTIFIQSHVPEHTQLAWVLNCYTYFGEMSRMTQFKDKSAR-YEENVNVG 124

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YPVLMAADILLY+A  VPVG+DQ+QHLEITR IA RFN  + +K          E  
Sbjct: 125 LFTYPVLMAADILLYQANQVPVGDDQKQHLEITRDIANRFNALYSKK--------DAEGN 176

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
             +  F + E  I  + +R+ SL + +KKMSKSD +  + I LL++P  +AKKI++A TD
Sbjct: 177 VLEPVFQVPEVFIGKAGARVMSLLEPTKKMSKSDENRNNVIGLLEDPKAVAKKIKRAMTD 236

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
           GD  P      EN+    NL++I + +    I E   +F GK +   K  +A+ V   + 
Sbjct: 237 GDEPPVVRYDRENKAGVSNLLDILSAVSGKAIAELEAEFEGKMYGHLKTEVAEQVSSLLT 296

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + ++  H  +D++ L+ I  EGA +AR RA++T+  V ++VG 
Sbjct: 297 DLQERYNHFRQDEALLERIFREGAEKARVRARKTLDEVYKLVGF 340


>gi|113478069|ref|YP_724130.1| tryptophanyl-tRNA synthetase [Trichodesmium erythraeum IMS101]
 gi|110169117|gb|ABG53657.1| tryptophanyl-tRNA synthetase [Trichodesmium erythraeum IMS101]
          Length = 339

 Score =  255 bits (651), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 140/350 (40%), Positives = 202/350 (57%), Gaps = 28/350 (8%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQPTG LH+GNYLG IRN +  Q+  ++   + + DLHAIT       L   +    
Sbjct: 7   LSGVQPTGNLHIGNYLGAIRNWVEGQKEYDNF--FCVVDLHAITVPHNPVTLATDTYTIA 64

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+D + + IF QS +  H++L+W L+C+  + W+ +MIQFKEK+ +  E   + 
Sbjct: 65  ALYLACGIDLNYSTIFVQSHIPAHSELTWFLNCITPLNWLTDMIQFKEKAIKQGENVGT- 123

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GL  YPVLMAADILLY A  VPVGEDQ+QHLE+TR IA RFN +F +             
Sbjct: 124 GLLDYPVLMAADILLYDADKVPVGEDQKQHLELTRDIAVRFNHQFGQ------------- 170

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
              +    + + LI    +R+ SL D + KMSKSD S+ SRINLLD PD+I KKI++ KT
Sbjct: 171 --GRTILKLPDPLIRKEGARVMSLTDGTSKMSKSDPSELSRINLLDPPDVITKKIKRCKT 228

Query: 249 DGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           D       + GLE     R E  NL+ ++        EE + +     + +FK  L +A 
Sbjct: 229 D------VIKGLEFDNPERPECNNLLTLYELFSAKTKEEVITECQDLGWGKFKPLLTEAT 282

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
           IE + PI  K + ++ D+ YL ++L +G  +A   A +T++ V + +G S
Sbjct: 283 IEALTPIQTKYKAVMDDQGYLKSVLAQGKQKAEAIANQTLEKVKKALGYS 332


>gi|145347571|ref|XP_001418237.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144578466|gb|ABO96530.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 342

 Score =  255 bits (651), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 145/350 (41%), Positives = 201/350 (57%), Gaps = 22/350 (6%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQEN-LRYQSRLF 67
           +SGVQPTG +HLGNY G I+N ++ QE  ++   Y + DLHAIT        L   +R  
Sbjct: 7   LSGVQPTGSIHLGNYFGAIKNYVKLQE--DYDAFYCVVDLHAITAGGHDPTALEASTRTS 64

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A +LAAGV P +  +F QS V  H++L W+L+C A +GW+  MIQFKEK+++  EE  S
Sbjct: 65  AAIYLAAGVSPEKANVFVQSHVPAHSELCWLLNCAAPIGWLEKMIQFKEKARKAGEEV-S 123

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GL  YPVLMAADILLY+A  VPVGEDQRQHLE+TR IA R N+ +  K  +  +     
Sbjct: 124 VGLLDYPVLMAADILLYKADLVPVGEDQRQHLELTRDIAGRVNSLYGGKKWKKRK----- 178

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                    + E        R+ SL D + KMSKS+ ++ SRIN+LD PD IAKK+++ K
Sbjct: 179 ---GGDVLMVPEAFTPKEGGRVMSLTDGTAKMSKSNPAEGSRINVLDTPDEIAKKLKRCK 235

Query: 248 TDGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           TD         GLE     R EA NL+ ++     +  EE L + G   +  FK  L DA
Sbjct: 236 TDA------FEGLEFGNPERPEANNLLTMYQLCTGLTQEEVLAECGSMRWGDFKPHLTDA 289

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           VI  + PI  + + ++ +  YL+ +L  GA  A   A  T++ V + +G 
Sbjct: 290 VIAHLSPIQGRYKEIMDEPGYLEDVLKRGAENANEVANLTLRDVRDAMGF 339


>gi|68249215|ref|YP_248327.1| tryptophanyl-tRNA synthetase [Haemophilus influenzae 86-028NP]
 gi|68057414|gb|AAX87667.1| tryptophanyl-tRNA synthetase [Haemophilus influenzae 86-028NP]
          Length = 336

 Score =  255 bits (651), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 144/353 (40%), Positives = 206/353 (58%), Gaps = 21/353 (5%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENL 60
           M+ +  +  SGVQP+G L +GNYLG +RN ++ QE  ++  ++ + DLHAIT       L
Sbjct: 1   MIMAKPIVFSGVQPSGELTIGNYLGALRNWVKMQE--DYECIFCVVDLHAITVRQDPVAL 58

Query: 61  RYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKE 120
           R  +   +A +LA G+DP+++ IF QS V  H  LSW+L+C    G M+ M QFK+KS  
Sbjct: 59  RKATLDVLALYLACGIDPNKSTIFVQSHVPEHTQLSWVLNCYTYFGEMSRMTQFKDKSAR 118

Query: 121 NKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEV 180
             E   ++GLF YPVLMAADILLY+A  VPVG+DQ+QHLEITR IA RFN  +       
Sbjct: 119 YAENI-NVGLFDYPVLMAADILLYQAKSVPVGDDQKQHLEITRDIANRFNALY------- 170

Query: 181 AQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIA 240
                         F I E  I  + +RI SL+D  KKMSKSD +  + + LL++P  +A
Sbjct: 171 -----------GNIFTIPEIFIGKAGARIMSLQDPEKKMSKSDDNRNNVVTLLEDPKSVA 219

Query: 241 KKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLAL 300
           KKI++A TD D  P     ++N+    NL++I + +    I +  K+F GK +   K A+
Sbjct: 220 KKIKRAVTDSDEPPVVRYDVQNKAGVSNLLDILSAVTDKPIADLEKEFEGKMYGHLKTAV 279

Query: 301 ADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           AD V   +  + ++      D++ LD IL +GA +AR +AQET+  V E VG 
Sbjct: 280 ADEVSTLLAGLQERFHQYRNDETLLDNILRQGAEKARAKAQETLAKVYEAVGF 332


>gi|169153909|emb|CAQ14505.1| novel protein similar to vertebrate tryptophanyl tRNA synthetase 2
           (mitochondrial) (WARS2, zgc:110828) [Danio rerio]
          Length = 364

 Score =  254 bits (650), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 146/351 (41%), Positives = 210/351 (59%), Gaps = 26/351 (7%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  L  SG+QPTG+ HLGNYLG + + +  Q+  + + MY I DLH+IT     + LR  
Sbjct: 38  SKGLVFSGIQPTGIPHLGNYLGALESWVALQDDYSTV-MYSIVDLHSITQPQDPQVLRDN 96

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
                AS LA G+DP+R+I+F+QS V  HA+LSWIL C+  M  + ++ Q+K KSK+  E
Sbjct: 97  IMDMAASLLACGIDPTRSILFQQSQVSEHAELSWILGCLTSMPRLRHLPQWKMKSKQKNE 156

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
              S+GL+ YPVL AADILLY++THVPVGEDQ QHLE+ + +A+ FN ++          
Sbjct: 157 --GSVGLYTYPVLQAADILLYKSTHVPVGEDQIQHLELAQDLARIFNNQYGE-------- 206

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
                     FFP    L+ S   +++SLRD S KMSKSD   FS + L D PD IA KI
Sbjct: 207 ----------FFPEPRALL-SGTRKVKSLRDPSSKMSKSDPQRFSAVFLTDTPDDIALKI 255

Query: 244 QKAKTDGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALAD 302
           ++A TD     SEV+   + R    NL+ + A +    IE  ++   G +  Q+K  +A+
Sbjct: 256 RRAVTD---FTSEVTYEPDTRPGVSNLVSMHAAVSGQTIEGVIRLAEGMDTGQYKNMVAE 312

Query: 303 AVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           A+I+++ PI  +IQ L  D+ YL+++L +GA +AR  A   MK V +++G 
Sbjct: 313 AIIKKLQPIRLEIQRLRADQGYLESLLAQGAEKARSLAAPVMKEVRKLLGF 363


>gi|165977336|ref|YP_001652929.1| tryptophanyl-tRNA synthetase [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|307251164|ref|ZP_07533086.1| Tryptophanyl-tRNA synthetase [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|165877437|gb|ABY70485.1| tryptophanyl-tRNA synthetase [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|306856830|gb|EFM88964.1| Tryptophanyl-tRNA synthetase [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
          Length = 342

 Score =  254 bits (650), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 143/344 (41%), Positives = 206/344 (59%), Gaps = 11/344 (3%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQP+G L +GNYLG +RN ++ Q+  + L  + I DLHAIT       LR  S   +A
Sbjct: 8   SGVQPSGELTIGNYLGALRNWVKMQDDYDCL--FCIVDLHAITVRQDPAALRKASLDVLA 65

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LA G+DP+++ IF QS V  H  L+W+L+C    G M+ M QFK+KS    EE  ++G
Sbjct: 66  LYLACGIDPNKSTIFIQSHVPEHTQLAWVLNCYTYFGEMSRMTQFKDKSAR-YEENVNVG 124

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YPVLMAADILLY+A  VPVG+DQ+QHLEITR IA RFN  + +K          E  
Sbjct: 125 LFTYPVLMAADILLYQANQVPVGDDQKQHLEITRDIANRFNALYGKK--------DAEGN 176

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
             +  F + E  I  + +R+ SL + +KKMSKSD +  + I LL++P  +AKKI++A TD
Sbjct: 177 VLEPVFQVPEVFIGKAGARVMSLLEPTKKMSKSDENRNNVIGLLEDPKAVAKKIKRAMTD 236

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
           GD  P      EN+    NL++I + +    I E   +F GK +   K  +A+ V   + 
Sbjct: 237 GDEPPVVRYDRENKAGVSNLLDILSAVSGKAIAELEAEFEGKMYGHLKTEVAEQVSSLLT 296

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + ++  H  +D++ L+ I  EGA +AR RA++T+  V ++VG 
Sbjct: 297 DLQERYNHFRQDEALLERIFREGAEKARVRARKTLDEVYKLVGF 340


>gi|302388847|ref|YP_003824668.1| tryptophanyl-tRNA synthetase [Thermosediminibacter oceani DSM
           16646]
 gi|302199475|gb|ADL07045.1| tryptophanyl-tRNA synthetase [Thermosediminibacter oceani DSM
           16646]
          Length = 342

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 140/352 (39%), Positives = 214/352 (60%), Gaps = 23/352 (6%)

Query: 2   LSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLR 61
           +S      SG QP+G + LGN+LG I+N +  Q+  + +  Y I DLHA+T     +  R
Sbjct: 1   MSGKKRIFSGAQPSGSVTLGNFLGAIKNWVELQDKYDCI--YCIVDLHALTVRQDPKVFR 58

Query: 62  YQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKEN 121
            +   F+A +LA G+DP +N+++ QS V  HA+L+WIL+C   MG ++ M QFKEK++++
Sbjct: 59  ERCYSFLAQYLACGLDPEKNVVYFQSHVSAHAELAWILNCYTYMGELSRMTQFKEKARKH 118

Query: 122 KEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVA 181
            ++  + GLF YPVLMAADILL++   VPVGEDQ+QH+E+TR IA RFN  +        
Sbjct: 119 -QDNINAGLFTYPVLMAADILLFQTDLVPVGEDQKQHVELTRDIATRFNNLYGE------ 171

Query: 182 QKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAK 241
                        F I E  I    +RI SL + +KKMSKSD ++ S I LLD PD+I K
Sbjct: 172 ------------VFKIPEPYIPEVGARIMSLLEPTKKMSKSDENENSYILLLDPPDVIMK 219

Query: 242 KIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALA 301
           K ++A TD + +      +E +    NL+ I+A +     EE  ++F GK + +FK A+A
Sbjct: 220 KFKRAVTDSEAVVR--YDVERKPGISNLMNIYAAVTGRSFEEIEREFEGKGYGEFKKAVA 277

Query: 302 DAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + VI+++ PI +K   L+ +K Y+++++  GA RA+  A+ET+K V + +GL
Sbjct: 278 EVVIDKLRPIREKYDELMANKDYMESVIKNGAERAQELARETLKKVYDKIGL 329


>gi|16272580|ref|NP_438797.1| tryptophanyl-tRNA synthetase [Haemophilus influenzae Rd KW20]
 gi|260581387|ref|ZP_05849202.1| tryptophanyl-tRNA synthetase [Haemophilus influenzae RdAW]
 gi|1174552|sp|P43835|SYW_HAEIN RecName: Full=Tryptophanyl-tRNA synthetase; AltName:
           Full=Tryptophan--tRNA ligase; Short=TrpRS
 gi|1573633|gb|AAC22296.1| tryptophanyl-tRNA synthetase (trpS) [Haemophilus influenzae Rd
           KW20]
 gi|260091982|gb|EEW75930.1| tryptophanyl-tRNA synthetase [Haemophilus influenzae RdAW]
          Length = 334

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 143/344 (41%), Positives = 202/344 (58%), Gaps = 21/344 (6%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQP+G L +GNYLG +RN ++ QE  ++  ++ + DLHAIT       LR  +   +A
Sbjct: 8   SGVQPSGELTIGNYLGALRNWVKMQE--DYECIFCVVDLHAITVRQDPVALRKATLDVLA 65

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LA G+DP+++ IF QS V  H  LSW+L+C    G M+ M QFK+KS    E   ++G
Sbjct: 66  LYLACGIDPNKSTIFVQSHVPEHTQLSWVLNCYTYFGEMSRMTQFKDKSARYAENI-NVG 124

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YPVLMAADILLY+A  VPVG+DQ+QHLEITR IA RFN  +                
Sbjct: 125 LFDYPVLMAADILLYQAKSVPVGDDQKQHLEITRDIANRFNALY---------------- 168

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                F I E  I  + +RI SL+D  KKMSKSD +  + + LL++P  +AKKI++A TD
Sbjct: 169 --GNIFTIPEIFIGKAGARIMSLQDPEKKMSKSDDNRNNVVTLLEDPKSVAKKIKRAVTD 226

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            D  P     ++N+    NL++I + +    I +  K+F GK +   K A+AD V   + 
Sbjct: 227 SDEPPVVRYDVQNKAGVSNLLDILSAVTDKPIADLEKEFEGKMYGHLKTAVADEVSTLLA 286

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + ++      D++ LD IL +GA +AR +AQET+  V E VG 
Sbjct: 287 SLQERFHQYRNDETLLDNILRQGAEKARAKAQETLAKVYEAVGF 330


>gi|319897828|ref|YP_004136025.1| tryptophanyl-tRNA synthetase [Haemophilus influenzae F3031]
 gi|317433334|emb|CBY81711.1| tryptophanyl-tRNA synthetase [Haemophilus influenzae F3031]
          Length = 334

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 143/344 (41%), Positives = 202/344 (58%), Gaps = 21/344 (6%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQP+G L +GNYLG +RN ++ QE  ++  ++ + DLHAIT       LR  +   +A
Sbjct: 8   SGVQPSGELTIGNYLGALRNWVKMQE--DYECIFCVVDLHAITVRQDPVALRKATLDVLA 65

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LA G+DP+++ IF QS V  H  LSW+L+C    G M+ M QFK+KS    E   ++G
Sbjct: 66  LYLACGIDPNKSTIFVQSHVPEHTQLSWVLNCYTYFGEMSRMTQFKDKSARYTENI-NVG 124

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YPVLMAADILLY+A  VPVG+DQ+QHLEITR IA RFN  +                
Sbjct: 125 LFNYPVLMAADILLYQAKSVPVGDDQKQHLEITRDIANRFNALY---------------- 168

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                F I E  I  + +RI SL+D  KKMSKSD +  + + LL++P  +AKKI++A TD
Sbjct: 169 --GNIFTIPEIFIGKAGARIMSLQDPEKKMSKSDDNRNNVVTLLEDPKSVAKKIKRAVTD 226

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            D  P     ++N+    NL++I + +    I +  K+F GK +   K A+AD V   + 
Sbjct: 227 SDEPPVVHYDVQNKAGVSNLLDILSAVTDKPIADLEKEFEGKMYGHLKTAVADEVSTLLA 286

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + ++      D++ LD IL +GA +AR +AQET+  V E VG 
Sbjct: 287 GLQERFHQYRNDETLLDNILRQGAEKARAKAQETLAKVYEAVGF 330


>gi|32034241|ref|ZP_00134452.1| COG0180: Tryptophanyl-tRNA synthetase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
          Length = 342

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 143/344 (41%), Positives = 205/344 (59%), Gaps = 11/344 (3%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQP+G L +GNYLG +RN ++ Q+  + L  + I DLHAIT       LR  S   +A
Sbjct: 8   SGVQPSGELTIGNYLGALRNWVKMQDDYDCL--FCIVDLHAITVRQDPAALRKASLDVLA 65

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LA G+DP+++ IF QS V  H  L+W+L+C    G M+ M QFK+KS    EE  ++G
Sbjct: 66  LYLACGIDPNKSTIFIQSHVPEHTQLAWVLNCYTYFGEMSRMTQFKDKSAR-YEENVNVG 124

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YPVLMAADILLY+A  VPVG+DQ+QHLEITR IA RFN  + +K          E  
Sbjct: 125 LFTYPVLMAADILLYQANQVPVGDDQKQHLEITRDIANRFNALYGKK--------DAEGN 176

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
             +  F + E  I  + +R+ SL + +KKMSKSD +  + I LL++P  +AKKI++A TD
Sbjct: 177 VLEPVFQVPEVFIGKAGARVMSLLEPTKKMSKSDENRNNVIGLLEDPKAVAKKIKRAMTD 236

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
           GD  P      EN+    NL++I + +    I E   +F GK +   K  +A  V   + 
Sbjct: 237 GDEPPVVRYDRENKAGVSNLLDILSAVSGKAIAELEAEFEGKMYGHLKTEVAKQVSSLLT 296

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + ++  H  +D++ L+ I  EGA +AR RA++T+  V ++VG 
Sbjct: 297 DLQERYNHFRQDEALLERIFREGAEKARVRARKTLDEVYKLVGF 340


>gi|218246868|ref|YP_002372239.1| tryptophanyl-tRNA synthetase [Cyanothece sp. PCC 8801]
 gi|257059910|ref|YP_003137798.1| tryptophanyl-tRNA synthetase [Cyanothece sp. PCC 8802]
 gi|218167346|gb|ACK66083.1| tryptophanyl-tRNA synthetase [Cyanothece sp. PCC 8801]
 gi|256590076|gb|ACV00963.1| tryptophanyl-tRNA synthetase [Cyanothece sp. PCC 8802]
          Length = 336

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 146/348 (41%), Positives = 205/348 (58%), Gaps = 27/348 (7%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQPTG LHLGNYLG IRN +  Q   N+   + + DLHAIT     + L   +    
Sbjct: 7   LSGVQPTGNLHLGNYLGAIRNWVEIQS--NYENFFCVVDLHAITVPHNPKTLAQDTYTIA 64

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+D + + IF QS V  H++L+W+L+C+  + W+  MIQFKEK+ + + E  S+
Sbjct: 65  ALYLACGIDLNHSTIFVQSHVSAHSELAWLLNCLTPLNWLERMIQFKEKALK-QGENVSV 123

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GL  YPVLMAADILLY A  VPVGEDQ+QHLE+TR I  RFN +F      V +      
Sbjct: 124 GLLDYPVLMAADILLYDADRVPVGEDQKQHLELTRDIVIRFNDQFATPENPVLK------ 177

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                   + E LI +  +R+ SL D ++KMSKSD S+ SRINLLD P++I KKI++ KT
Sbjct: 178 --------MPEPLIRTEGARVMSLTDGTRKMSKSDPSEMSRINLLDPPELIQKKIKRCKT 229

Query: 249 DGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           D       + GLE     R E  NL+ ++  + Q   +E + +     + +FK  L +  
Sbjct: 230 D------PIVGLEFDNPERPECNNLLGLYGLLSQKTKQEVITECQDMGWGKFKPLLTETT 283

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVG 352
           IE + PI  K Q ++ +K YLD++L EG  +A   A +T+  V E +G
Sbjct: 284 IEALKPIQLKYQEIMDNKDYLDSVLREGKEKAETVANQTLTRVKEALG 331


>gi|307262392|ref|ZP_07544038.1| Tryptophanyl-tRNA synthetase [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|306867940|gb|EFM99770.1| Tryptophanyl-tRNA synthetase [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
          Length = 342

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 143/344 (41%), Positives = 206/344 (59%), Gaps = 11/344 (3%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQP+G L +GNYLG +RN ++ Q+  + L  + I DLHAIT       LR  S   +A
Sbjct: 8   SGVQPSGELTIGNYLGALRNWVKMQDDYDCL--FCIVDLHAITVRQDPAALRKASLDVLA 65

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LA G+DP+++ IF QS V  H  L+W+L+C    G M+ M QFK+KS    EE  ++G
Sbjct: 66  LYLACGIDPNKSTIFIQSHVPEHTQLAWVLNCYTYFGEMSRMTQFKDKSAR-YEENVNVG 124

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YPVLMAADILLY+A  VPVG+DQ+QHLEITR IA RFN  + +K          E  
Sbjct: 125 LFTYPVLMAADILLYQANQVPVGDDQKQHLEITRDIANRFNALYGKK--------DAEGN 176

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
             +  F + E  I  + +R+ SL + +KKMSKSD +  + I+LL++P  +AKKI++A TD
Sbjct: 177 VLEPVFQVPEVFIGKAGARVMSLLEPTKKMSKSDENRNNVISLLEDPKAVAKKIKRAMTD 236

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
           GD  P      EN+    NL++I + +    I E   +F GK +   K  +A+ V   + 
Sbjct: 237 GDEPPVVRYDRENKAGVSNLLDILSAVSGKTIAELEAEFEGKMYGHLKTEVAEQVSTLLT 296

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            +  +  H  +D++ L+ I  EGA +AR RA++T+  V ++VG 
Sbjct: 297 DLQARYNHFRQDEALLERIFREGAEKARVRARKTLDEVYKLVGF 340


>gi|78212571|ref|YP_381350.1| tryptophanyl-tRNA synthetase [Synechococcus sp. CC9605]
 gi|78197030|gb|ABB34795.1| tryptophanyl-tRNA synthetase [Synechococcus sp. CC9605]
          Length = 337

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 146/351 (41%), Positives = 203/351 (57%), Gaps = 28/351 (7%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQPTG LHLGN+LG IRN +  QET  H     + DLHAIT       L   +R   
Sbjct: 7   LSGVQPTGALHLGNWLGAIRNWVDLQET--HDTFVCVVDLHAITVPHDPSRLAEDTRSTA 64

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+DP R  +F QS V  H++L W+L+CV  + W+  MIQFKEK+ + + +  S+
Sbjct: 65  ALYLACGMDPKRCSVFVQSQVAAHSELCWLLNCVTPLNWLERMIQFKEKAVK-QGDNVSV 123

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIA-QRFNTEFERKIKEVAQKYAQE 187
           GL  YPVLMAADILLY A  VPVGEDQ+QHLE+ R IA QR N  F  K   V +     
Sbjct: 124 GLLDYPVLMAADILLYDADLVPVGEDQKQHLELARDIAQQRINARFGDKETPVLK----- 178

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                    + + +I    +R+ SL D   KMSKSD ++ SRI LLD P++I KKI++AK
Sbjct: 179 ---------VPKPMILKEGARVMSLTDGRSKMSKSDPNEGSRITLLDPPELITKKIKRAK 229

Query: 248 TDGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           TD +       GLE    +R E  NL+ ++A +     E+A  + G   + QFK  LA+A
Sbjct: 230 TDPE------RGLEFGNPDRPETDNLLGLYAILSGKGREQAAAECGEMGWGQFKPLLAEA 283

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
            +  + PI  + + L++D + LD +L  G  +A   A  T++ V + +G +
Sbjct: 284 TVNALEPIQARYRELMQDPTELDQVLSTGREKAETVANATLERVRDALGFA 334


>gi|323449869|gb|EGB05754.1| hypothetical protein AURANDRAFT_70285 [Aureococcus anophagefferens]
          Length = 342

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 148/350 (42%), Positives = 210/350 (60%), Gaps = 27/350 (7%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQPTG LHLGNYLG IR  +  Q   + L  + + DLHAIT     ++L  ++    
Sbjct: 11  LSGVQPTGSLHLGNYLGAIRQWVEYQHEYDSL--FCVVDLHAITMPHDAKSLSRETLDAA 68

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A ++AAGV+P    IF QS V  HA+L+W+L+C+  M W+  MIQ+KEK K+ + E  ++
Sbjct: 69  ALYIAAGVEPDIAPIFVQSHVSAHAELAWLLNCMTPMNWLERMIQYKEK-KQKQGENVAV 127

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GLF YPVLMAADILLY+A  VPVGEDQRQHLE+TR IA+RF+  + ++ + V        
Sbjct: 128 GLFDYPVLMAADILLYQADLVPVGEDQRQHLELTRDIARRFHDLYCKRKRRV-------- 179

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                 F   + LI    +R+ SL D   KMSKS   D SRINL+D+PD+IA KI+K KT
Sbjct: 180 ------FREPKALIVKEGARVMSLADGKAKMSKSAPIDGSRINLVDSPDLIASKIKKCKT 233

Query: 249 DGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           D      ++ GLE    NR EA NL+ I+ ++  ++ E  L+     ++  FK  L DA+
Sbjct: 234 D------QLKGLEWDNPNRPEATNLLNIYQSVTGLEREVILRDVSDLSWGAFKPRLTDAI 287

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
           I  + PI +  + L  D+ +L   L +GA+RA   A +T+      +G++
Sbjct: 288 IAHLDPIQRAYKELAADQLFLSQTLKQGAHRADEIATKTLDDAKGAMGIT 337


>gi|182436495|ref|YP_001824214.1| tryptophanyl-tRNA synthetase [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|326777117|ref|ZP_08236382.1| tryptophanyl-tRNA synthetase [Streptomyces cf. griseus XylebKG-1]
 gi|178465011|dbj|BAG19531.1| putative tryptophanyl-tRNA synthetase [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|326657450|gb|EGE42296.1| tryptophanyl-tRNA synthetase [Streptomyces cf. griseus XylebKG-1]
          Length = 352

 Score =  253 bits (647), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 141/346 (40%), Positives = 195/346 (56%), Gaps = 23/346 (6%)

Query: 9   VSGVQPT-GVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SG+QPT G  HLGNYLG +R  +  QE+  H   Y + DLHAIT       LR  +RL 
Sbjct: 24  LSGIQPTAGSFHLGNYLGAVRQWVALQES--HDAFYMVVDLHAITIPQDPAELRANTRLA 81

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
           VA  LAAGVDP R  +F QS V  HA L W+++C+   G  + M QFK+KS +   + A+
Sbjct: 82  VAQLLAAGVDPERCTLFVQSHVPEHAQLGWVMNCLTGFGEASRMTQFKDKSAKQGADRAT 141

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GLF YPVL  ADILLY+A  VPVGEDQRQH+E+TR +A+RFN            +Y Q 
Sbjct: 142 VGLFTYPVLQVADILLYQANQVPVGEDQRQHIELTRDLAERFNG-----------RYGQT 190

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F +    I    ++I  L+D + KMSKS S+    INLLD+P + AKK++ A 
Sbjct: 191 -------FTVPAPYILKETAKIFDLQDPAVKMSKSASTPKGLINLLDDPKVTAKKVKSAV 243

Query: 248 TDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
           TD D +       E +    NL+ I +T+    +E+  + + GK +   K  LA+A++E 
Sbjct: 244 TDTDTVIR--FDAEEKPGVSNLLTILSTLSGSPVEDLERSYEGKGYGALKTDLAEAMVEF 301

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + P   + Q  L D   LD IL +GA +AR  A ET+    + +G 
Sbjct: 302 VTPFRSRTQQYLDDPETLDAILAKGAEKARAVAAETLAQTYDRMGF 347


>gi|152967912|ref|YP_001363696.1| tryptophanyl-tRNA synthetase [Kineococcus radiotolerans SRS30216]
 gi|151362429|gb|ABS05432.1| tryptophanyl-tRNA synthetase [Kineococcus radiotolerans SRS30216]
          Length = 346

 Score =  253 bits (647), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 143/351 (40%), Positives = 199/351 (56%), Gaps = 31/351 (8%)

Query: 8   FVSGVQPT-GVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
            +SG+QPT G LHLGNYLG ++  +  Q+T  H  +Y + DLHA+T       LR ++R 
Sbjct: 17  LLSGMQPTSGSLHLGNYLGALKQWVALQDT--HDALYCVVDLHALTVGPDPAALRERTRW 74

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A ++AAGVDP R+ +F QS V  HA L+W+LSC+   G    M QFK+KS     ++ 
Sbjct: 75  TAAQYVAAGVDPERSALFVQSHVPAHAQLAWVLSCLTGYGEAARMTQFKDKSARQGTDST 134

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           ++GLF YPVLMAADILLY+A  VPVGEDQRQHLE+TR +AQRFN  F             
Sbjct: 135 TVGLFTYPVLMAADILLYQAAEVPVGEDQRQHLELTRNLAQRFNARFGDT---------- 184

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F + E  I    ++I  L+D   KMSKS SS    ++++D+P + AKKI+ A
Sbjct: 185 --------FTVPEPFIPKETAKIFDLQDPGAKMSKSSSSPNGIVDVMDDPKVTAKKIRSA 236

Query: 247 KTDG--DVL--PSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALAD 302
            TD   +VL  P E +G+       NL+ I + +    I E    F G+ +   K  LA+
Sbjct: 237 VTDTGREVLFDPVEKAGV------SNLLSIHSALSGKPIAELEADFAGRGYGDLKKELAE 290

Query: 303 AVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            V + + P+  + Q L+ D   LD +L  GA RA   A++T+  V + VGL
Sbjct: 291 VVTDTLGPVRSRAQELMADPGALDELLAAGAARANEIAEQTLATVYDRVGL 341


>gi|145633885|ref|ZP_01789606.1| tryptophanyl-tRNA synthetase [Haemophilus influenzae 3655]
 gi|144985257|gb|EDJ92100.1| tryptophanyl-tRNA synthetase [Haemophilus influenzae 3655]
 gi|301169353|emb|CBW28953.1| tryptophanyl-tRNA synthetase [Haemophilus influenzae 10810]
          Length = 334

 Score =  253 bits (647), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 143/344 (41%), Positives = 202/344 (58%), Gaps = 21/344 (6%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQP+G L +GNYLG +RN ++ QE  ++  ++ + DLHAIT       LR  +   +A
Sbjct: 8   SGVQPSGELTIGNYLGALRNWVKMQE--DYECIFCVVDLHAITVRQDPVALRKATLDVLA 65

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LA G+DP+++ IF QS V  H  LSW+L+C    G M+ M QFK+KS    E   ++G
Sbjct: 66  LYLACGIDPNKSTIFVQSHVPEHTQLSWVLNCYTYFGEMSRMTQFKDKSARYAENI-NVG 124

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YPVLMAADILLY+A  VPVG+DQ+QHLEITR IA RFN  +                
Sbjct: 125 LFDYPVLMAADILLYQAKSVPVGDDQKQHLEITRDIANRFNALY---------------- 168

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                F I E  I  + +RI SL+D  KKMSKSD +  + + LL++P  +AKKI++A TD
Sbjct: 169 --GNIFTIPEIFIGKAGARIMSLQDPEKKMSKSDDNRNNVVTLLEDPKSVAKKIKRAVTD 226

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            D  P     ++N+    NL++I + +    I +  K+F GK +   K A+AD V   + 
Sbjct: 227 SDEPPVVRYDVQNKAGVSNLLDILSAVTDKPIADLEKEFEGKMYGHLKTAVADEVSTLLA 286

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + ++      D++ LD IL +GA +AR +AQET+  V E VG 
Sbjct: 287 GLQERFHQYRNDETLLDNILRQGAEKARAKAQETLAKVYEAVGF 330


>gi|78485871|ref|YP_391796.1| tryptophanyl-tRNA synthetase [Thiomicrospira crunogena XCL-2]
 gi|78364157|gb|ABB42122.1| tryptophanyl-tRNA synthetase [Thiomicrospira crunogena XCL-2]
          Length = 334

 Score =  253 bits (647), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 143/353 (40%), Positives = 219/353 (62%), Gaps = 23/353 (6%)

Query: 2   LSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLR 61
           +S   LF SG+QP+G L +GNY+G I+N +  Q+  + L  + + ++HAIT     E L 
Sbjct: 1   MSKPTLF-SGIQPSGDLMIGNYIGSIKNWVNMQDDYDCL--FSLVNMHAITVEQSPEELA 57

Query: 62  YQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKEN 121
            +S  FVA +LA+G+DP ++ +F QS V  H++L+WIL+C   MG +N M QFK+KS+++
Sbjct: 58  KRSLDFVALYLASGIDPDKSTVFIQSHVPAHSELAWILNCSTYMGELNRMTQFKDKSQKH 117

Query: 122 KEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVA 181
            +   ++GLF YPVLMAADILLY+   VPVG DQ+QHLE+ R IA R+N  F+R+I +V 
Sbjct: 118 AQNI-NVGLFDYPVLMAADILLYQTEMVPVGADQKQHLELARDIATRYNNRFDREIFKVP 176

Query: 182 QKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAK 241
           +           F P       +S  RI SL+D + KMSKSD +  + I LLD+P  I K
Sbjct: 177 EP----------FIPPA-----TSGGRIMSLQDPASKMSKSDENKNNFIALLDDPKTIIK 221

Query: 242 KIQKAKTDGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLAL 300
           K +KA+TD     +E+S  +EN+    NL+ I++ +    I+E ++ F GK +   K+ L
Sbjct: 222 KFKKAQTDSG---TEISYDVENKPGVSNLLTIYSVISGQSIDEVVRHFEGKMYGHLKVEL 278

Query: 301 ADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + V+E + PI  K   +  D++ L  IL +GA++A+ +AQ+T++ V E +G 
Sbjct: 279 GELVVEYLKPIQDKFHEIRTDETELKAILKKGAHQAQEQAQKTLRDVQESIGF 331


>gi|37522580|ref|NP_925957.1| tryptophanyl-tRNA synthetase [Gloeobacter violaceus PCC 7421]
 gi|39932046|sp|Q7NCG8|SYW_GLOVI RecName: Full=Tryptophanyl-tRNA synthetase; AltName:
           Full=Tryptophan--tRNA ligase; Short=TrpRS
 gi|35213581|dbj|BAC90952.1| tryptophanyl-tRNA synthetase [Gloeobacter violaceus PCC 7421]
          Length = 336

 Score =  253 bits (647), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 146/349 (41%), Positives = 200/349 (57%), Gaps = 32/349 (9%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYF-IADLHAITNNIVQENLRYQSRLF 67
           +SG QPTG LHLGNYLG +RN +  Q   +    YF + DLHA+T       LR  +R  
Sbjct: 12  LSGAQPTGQLHLGNYLGAVRNWVSEQRQYDS---YFCVVDLHALTVPQEAAELRAATRRT 68

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A +LA G+DP R+ +F QS V  H +L+W+ +C+  + W+  MIQFKEK+ +  EE   
Sbjct: 69  AALYLACGIDPERSTVFVQSHVSAHTELTWLFNCLTPINWLERMIQFKEKAIKLGEEVG- 127

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GLF YPVL AADILLY    VPVGEDQRQHLE+TR IA+RFN  +   ++         
Sbjct: 128 IGLFDYPVLQAADILLYEPHLVPVGEDQRQHLELTRDIARRFNDRYGESLR--------- 178

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                    + E LI    +R+ SL+D + KMSKSD SD SR+NLLD P+ +  KI++AK
Sbjct: 179 ---------VPEMLIRKEGARVMSLQDGTSKMSKSDPSDLSRLNLLDAPEKLRDKIKRAK 229

Query: 248 TDGDVLPSEVSGLE---NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           +D       V GL+    R E  NL+ I+  +     E    +F    F +FK  LAD V
Sbjct: 230 SDA------VMGLKFDPARPECTNLLTIYQLLSGESPEAVEARFADAGFGRFKPILADLV 283

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           IE + PI ++   +  +  YL+ IL EGA RA   A  T++ + + +GL
Sbjct: 284 IEYLRPIRERYDAIAGESGYLEGILREGALRASKVAGLTLERIRDRMGL 332


>gi|145635662|ref|ZP_01791358.1| tryptophanyl-tRNA synthetase [Haemophilus influenzae PittAA]
 gi|145267057|gb|EDK07065.1| tryptophanyl-tRNA synthetase [Haemophilus influenzae PittAA]
          Length = 334

 Score =  253 bits (647), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 143/344 (41%), Positives = 202/344 (58%), Gaps = 21/344 (6%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQP+G L +GNYLG +RN ++ QE  ++  ++ + DLHAIT       LR  +   +A
Sbjct: 8   SGVQPSGELTIGNYLGALRNWVKMQE--DYECIFCVVDLHAITVRQDPVALRKATLDVLA 65

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LA G+DP+++ IF QS V  H  LSW+L+C    G M+ M QFK+KS    E   ++G
Sbjct: 66  LYLACGIDPNKSTIFVQSHVPEHTQLSWVLNCYTYFGEMSRMTQFKDKSARYAENI-NVG 124

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YPVLMAADILLY+A  VPVG+DQ+QHLEITR IA RFN  +                
Sbjct: 125 LFDYPVLMAADILLYQAKSVPVGDDQKQHLEITRDIANRFNALY---------------- 168

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                F I E  I  + +RI SL+D  KKMSKSD +  + + LL++P  +AKKI++A TD
Sbjct: 169 --GNIFTIPEIFIGKAGARIMSLQDPEKKMSKSDDNRNNVVTLLEDPKSVAKKIKRAVTD 226

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            D  P     ++N+    NL++I + +    I +  K+F GK +   K A+AD V   + 
Sbjct: 227 SDEPPVVRYDVQNKAGVSNLLDILSAVTDKPIADLEKEFEGKMYGHLKTAVADEVSTLLA 286

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + ++      D++ LD IL +GA +AR +AQET+  V E VG 
Sbjct: 287 GLQERFHQYRNDETLLDNILRQGAEKARAKAQETLAKVYEAVGF 330


>gi|3643599|gb|AAC42246.1| putative trytophanyl-tRNA synthetase [Arabidopsis thaliana]
          Length = 347

 Score =  253 bits (646), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 150/348 (43%), Positives = 201/348 (57%), Gaps = 17/348 (4%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           VSGVQPTG +HLGNYLG I+N +  Q+T   L  + I D HAIT       L   +    
Sbjct: 6   VSGVQPTGSVHLGNYLGAIKNWVALQDTYETL--FIIVDHHAITLPYDTRQLGKATTDTA 63

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+D S+  +F QS V  H +L W+L     +GW+  MIQFKEKS++   E AS+
Sbjct: 64  ALYLACGIDVSKASVFVQSHVPAHVELMWLLCSSTPIGWLQKMIQFKEKSRKEGVENASV 123

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GLF YP LM ADILLY++  VPVGEDQ+QH+E+ R IAQR N  +  K  +    Y   E
Sbjct: 124 GLFTYPDLMTADILLYQSDFVPVGEDQKQHIELAREIAQRVNHLYGGKKWKKLGGY---E 180

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                  P  E LI  + +R+ SL D   KMSKS  SD SRINLLD+ D+I  KI++ KT
Sbjct: 181 ILYVHLIP--EPLIPQAGARVMSLTDGLSKMSKSAPSDQSRINLLDSKDLIVDKIKRCKT 238

Query: 249 DGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           D        +GLE     R E  NL+ I+  +   K EE +++    ++  FK  LADA+
Sbjct: 239 DS------FAGLEFDNAERPECNNLLSIYQIVSGKKKEEVMEECKDMSWGTFKPLLADAL 292

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVG 352
           IE + PI  + Q ++ +  YLD IL EGA+RA      TM+ + + +G
Sbjct: 293 IEHLSPIQARYQEIIAEPEYLDKILSEGADRAEELGAVTMRNMYQAMG 340


>gi|260583183|ref|ZP_05850962.1| tryptophanyl-tRNA synthetase [Haemophilus influenzae NT127]
 gi|260093740|gb|EEW77649.1| tryptophanyl-tRNA synthetase [Haemophilus influenzae NT127]
          Length = 334

 Score =  253 bits (646), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 143/344 (41%), Positives = 202/344 (58%), Gaps = 21/344 (6%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQP+G L +GNYLG +RN ++ QE  ++  ++ + DLHAIT       LR  +   +A
Sbjct: 8   SGVQPSGELTIGNYLGALRNWVKMQE--DYECIFCVVDLHAITVRQDPVALRKATLDVLA 65

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LA G+DP+++ IF QS V  H  LSW+L+C    G M+ M QFK+KS    E   ++G
Sbjct: 66  LYLACGIDPNKSTIFVQSHVPEHTQLSWVLNCYTYFGEMSRMTQFKDKSARYAENI-NVG 124

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YPVLMAADILLY+A  VPVG+DQ+QHLEITR IA RFN  +                
Sbjct: 125 LFDYPVLMAADILLYQAKSVPVGDDQKQHLEITRDIANRFNALY---------------- 168

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                F I E  I  + +RI SL+D  KKMSKSD +  + + LL++P  +AKKI++A TD
Sbjct: 169 --GNIFTIPEIFIGKAGARIMSLQDPEKKMSKSDDNRNNVVTLLEDPKSVAKKIKRAVTD 226

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            D  P     ++N+    NL++I + +    I +  K+F GK +   K A+AD V   + 
Sbjct: 227 SDEPPVVRYDVQNKAGVSNLLDILSAVTDKPIADLEKEFEGKMYGHLKTAVADEVSTLLA 286

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + ++      D++ LD IL +GA +AR +AQET+  V E VG 
Sbjct: 287 GLQERFHQYRNDEALLDNILRQGAEKARAKAQETLAKVYEAVGF 330


>gi|148826730|ref|YP_001291483.1| tryptophanyl-tRNA synthetase [Haemophilus influenzae PittEE]
 gi|148716890|gb|ABQ99100.1| tryptophanyl-tRNA synthetase [Haemophilus influenzae PittEE]
          Length = 334

 Score =  253 bits (646), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 143/344 (41%), Positives = 201/344 (58%), Gaps = 21/344 (6%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQP+G L +GNYLG +RN ++ QE  ++  ++ + DLHAIT       LR  +   +A
Sbjct: 8   SGVQPSGELTIGNYLGALRNWVKMQE--DYECIFCVVDLHAITVRQDPVALRKATLDVLA 65

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LA G+DP+++ IF QS V  H  LSW+L+C    G M+ M QFK+KS    E   ++G
Sbjct: 66  LYLACGIDPNKSTIFVQSHVPEHTQLSWVLNCYTYFGEMSRMTQFKDKSARYAENI-NVG 124

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YPVLMAADILLY+A  VPVG+DQ+QHLEITR IA RFN  +                
Sbjct: 125 LFDYPVLMAADILLYQAKSVPVGDDQKQHLEITRDIANRFNALY---------------- 168

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                F I E  I  + +RI SL+D  KKMSKSD +  + + LL++P  +AKKI++A TD
Sbjct: 169 --GNIFTIPEIFIGKAGARIMSLQDPEKKMSKSDDNRNNVVTLLEDPKSVAKKIKRAVTD 226

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            D  P     ++N+    NL++I + +    I +  K+F GK +   K A+AD V   + 
Sbjct: 227 SDEPPVVRYDVQNKAGVSNLLDILSAVTDKPIADLEKEFEGKMYGHLKTAVADEVTTLLT 286

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            +  +      D++ LD IL +GA +AR +AQET+  V E VG 
Sbjct: 287 GLQDRFHRYRNDETLLDNILRQGAEKARAKAQETLAKVYEAVGF 330


>gi|149472275|ref|XP_001517143.1| PREDICTED: similar to Tryptophanyl tRNA synthetase 2, mitochondrial
           [Ornithorhynchus anatinus]
          Length = 369

 Score =  253 bits (646), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 145/353 (41%), Positives = 208/353 (58%), Gaps = 27/353 (7%)

Query: 3   SSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQET-CNHLGMYFIADLHAITNNIVQENLR 61
           S  +L+ SG+QPTG+ HLGNYLG I + +R QE  C+ L    I DLH++T       LR
Sbjct: 41  SHPHLYFSGIQPTGIPHLGNYLGAIESWVRLQEQECSML--LCIVDLHSLTLPQDPAVLR 98

Query: 62  YQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKEN 121
             +    A+ LA GVDP + I+F+QS V  HA+LSWIL C+ R+  + ++ Q+K KS   
Sbjct: 99  QSTLDMAAALLACGVDPGKCILFQQSQVPEHAELSWILGCLIRLPRLQHLPQWKMKSA-G 157

Query: 122 KEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVA 181
           K +  S+GLF YPVL AADILLYR+THVP+GEDQ QH+E+ + +A+ FN +F        
Sbjct: 158 KRQDGSVGLFTYPVLQAADILLYRSTHVPIGEDQVQHMELAQDVAETFNKKF-------- 209

Query: 182 QKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAK 241
                       FFP+   ++ +S  R++SLRD S KMSKSD    + + + D+P+ I  
Sbjct: 210 ----------GPFFPVPRYIL-TSTKRVKSLRDPSAKMSKSDPDRLATVKVTDSPEEIVL 258

Query: 242 KIQKAKTDGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLAL 300
           K +KA TD     S V+     R    NL+ I A +  + +EE ++Q  G + +++KL +
Sbjct: 259 KFRKAVTDCT---SAVTYDPAARQGVSNLVAIHAAVAGLTVEEVVRQSAGLDTARYKLLV 315

Query: 301 ADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           ADAVI++  PI  +I  LL D  +L+ IL  GA RA+  A    + V  +VGL
Sbjct: 316 ADAVIQKFAPIRAEIARLLADTGHLEGILEAGAKRAKELAGPVGQEVRRLVGL 368


>gi|311113024|ref|YP_003984246.1| tryptophan--tRNA ligase [Rothia dentocariosa ATCC 17931]
 gi|310944518|gb|ADP40812.1| tryptophan--tRNA ligase [Rothia dentocariosa ATCC 17931]
          Length = 354

 Score =  253 bits (646), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 140/346 (40%), Positives = 205/346 (59%), Gaps = 23/346 (6%)

Query: 10  SGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           SG QP+   +HLGNY+G + N +  QE   +  ++FI D+HAIT     ++LR ++RL  
Sbjct: 24  SGAQPSADSMHLGNYIGAVNNWVALQEDPANECLFFIPDMHAITVPQDPQSLRERTRLTA 83

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A ++AAG+DP+R+  F QS V  HA L+W+L+C    G  + M QFK+KS++   + AS+
Sbjct: 84  AQYIAAGIDPARSPFFVQSQVPEHAQLAWVLNCFTGFGEASRMTQFKDKSQKQGADNASV 143

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GLF YPVLMAADILLY+   VPVGEDQRQHLE+TR +AQRFN+ F               
Sbjct: 144 GLFTYPVLMAADILLYQVDGVPVGEDQRQHLELTRNLAQRFNSRFGET------------ 191

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                 F + E +I    ++I  L++ + KMSKS +SD   I LLD P    KKI+ A T
Sbjct: 192 ------FVVPEPIIVKETAKIYDLQEPTSKMSKSAASDKGLIKLLDEPKATVKKIKSAVT 245

Query: 249 -DGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
            DG V+  +    E +    NL+ I++ M    I+  +K++ GK +   K+ LAD V+E+
Sbjct: 246 DDGSVIAYD---REAKPGVSNLLSIYSAMTGESIDSLVKRYEGKMYGHLKVDLADVVVEK 302

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + P+ ++   L+ D + LD +L  GA +AR  A  T++ V + VG 
Sbjct: 303 LSPLRERTLELMADPAELDRLLALGAQKAREIATVTIENVYDKVGF 348


>gi|313895168|ref|ZP_07828725.1| tryptophan--tRNA ligase [Selenomonas sp. oral taxon 137 str. F0430]
 gi|312976063|gb|EFR41521.1| tryptophan--tRNA ligase [Selenomonas sp. oral taxon 137 str. F0430]
          Length = 336

 Score =  253 bits (646), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 142/348 (40%), Positives = 203/348 (58%), Gaps = 24/348 (6%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           + +SG+QPTG   LGNYLG ++N    QE+ +    YF+ADLHA+T     E  R QSR 
Sbjct: 13  IILSGIQPTGTFTLGNYLGAVKNWRHLQESYD--CYYFVADLHALTVYNEPEKRRRQSRE 70

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A  LA G+DP  +++F QS V  HA + W+LSC++  G ++ M QFK+KS ++ E+  
Sbjct: 71  AFALLLACGLDPKESLVFIQSHVPAHAQMGWMLSCLSPFGDLSRMTQFKDKSAKHPEDI- 129

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           + GLF YP LMA DILLY+A +VPVG DQ+QHLE TR +A+RFN    R   EV      
Sbjct: 130 NAGLFTYPALMAGDILLYQADYVPVGADQKQHLEFTRDVAERFN----RAYGEV------ 179

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F + EG      +R++SL++ + KMSKSD++  + I +LD+   I KK + A
Sbjct: 180 --------FRLPEGYYPKEGARVKSLQEPTAKMSKSDTNAKATIYILDDEHTILKKFRSA 231

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
            TD +   SEV+  E +    NL+ I+A +    ++E   +F GK +  FK A+   V +
Sbjct: 232 VTDSE---SEVAFREGKDGINNLMTIYAAVTGKNMDEIAAEFAGKGYGDFKTAVGTVVAD 288

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
           E+ PI +K   LL DK YLD  + EGA RA   A+ T+      +GL+
Sbjct: 289 ELRPIREKYAELLADKEYLDAAIREGAERASAIAERTLAKAKRKMGLT 336


>gi|148827814|ref|YP_001292567.1| tryptophanyl-tRNA synthetase [Haemophilus influenzae PittGG]
 gi|148719056|gb|ABR00184.1| tryptophanyl-tRNA synthetase [Haemophilus influenzae PittGG]
          Length = 334

 Score =  253 bits (646), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 143/344 (41%), Positives = 202/344 (58%), Gaps = 21/344 (6%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQP+G L +GNYLG +RN ++ QE  ++  ++ + DLHAIT       LR  +   +A
Sbjct: 8   SGVQPSGELTIGNYLGALRNWVKMQE--DYECIFCVVDLHAITVRQDPVALRKATLDVLA 65

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LA G+DP+++ IF QS V  H  LSW+L+C    G M+ M QFK+KS    E   ++G
Sbjct: 66  LYLACGIDPNKSTIFVQSHVPEHTQLSWVLNCYTYFGEMSRMTQFKDKSARYAENI-NVG 124

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YPVLMAADILLY+A  VPVG+DQ+QHLEITR IA RFN  +                
Sbjct: 125 LFDYPVLMAADILLYQAKSVPVGDDQKQHLEITRDIANRFNALY---------------- 168

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                F I E  I  + +RI SL+D  KKMSKSD +  + + LL++P  +AKKI++A TD
Sbjct: 169 --GNIFTIPEIFIGKAGARIMSLQDPEKKMSKSDDNRNNVVTLLEDPKSVAKKIKRAVTD 226

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            D  P     ++N+    NL++I + +    I +  K+F GK +   K A+AD V   + 
Sbjct: 227 SDEPPVVRYDVKNKAGVSNLLDILSAVTDKPIADLEKEFEGKMYGHLKTAVADEVSTLLA 286

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + ++      D++ LD IL +GA +AR +AQET+  V E VG 
Sbjct: 287 GLQERFHQYRNDEALLDNILRQGAEKARAKAQETLAKVYEAVGF 330


>gi|115439877|ref|NP_001044218.1| Os01g0743400 [Oryza sativa Japonica Group]
 gi|57899973|dbj|BAD87909.1| putative tryptophanyl-tRNA synthetase [Oryza sativa Japonica Group]
 gi|113533749|dbj|BAF06132.1| Os01g0743400 [Oryza sativa Japonica Group]
          Length = 393

 Score =  253 bits (646), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 146/350 (41%), Positives = 201/350 (57%), Gaps = 26/350 (7%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           VSGVQPTG++HLGNYLG I+N +  Q+    L  +FI DLHAIT       L   +R   
Sbjct: 62  VSGVQPTGLVHLGNYLGAIKNWVSLQDLYETL--FFIVDLHAITLPYEAPQLSKATRSTA 119

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+D S+      S V  H +L W+LS    +GW+N MIQFKEKS++  +E   +
Sbjct: 120 AIYLACGIDSSK------SHVRAHVELMWLLSSSTPIGWLNRMIQFKEKSRKAGDENVGV 173

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEF-ERKIKEVAQKYAQE 187
            L  YPVLMA+DILLY++  VPVGEDQ QHLE+TR IA+R N  +  RK K++  +    
Sbjct: 174 ALLTYPVLMASDILLYQSDLVPVGEDQTQHLELTREIAERVNNLYGGRKWKKMGGR---- 229

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F + E LI  + +R+ SL D   KMSKS  SD SRINLLD  D+I  KI++ K
Sbjct: 230 ---GGSLFKVPEALIPPAGARVMSLTDGLSKMSKSAPSDQSRINLLDPKDVIMNKIKRCK 286

Query: 248 TDGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           TD         GLE     R E  NL+ I+  +     EE +++    N+  FK  L DA
Sbjct: 287 TD------SFPGLEFDNPERPECNNLLSIYQIITGKTKEEVIRECENMNWGSFKTTLTDA 340

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           +I+ + PI  + + ++ D  YLD +L+EG+ +A   A  T+  V + +G 
Sbjct: 341 LIDHLQPIQVRYEEIMSDPGYLDGVLLEGSGKAAEIADITLNNVYQAMGF 390


>gi|323447381|gb|EGB03304.1| hypothetical protein AURANDRAFT_39388 [Aureococcus anophagefferens]
          Length = 387

 Score =  253 bits (646), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 148/350 (42%), Positives = 207/350 (59%), Gaps = 27/350 (7%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQPTG LHLGNYLG IR  +  Q   + L  + + D+HAIT     + L  ++    
Sbjct: 57  LSGVQPTGSLHLGNYLGAIRQWVEYQHEYDSL--FCVVDMHAITVPHDAKTLSSETMDAA 114

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A ++AAGVDP    IF QS V  HA+L+W+L+C+  + W+  MIQ+KEK KE + E  ++
Sbjct: 115 ALYIAAGVDPDIAPIFVQSHVSAHAELAWLLNCITPINWLERMIQYKEK-KEKQGELVAV 173

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GLF YPVLMAADILLY+A  VPVG+DQRQHLE+TR IA+RF+  + ++ + V        
Sbjct: 174 GLFDYPVLMAADILLYQAGLVPVGDDQRQHLELTRDIARRFHDMYCKRKQRV-------- 225

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                 F   + LI    SR+ SL D + KMSKS   D SRINL D PD+IA KI+K KT
Sbjct: 226 ------FREPKALIVKEGSRVMSLTDGTVKMSKSAPLDNSRINLSDPPDLIASKIKKCKT 279

Query: 249 DGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           D      +V GLE    +R EA NL+ I+ ++  ++ E  L++    ++  FK  L DAV
Sbjct: 280 D------QVKGLEWDNPDRPEAANLLNIYQSVTGLEHEAILREVSDLSWGAFKPRLTDAV 333

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
           +  + PI +  + +  D+ YL   L +GA RA   A  T+      +G++
Sbjct: 334 VAHLEPIQRAYKEIAADQHYLSQTLKQGAYRADEIATRTLDDAKSAMGIN 383


>gi|302544630|ref|ZP_07296972.1| tryptophan-tRNA ligase [Streptomyces hygroscopicus ATCC 53653]
 gi|302462248|gb|EFL25341.1| tryptophan-tRNA ligase [Streptomyces himastatinicus ATCC 53653]
          Length = 337

 Score =  253 bits (646), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 141/347 (40%), Positives = 195/347 (56%), Gaps = 25/347 (7%)

Query: 9   VSGVQPT-GVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SG+QPT G  HLGNYLG IR  +  QET  H   Y + DLHAIT       LR  SRL 
Sbjct: 9   LSGIQPTAGSFHLGNYLGAIRQYVALQET--HDAFYTVVDLHAITVPQDPAELRANSRLA 66

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A  LA+G+DP R  +F QS V  HA L W+++C+   G  + M QFK+KS +   + ++
Sbjct: 67  AAQLLASGLDPDRCTLFIQSHVPEHAQLGWVMNCLTGFGEASRMTQFKDKSAKQGADRST 126

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GLF YP+L  ADILLY+A HVPVGEDQRQH+E+TR +A RFN  F              
Sbjct: 127 VGLFTYPILQVADILLYQANHVPVGEDQRQHIELTRDLADRFNGRFGET----------- 175

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F + +  I     +I  L+D + KMSKS S+    +NLLD P + AKKI+ A 
Sbjct: 176 -------FTVPDAYIVKETGKIYDLQDPTVKMSKSASTPKGIVNLLDEPKVSAKKIKSAV 228

Query: 248 TDGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
           TD   L +E+    E +    NL+ I++T+    I+E   ++ GK +   K  LA+ ++E
Sbjct: 229 TD---LETEIRFDEEKKPGVSNLLTIYSTLTGDSIKELEGKYEGKGYGALKTDLAEVLVE 285

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + P  ++ Q  L D   LD IL +GA++AR  A ET+    + VG 
Sbjct: 286 WVTPFRERTQEYLGDPGTLDGILAKGADKARAVAAETLALAYDKVGF 332


>gi|318041221|ref|ZP_07973177.1| tryptophanyl-tRNA synthetase [Synechococcus sp. CB0101]
          Length = 342

 Score =  253 bits (646), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 144/350 (41%), Positives = 203/350 (58%), Gaps = 23/350 (6%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQPTG LHLGN+LG IRN +  Q++  H   + + DLHAIT     E L   +R   
Sbjct: 7   LSGVQPTGSLHLGNWLGAIRNWVDLQDS--HDTFFCVVDLHAITVPHNPEQLAADTRSTA 64

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+DP++  +F QS V  H++L W+L+CV  + W+  MIQFKEK+ +  ++  S+
Sbjct: 65  ALYLACGIDPAKATVFVQSHVPAHSELCWLLNCVTPLNWLERMIQFKEKAVKQGDQV-SV 123

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIA-QRFNTEFERKIKEVAQKYAQE 187
           GL  YPVLMAADILLY A  VPVGEDQ+QHLE+ R IA QR N  F         K A  
Sbjct: 124 GLLDYPVLMAADILLYDADLVPVGEDQKQHLELARDIAQQRINARF-------GPKDADG 176

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
           E        + E LI    +R+ SL D   KMSKSD ++ SRINLLD P++I KK+++AK
Sbjct: 177 EPIP--VLKVPEPLILKEGARVMSLTDGRSKMSKSDPNEGSRINLLDPPELITKKVKRAK 234

Query: 248 TDGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           TD       + GLE     R E  NL+ ++A +     + A  +     +  FK  LA+ 
Sbjct: 235 TD------PIMGLEFGNPERPETDNLLGLYALLSGKGRDAAAAECASMGWGSFKPLLAET 288

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           ++E + PI ++   L  D + LD +L +G+ RA   A+ T++   + +G 
Sbjct: 289 LVEALRPIQERYSALSNDPAELDRVLEQGSERANAVAESTLERTRQALGF 338


>gi|154482530|ref|ZP_02024978.1| hypothetical protein EUBVEN_00197 [Eubacterium ventriosum ATCC
           27560]
 gi|149736555|gb|EDM52441.1| hypothetical protein EUBVEN_00197 [Eubacterium ventriosum ATCC
           27560]
          Length = 334

 Score =  253 bits (645), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 142/354 (40%), Positives = 210/354 (59%), Gaps = 24/354 (6%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENL 60
           ML    +  S +Q TG L LGNYLG + N ++ QE   +   Y IADLH++T       L
Sbjct: 1   MLGDKKVSYSAMQSTGTLTLGNYLGALDNWLKMQE--EYECFYAIADLHSLTIRQNPAEL 58

Query: 61  RYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKE 120
           R ++R   A ++AAG+DP +N I+ QS V  HA+L+WIL C   MG +N M QFK+K+ +
Sbjct: 59  RKRARDLYALYVAAGLDPEKNCIYFQSHVSAHAELAWILDCFTYMGELNRMTQFKDKAAK 118

Query: 121 NKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEV 180
           + +   + GLF YP LMAADILLY+A  VPVG DQ+QHLE+TR IA RFN  +       
Sbjct: 119 HADNINA-GLFTYPSLMAADILLYQADVVPVGVDQKQHLELTRDIANRFNGIY------- 170

Query: 181 AQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIA 240
                         F I E  I  S ++I SL+D ++KMSKSD +  + I L+D+PD I 
Sbjct: 171 -----------GDVFTIPEAYIGKSTAKIMSLQDPTRKMSKSDENPNASILLMDDPDTII 219

Query: 241 KKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLAL 300
           +K ++A TD D+   E+   +++   +NLI I++ +    IEE  K+F GK + +FKLA+
Sbjct: 220 RKFKRAVTDSDM---EIRYSDDKPGIQNLINIYSCITGKTIEEVEKEFDGKGYGEFKLAV 276

Query: 301 ADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
            + V   + P+  +   L KDK+YL++++ E   +A   A +T++ V + VGL+
Sbjct: 277 GECVANRLKPLQDRFYELQKDKTYLNSVIKENDEKAAYFANKTLRKVQKKVGLT 330


>gi|254416836|ref|ZP_05030585.1| tryptophanyl-tRNA synthetase [Microcoleus chthonoplastes PCC 7420]
 gi|196176382|gb|EDX71397.1| tryptophanyl-tRNA synthetase [Microcoleus chthonoplastes PCC 7420]
          Length = 336

 Score =  253 bits (645), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 145/350 (41%), Positives = 199/350 (56%), Gaps = 27/350 (7%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQPTG LHLGNYLG IRN +  Q    +   + + DLHAIT       L   +    
Sbjct: 7   LSGVQPTGNLHLGNYLGAIRNWVEAQS--QYENFFCVVDLHAITVPHNPATLATDTYTIA 64

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA GVD + + IF QS +  H +L+W+ +CV  + W+  MIQFKEK+ + + E  S 
Sbjct: 65  ALYLACGVDLNDSTIFVQSHIPAHCELTWLFNCVTPINWLERMIQFKEKAVK-QGENVST 123

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GL  YPVLMAADILLY A  VPVGEDQ+QH+E+TR I  R N ++  K K V +      
Sbjct: 124 GLLDYPVLMAADILLYDADLVPVGEDQKQHIELTRDIVIRINDQYGSKKKPVLK------ 177

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                   + E LI    +R+ SL D +KKMSKSD S+ SRINLLD+P+ I KKI++ KT
Sbjct: 178 --------LPEPLIRKEGARVMSLTDGTKKMSKSDPSEMSRINLLDSPEEIQKKIKRCKT 229

Query: 249 DGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           D       + GLE     R E  NL+ ++  +     E    +     + QFK  L++A 
Sbjct: 230 D------PIKGLEFDNPERPECHNLLTLYTLLSGKTQEAVAAECQDMGWGQFKTVLSEAT 283

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
           IE + PI Q  Q +++DK YL+++L +G  +A   A  T+  V   +G S
Sbjct: 284 IEALKPIQQNYQAVMEDKGYLESVLRQGREKAEAIALSTLSRVKAAMGYS 333


>gi|172038447|ref|YP_001804948.1| tryptophanyl-tRNA synthetase [Cyanothece sp. ATCC 51142]
 gi|171699901|gb|ACB52882.1| tryptophanyl-tRNA synthetase [Cyanothece sp. ATCC 51142]
          Length = 371

 Score =  252 bits (644), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 149/348 (42%), Positives = 202/348 (58%), Gaps = 27/348 (7%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQPTG LHLGNYLG IR  +  QE  N+   + + DLHAIT     + L   +    
Sbjct: 42  LSGVQPTGNLHLGNYLGAIRTWVDMQE--NYDNFFCVVDLHAITVPHDPKTLAQDTYTIA 99

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+D     IF QS V  H++L+W+L+C+  + W+  MIQFKEK+ + + E  S+
Sbjct: 100 ALYLACGIDLDHATIFVQSHVTAHSELAWLLNCITPLNWLERMIQFKEKAVK-QGENVSV 158

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GL  YPVLMAADILLY A  VPVGEDQ+QHLE+TR IA R N +F  K   + +      
Sbjct: 159 GLLDYPVLMAADILLYNADKVPVGEDQKQHLELTRDIAIRVNDQFGSKKNPILK------ 212

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                   + E LI S  +R+ SL D ++KMSKSD SD SRINLLD+PD+I KKI+K KT
Sbjct: 213 --------LPEPLIRSEGARVMSLSDGTRKMSKSDPSDLSRINLLDSPDLIKKKIKKCKT 264

Query: 249 DGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           D       + GLE     R E  NL+ ++  +     EE   +     + QFK  L +  
Sbjct: 265 D------PIKGLEFDNKERPECNNLLGLYTLLSGKSKEEVATECQDMGWGQFKPLLTETT 318

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVG 352
           IE + PI    Q ++ +K YLD++L +G  +A   A +T+  V E +G
Sbjct: 319 IEALKPIQDNYQAIMDNKDYLDSVLRDGKEKAETVANQTLSRVKEALG 366


>gi|289578445|ref|YP_003477072.1| tryptophanyl-tRNA synthetase [Thermoanaerobacter italicus Ab9]
 gi|289528158|gb|ADD02510.1| tryptophanyl-tRNA synthetase [Thermoanaerobacter italicus Ab9]
          Length = 327

 Score =  252 bits (644), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 145/345 (42%), Positives = 206/345 (59%), Gaps = 28/345 (8%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQPTG +H+GNYLG +R  +  Q+  ++   + + DLHA+T       L+  +     
Sbjct: 6   SGVQPTGDIHIGNYLGAMRQFVALQD--DYECFFCVVDLHALTVPQDPIKLKENTIELAG 63

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LA G+DP +  +F QS V  HA+L+W+L C+   G ++ M QFKEKSK   +ET S+G
Sbjct: 64  LYLAIGLDPKKVTLFVQSHVAAHAELAWLLQCMTYFGELSRMTQFKEKSK--GKETVSVG 121

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LMAADILLY   +VPVGEDQ+QHLE+TR IAQRFN  F                
Sbjct: 122 LFTYPDLMAADILLYNTHYVPVGEDQKQHLELTRDIAQRFNNRFGET------------- 168

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                F + E +I    +RI SL D +KKMSKSDS   +RINLLD P +I KKI +A TD
Sbjct: 169 -----FVVPEPMILKLGARIMSLTDPTKKMSKSDSDPNNRINLLDEPSVIKKKIMRAVTD 223

Query: 250 GDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
            +   +E+    EN+    NL+ I++    ++IEE + +F G+ +   K  LA+ VI+++
Sbjct: 224 SE---TEIRLDWENKPGVSNLLTIYSLFTGMEIEEVVNKFKGQGYGTLKKELAEVVIDKL 280

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
             I +  + L +D  Y+  +L EGA RA+  A++T+K V E +GL
Sbjct: 281 TVIQKNYKDLSRD--YVLKVLKEGAERAQAVAEKTLKEVKEKMGL 323


>gi|260435375|ref|ZP_05789345.1| tryptophanyl-tRNA synthetase [Synechococcus sp. WH 8109]
 gi|260413249|gb|EEX06545.1| tryptophanyl-tRNA synthetase [Synechococcus sp. WH 8109]
          Length = 337

 Score =  252 bits (644), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 145/351 (41%), Positives = 203/351 (57%), Gaps = 28/351 (7%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQPTG LHLGN+LG IRN +  QET  H     + DLHAIT       L   +R   
Sbjct: 7   LSGVQPTGALHLGNWLGAIRNWVDLQET--HDTFVCVVDLHAITVPHDPSRLAEDTRSTA 64

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+DP R  +F QS V  H++L W+L+CV  + W+  MIQFKEK+ + + +  S+
Sbjct: 65  ALYLACGIDPKRCSVFVQSQVAAHSELCWLLNCVTPLNWLERMIQFKEKAVK-QGDNVSV 123

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIA-QRFNTEFERKIKEVAQKYAQE 187
           GL  YPVLMAADILLY A  VPVGEDQ+QHLE+ R IA QR N  F  K   V +     
Sbjct: 124 GLLDYPVLMAADILLYDADLVPVGEDQKQHLELARDIAQQRINARFRGKDTPVLK----- 178

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                    + + LI    +R+ SL D   KMSKSD ++ SRI LLD P++I KKI++AK
Sbjct: 179 ---------VPKPLILKEGARVMSLTDGRSKMSKSDPNEGSRITLLDPPELITKKIKRAK 229

Query: 248 TDGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           TD +       GLE    +R E  NL+ ++A +     ++A  +     + QFK  LA+A
Sbjct: 230 TDPE------RGLEFGNPDRPETDNLLGLYAILSGKGRQQAATECAEMGWGQFKPLLAEA 283

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
            +  + PI  + + L++D + LD +L  G  +A   A +T++ V + +G +
Sbjct: 284 TVSALEPIQARYRELMQDPTELDQVLRTGREKAETVANDTLERVRDALGFA 334


>gi|295695295|ref|YP_003588533.1| tryptophanyl-tRNA synthetase [Bacillus tusciae DSM 2912]
 gi|295410897|gb|ADG05389.1| tryptophanyl-tRNA synthetase [Bacillus tusciae DSM 2912]
          Length = 327

 Score =  252 bits (644), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 147/345 (42%), Positives = 203/345 (58%), Gaps = 27/345 (7%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G   LGNYLG +R+ +  Q+       Y + DLHA+T       L  Q+R   A
Sbjct: 5   SGMQPSGTPTLGNYLGALRHFVEIQDEAE--CFYCVVDLHAVTVPQEPAALHRQTRQLSA 62

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LAAG+DP R+++F QS V  H+ L W++ C+   G +  M QFKEKS+   +E  S G
Sbjct: 63  LYLAAGIDPRRSVLFLQSHVPAHSQLGWLMECLVHYGELGRMTQFKEKSE--GKEGVSAG 120

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LMAADILLY+ATHVPVGEDQ+QHLE+TR +A+RFN                 ++
Sbjct: 121 LFTYPALMAADILLYQATHVPVGEDQKQHLELTRDLAERFN-----------------KR 163

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
           Y   F  I E LI    SRI SL D +KKMSKS ++  S I+LLD+PD I KKI++A TD
Sbjct: 164 YGDTFV-IPEPLIPKVGSRIMSLDDPTKKMSKSSANPGSYISLLDSPDEIRKKIRRAVTD 222

Query: 250 GDVLPSEVSGLENRLEA-KNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
            +   +EV     R  A  NL+ I+++     I E  KQ+ G  +  FK  LA+AV+  +
Sbjct: 223 SE---AEVRFDPQRKPAVSNLLTIYSSCTDKTIPELEKQYSGVGYGPFKQDLAEAVVARL 279

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            P+ ++ + L+ D   LD IL EGA +A+  A+  +  V E +G 
Sbjct: 280 EPLQERYRELV-DSEELDRILAEGATKAKAVAEPNLHLVFERMGF 323


>gi|229847416|ref|ZP_04467516.1| tryptophanyl-tRNA synthetase [Haemophilus influenzae 7P49H1]
 gi|229809654|gb|EEP45380.1| tryptophanyl-tRNA synthetase [Haemophilus influenzae 7P49H1]
 gi|309751769|gb|ADO81753.1| Tryptophanyl-tRNA synthetase [Haemophilus influenzae R2866]
 gi|309973871|gb|ADO97072.1| Tryptophanyl-tRNA synthetase [Haemophilus influenzae R2846]
          Length = 334

 Score =  252 bits (644), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 143/344 (41%), Positives = 201/344 (58%), Gaps = 21/344 (6%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQP+G L +GNYLG +RN ++ QE  ++  ++ + DLHAIT       LR  +   +A
Sbjct: 8   SGVQPSGELTIGNYLGALRNWVKMQE--DYECIFCVVDLHAITVRQDPVALRKATLDVLA 65

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LA G+DP+++ IF QS V  H  LSW+L+C    G M+ M QFK+KS    E   ++G
Sbjct: 66  LYLACGIDPNKSTIFVQSHVPEHTQLSWVLNCYTYFGEMSRMTQFKDKSARYAENI-NVG 124

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YPVLMAADILLY+A  VPVG+DQ+QHLEITR IA RFN  +                
Sbjct: 125 LFDYPVLMAADILLYQAKSVPVGDDQKQHLEITRDIANRFNALY---------------- 168

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                F I E  I  + +RI SL+D  KKMSKSD +  + + LL++P  +AKKI++A TD
Sbjct: 169 --GNIFTIPEIFIGKAGARIMSLQDPEKKMSKSDDNRNNVVTLLEDPKSVAKKIKRAVTD 226

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            D  P     ++N+    NL++I + +    I +  K+F GK +   K A+AD V   + 
Sbjct: 227 SDEPPVVRYDVQNKAGVSNLLDILSAVTDKPIADLEKEFEGKMYGHLKTAVADEVSTLLT 286

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            +  +      D++ LD IL +GA +AR +AQET+  V E VG 
Sbjct: 287 GLQDRFHRYRNDETLLDNILRQGAEKARAKAQETLAKVYEAVGF 330


>gi|145631666|ref|ZP_01787429.1| tryptophanyl-tRNA synthetase [Haemophilus influenzae R3021]
 gi|144982689|gb|EDJ90225.1| tryptophanyl-tRNA synthetase [Haemophilus influenzae R3021]
          Length = 334

 Score =  252 bits (644), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 143/344 (41%), Positives = 202/344 (58%), Gaps = 21/344 (6%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQP+G L +GNYLG +RN ++ QE  ++  ++ + DLHAIT       LR  +   +A
Sbjct: 8   SGVQPSGELTIGNYLGALRNWVKMQE--DYECIFCVVDLHAITVRQDPVALRKATLDVLA 65

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LA G+DP+++ IF QS V  H  LSW+L+C    G M+ M QFK+KS    EE  ++G
Sbjct: 66  LYLACGIDPNKSTIFVQSHVPEHTQLSWVLNCYTYFGEMSRMTQFKDKSAR-YEENINVG 124

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YPVLMAADILLY+A  VPVG+DQ+QHLEITR IA RFN  +                
Sbjct: 125 LFDYPVLMAADILLYQAKSVPVGDDQKQHLEITRDIANRFNALY---------------- 168

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                F I E  I  + +RI SL+D  KKMSKSD +  + + LL++P  +AKKI++A TD
Sbjct: 169 --GNIFTIPEIFIGKAGARIMSLQDPEKKMSKSDDNRNNVVTLLEDPKSVAKKIKRAVTD 226

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            D  P     ++N+    NL++I + +    I +  K+F  K +   K A+AD V   + 
Sbjct: 227 SDEPPVVRYDVQNKAGVSNLLDILSAVTDKPIADLEKEFEDKMYGHLKTAVADEVSTLLA 286

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + ++      D++ LD IL +GA +AR +AQET+  V E VG 
Sbjct: 287 GLQERFHQYRNDEALLDNILRQGAEKARAKAQETLAKVYEAVGF 330


>gi|194477316|ref|YP_002049495.1| tryptophanyl-tRNA synthetase [Paulinella chromatophora]
 gi|171192323|gb|ACB43285.1| tryptophanyl-tRNA synthetase [Paulinella chromatophora]
          Length = 338

 Score =  252 bits (644), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 146/350 (41%), Positives = 201/350 (57%), Gaps = 26/350 (7%)

Query: 8   FVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
            +SGVQPTG LH+GN+LG IRN +  Q T  H     + DLHAIT +     L   +R  
Sbjct: 6   ILSGVQPTGSLHIGNWLGAIRNWVNLQNT--HETYVCVVDLHAITMSYDPIKLAEDTRNT 63

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A +LA G++P  + +F QS V  H++L W+L+C+  + W+  MIQFKEKS + +    S
Sbjct: 64  AALYLACGINPEHSTVFVQSHVRAHSELCWLLNCLTPLNWLERMIQFKEKSIK-QGSNVS 122

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GL  YP++MAADILLY A  VPVGEDQ+QHLE+ R IAQ          + V  ++ ++
Sbjct: 123 IGLLDYPIMMAADILLYDADLVPVGEDQKQHLELARDIAQ----------QRVNSRFGKD 172

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
           E        + E LI S  +RI SL D   KMSKS   D SRINLLD+PD+I KKI++AK
Sbjct: 173 ENV---IVKVPEPLIMSEGARIMSLVDGRSKMSKSHPDDNSRINLLDSPDLIKKKIKRAK 229

Query: 248 TDGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           TD ++      GLE    +R EA NL+ I+A +     E    +     +  FK  L DA
Sbjct: 230 TDSNI------GLEFTNTDRPEADNLLGIYAILSGKGRETVAIECSEMGWGNFKQLLIDA 283

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            IE + PI      ++ D++Y+D IL EGA +A   A  T++ V   +G 
Sbjct: 284 TIESLKPIQNHYNEIINDRTYMDNILKEGAQKANSVADTTLQRVRSALGF 333


>gi|167037680|ref|YP_001665258.1| tryptophanyl-tRNA synthetase [Thermoanaerobacter pseudethanolicus
           ATCC 33223]
 gi|320116095|ref|YP_004186254.1| tryptophanyl-tRNA synthetase [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
 gi|166856514|gb|ABY94922.1| tryptophanyl-tRNA synthetase [Thermoanaerobacter pseudethanolicus
           ATCC 33223]
 gi|319929186|gb|ADV79871.1| tryptophanyl-tRNA synthetase [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
          Length = 327

 Score =  252 bits (643), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 145/345 (42%), Positives = 208/345 (60%), Gaps = 28/345 (8%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQP+G +H+GNYLG +R  +  QE  ++   +   DLHA+T     + L+ ++    A
Sbjct: 6   SGVQPSGDIHIGNYLGAMRQFVALQE--DYECFFCAVDLHALTVPQDPKVLKEKTIELAA 63

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LA G+DP +  IF QS V  HA+L+W+L C+   G ++ M QFK+KSK   +E+ S+G
Sbjct: 64  LYLAIGLDPKKVTIFIQSHVPAHAELAWLLQCITYFGELSRMTQFKDKSK--GKESVSVG 121

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LMAADILLY   +VPVGEDQ+QHLE+TR IAQRFN  F                
Sbjct: 122 LFTYPDLMAADILLYNTHYVPVGEDQKQHLELTRDIAQRFNNRFGET------------- 168

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                F + E +I    +RI SL D +KKMSKSDS   +RINLLD P +I KKI +A TD
Sbjct: 169 -----FVVPEPMILKLGARIMSLTDPTKKMSKSDSDPNNRINLLDEPSVIKKKIMRAVTD 223

Query: 250 GDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
            +   +E+    EN+    NL+ I++    ++IEE + +F G+ +   K  LA+ VI+++
Sbjct: 224 SE---TEIKLDWENKPGVSNLLTIYSLFTGMEIEEVVNKFKGQGYGTLKKELAEVVIDKL 280

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
             I +  + L +D  Y+  +L EGA RA+  A++T+K V E +GL
Sbjct: 281 TVIQKNYKDLSRD--YVLKVLKEGAERAQAVAEKTLKEVKEKMGL 323


>gi|226365709|ref|YP_002783492.1| tryptophanyl-tRNA synthetase [Rhodococcus opacus B4]
 gi|226244199|dbj|BAH54547.1| tryptophanyl-tRNA synthetase [Rhodococcus opacus B4]
          Length = 344

 Score =  252 bits (643), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 142/350 (40%), Positives = 196/350 (56%), Gaps = 31/350 (8%)

Query: 9   VSGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SG+QPT    HLGN+LG ++  +  Q+  +    YFI DLHAIT     + LR ++++ 
Sbjct: 16  LSGIQPTADSFHLGNFLGALQQWVPLQDDFD--AFYFIPDLHAITVAQDPKELRRRTKIA 73

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
           VA  LA G+DP R  +F QS V  HA L+W+L+C+   G  + M QFK+KS +   E AS
Sbjct: 74  VAQLLALGIDPDRATLFVQSQVPEHAQLAWVLNCITGFGEASRMTQFKDKSAKQGSENAS 133

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GLF YPVLMAADILLYR   VPVGEDQRQHLE+ R +AQRFNT F +            
Sbjct: 134 VGLFTYPVLMAADILLYRPQRVPVGEDQRQHLELARDLAQRFNTRFGKA----------- 182

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F I E  I    ++I  L+D + KMSKS  S    INLLD+P + AKKI+ A 
Sbjct: 183 -------FVIPEAQIIKGTAKIYDLQDPTSKMSKSGPSPAGLINLLDDPKVSAKKIKSAV 235

Query: 248 TDGD----VLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           TD +      P    G+       NL+ I + +    +E  +  + GK +   K   AD 
Sbjct: 236 TDNEREIRYDPQAKPGVS------NLLTIQSALSGTPVETLVAGYAGKGYGDLKTDTADV 289

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + E + P+  K++  L D++ LD I+  GA+RAR  + +T+  V E VG 
Sbjct: 290 LAEFVTPLKAKVEGYLSDEAELDRIIAAGAHRAREVSSQTLAAVYEKVGF 339


>gi|108803126|ref|YP_643063.1| tryptophanyl-tRNA synthetase [Rubrobacter xylanophilus DSM 9941]
 gi|108764369|gb|ABG03251.1| tryptophanyl-tRNA synthetase [Rubrobacter xylanophilus DSM 9941]
          Length = 330

 Score =  252 bits (643), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 131/328 (39%), Positives = 204/328 (62%), Gaps = 23/328 (7%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G LH+GNY+G I+N +  QE   +   + I DLHA+T     + LR + R   A
Sbjct: 9   SGIQPSGNLHIGNYVGAIKNWVAIQE--RYENYFCIVDLHALTVPQDPKELRRKIREVAA 66

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LA+G+DP R +IF+QS V  HA+L+W+L+C+AR G ++ M QFK+K+++   E+AS+G
Sbjct: 67  IYLASGLDPQRCVIFRQSHVSAHAELTWLLNCIARFGELSRMTQFKDKARKEGTESASVG 126

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YPVLMA+DILLY A  VPVG+DQRQHLE+TR +A+RFN  +                
Sbjct: 127 LFDYPVLMASDILLYNAHLVPVGDDQRQHLELTRTLARRFNNLYGET------------- 173

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                F + E +I  + +R+ +L   ++KMSKS     S + +LD+PD + +KI++A TD
Sbjct: 174 -----FVVPEAMILKTGARVMALDAPNEKMSKSSPRPASYVAILDDPDTVRRKIRRAVTD 228

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
                +E+   E++    NL++I+A +    + E  +Q+ G+ + +FK  LA+ V+E + 
Sbjct: 229 SG---TEIVAREDKPAITNLLDIYAAITGKTVPELEEQYRGRGYGEFKKDLAEVVVEALA 285

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRAR 337
           PI ++   LL++   L+ +L  GA RAR
Sbjct: 286 PIRERALELLENPGELEELLEAGAERAR 313


>gi|159903593|ref|YP_001550937.1| tryptophanyl-tRNA synthetase [Prochlorococcus marinus str. MIT
           9211]
 gi|159888769|gb|ABX08983.1| Tryptophanyl-tRNA synthetase [Prochlorococcus marinus str. MIT
           9211]
          Length = 337

 Score =  252 bits (643), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 147/346 (42%), Positives = 208/346 (60%), Gaps = 20/346 (5%)

Query: 8   FVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
            +SGVQPTG LH+GN+LG IRN +  QE  +H  +  + DLHAIT    +E+L   +   
Sbjct: 6   VLSGVQPTGALHIGNWLGAIRNWVDLQE--DHETLVCVVDLHAITVPHNREDLAKNTLST 63

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A ++A G+DP    IF QS V  H++L W+L+CV  + WM  MIQFKEK+ + + +  S
Sbjct: 64  AALYVACGMDPKICSIFVQSHVKAHSELCWLLNCVTPLNWMERMIQFKEKALK-QGDNVS 122

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIA-QRFNTEFERKIKEVAQKYAQ 186
           +GL  YPVLMAADILLY    VPVGEDQ+QHLE+ R IA QR N+ F           A+
Sbjct: 123 IGLLDYPVLMAADILLYDTDLVPVGEDQKQHLELARDIAQQRINSRF-----------AK 171

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
            +Q       + + LI    ++I SL D   KMSKSD ++ SRI+LLD+ ++I KKI++A
Sbjct: 172 GDQV---ILKVPQPLIMKEGAKIMSLCDGKSKMSKSDPNENSRISLLDSAELITKKIKRA 228

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
           KTD  +     +G  NR EA NL+ I+A +R I  E+AL++ G   + +FK  L +A+I 
Sbjct: 229 KTDAQI--GLEAGNTNRPEADNLLGIYALVRGIGKEKALEELGDMGWGKFKPILTEAIIN 286

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVG 352
            + PI      L+ D+  L+ +L +G  RA   +  T+K V E +G
Sbjct: 287 ALSPIQNNYYELINDREELNNMLQQGKERADEISNATIKRVKEALG 332


>gi|296128865|ref|YP_003636115.1| tryptophanyl-tRNA synthetase [Cellulomonas flavigena DSM 20109]
 gi|296020680|gb|ADG73916.1| tryptophanyl-tRNA synthetase [Cellulomonas flavigena DSM 20109]
          Length = 351

 Score =  252 bits (643), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 142/349 (40%), Positives = 198/349 (56%), Gaps = 30/349 (8%)

Query: 10  SGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           SG+QPT   L LGNYLG +   +  Q+T  H  +Y + DLHA+T     + LR ++R   
Sbjct: 22  SGMQPTSDSLQLGNYLGALTQWVALQDT--HDAIYCVVDLHALTVGPDPKVLRERTRRTA 79

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LAAGVDP+R+I+F QS V  HA+L+WILSC+   G    M QFK+KS +   +  ++
Sbjct: 80  AQYLAAGVDPARSILFVQSHVPEHAELAWILSCLTGFGEAGRMTQFKDKSAKQGSDGTTV 139

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GLF YPVLMAADILLY    VPVGEDQRQHLE++R +AQR N+ F               
Sbjct: 140 GLFTYPVLMAADILLYDTALVPVGEDQRQHLELSRDLAQRLNSRF--------------- 184

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
               G   + E  I S+ ++I  L+D + KMSKS  S    I LLD+P ++AK+I+ A T
Sbjct: 185 --GPGTVVVPEPYIVSATAKIYDLQDPTSKMSKSAESPNGLIELLDDPKVVAKRIRSAVT 242

Query: 249 DGD----VLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           D +      P+   G+       NL+ IFA +    I      + GK +   K  LAD V
Sbjct: 243 DAEREIRYDPAAKPGV------SNLLTIFAALSGRSIPSLESDYAGKGYGDLKKDLADVV 296

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           ++ + P  ++++H + D S LD +L  GA RAR  A  T++ V +  GL
Sbjct: 297 VDFLTPFQERVRHYMSDPSALDDVLAAGAQRARELATPTLERVYDRSGL 345


>gi|302536383|ref|ZP_07288725.1| tryptophanyl-tRNA synthetase [Streptomyces sp. C]
 gi|302445278|gb|EFL17094.1| tryptophanyl-tRNA synthetase [Streptomyces sp. C]
          Length = 337

 Score =  252 bits (643), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 141/346 (40%), Positives = 192/346 (55%), Gaps = 23/346 (6%)

Query: 9   VSGVQPT-GVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SG+QPT G  HLGNYLG IR  +  QET  H   Y + DLHAIT     ++LR  +RL 
Sbjct: 9   LSGIQPTSGSFHLGNYLGAIRQYVALQET--HDAFYMVVDLHAITMPQDPKDLRANTRLS 66

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A  LAAG+DP R  +F QS V  HA L W+++C+   G  + M QFK+KS +    +AS
Sbjct: 67  AAQLLAAGLDPERCTLFVQSHVPEHAQLGWVMNCITGFGEASRMTQFKDKSAKGGVNSAS 126

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GLF YP+L  ADILLY+A  VPVGEDQRQH+E+TR +A+RFN  F R     A    +E
Sbjct: 127 VGLFTYPILQVADILLYQANAVPVGEDQRQHIELTRDLAERFNQRFGRTFTLPAAHIVKE 186

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                              ++I  L+D + KMSKS SS    INLLD P +  KKI+ A 
Sbjct: 187 ------------------VAKIYDLQDPAIKMSKSASSPKGLINLLDEPKVTEKKIKSAV 228

Query: 248 TDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
           TD D +    +  EN+    NL+ I +T+    I      + GK +   K  LA  +++ 
Sbjct: 229 TDTDTVIRFDT--ENKPGVSNLLTILSTLTGESITALEASYEGKGYGALKTDLAGVMVDF 286

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + P  Q+ Q  L D   LD++L +GA +AR  A ET+    + +G 
Sbjct: 287 VTPFRQRTQEFLDDPETLDSLLAKGAEKARAVAAETLAQAYDHLGF 332


>gi|167758945|ref|ZP_02431072.1| hypothetical protein CLOSCI_01291 [Clostridium scindens ATCC 35704]
 gi|167663352|gb|EDS07482.1| hypothetical protein CLOSCI_01291 [Clostridium scindens ATCC 35704]
          Length = 339

 Score =  252 bits (643), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 139/353 (39%), Positives = 211/353 (59%), Gaps = 24/353 (6%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENL 60
           M++   +  SG+Q TG L LGNYLG ++N +   +   +   Y + D+H+IT       L
Sbjct: 6   MINDKKVLFSGMQATGNLTLGNYLGALKNWVTLSD--EYECFYSVVDMHSITVRQDPATL 63

Query: 61  RYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKE 120
           R ++R  +  ++AAG+DP +N I+ QS V  HA+L+WIL+C   MG +N M QFK+KS +
Sbjct: 64  RKRARALLTLYIAAGLDPKKNCIYYQSHVSAHAELAWILNCFTYMGELNRMTQFKDKSAK 123

Query: 121 NKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEV 180
           + +   + GLF YPVLMAADILLY+A  VPVG DQ QHLEITR IA+RFN  +       
Sbjct: 124 HADNINA-GLFTYPVLMAADILLYQADVVPVGVDQMQHLEITRDIAERFNNIY------- 175

Query: 181 AQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIA 240
                         F + E  I    ++I SL++ SKKMSKSD +  + I L+D+PD I 
Sbjct: 176 -----------GDVFTVPEAYIGKVGAKIMSLQEPSKKMSKSDENPNASIYLMDDPDTIM 224

Query: 241 KKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLAL 300
           +K ++A TD +   ++V   + +   KNLI+I++     K EE  K+F GK +  FK+A+
Sbjct: 225 RKCKRAVTDSE---AQVLYRDTQPGIKNLIDIYSACTGKKAEEVEKEFDGKGYGDFKMAV 281

Query: 301 ADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            +AV+  + P+  ++  L KDK+Y+D I+ E A +A   A +T++ V++ +G 
Sbjct: 282 GEAVVSVLKPLQDEVARLEKDKAYIDGIIKENAEKAGYFANKTLRKVHKKIGF 334


>gi|61651796|ref|NP_001013341.1| tryptophanyl-tRNA synthetase, mitochondrial [Danio rerio]
 gi|60416018|gb|AAH90784.1| Tryptophanyl tRNA synthetase 2, mitochondrial [Danio rerio]
 gi|182888774|gb|AAI64194.1| Wars2 protein [Danio rerio]
          Length = 364

 Score =  252 bits (643), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 145/351 (41%), Positives = 209/351 (59%), Gaps = 26/351 (7%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  L  SG+QPTG+ HLGNYLG + + +  Q+  + + MY I DLH+IT     + LR  
Sbjct: 38  SKGLVFSGIQPTGIPHLGNYLGALESWVALQDEYSTV-MYSIVDLHSITQPQDPQVLRDN 96

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
                AS LA G+DP+R+I+F+QS V  HA+LSWIL C+  M  + ++ Q+K KSK+  E
Sbjct: 97  IMDMAASLLACGIDPTRSILFQQSQVSEHAELSWILGCLTSMPRLRHLPQWKMKSKQKNE 156

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
              S+GL+ YPVL AADILLY++THVPVGEDQ QHLE+ + +A+ FN ++          
Sbjct: 157 --GSVGLYTYPVLQAADILLYKSTHVPVGEDQIQHLELAQDLARIFNNQYGE-------- 206

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
                      FP    L+ S   +++SLRD S KMSKSD   FS + L D PD IA KI
Sbjct: 207 ----------IFPEPRALL-SGTRKVKSLRDPSSKMSKSDPQRFSAVFLNDTPDDIALKI 255

Query: 244 QKAKTDGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALAD 302
           ++A TD     SEV+   + R    NL+ + A +    +E  ++   G +  Q+K  +A+
Sbjct: 256 RRAVTD---FTSEVTYEPDTRPGVSNLVSMHAAVSGQTVEGVIRLAEGMDTGQYKNMVAE 312

Query: 303 AVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           A+I+++ PI  +IQ L  D+ YL+++L +GA +AR  A   MK V ++VG 
Sbjct: 313 AIIKKLQPIRLEIQRLRADQGYLESLLAQGAEKARSLAAPVMKEVRKLVGF 363


>gi|239943728|ref|ZP_04695665.1| tryptophanyl-tRNA synthetase [Streptomyces roseosporus NRRL 15998]
 gi|239990177|ref|ZP_04710841.1| tryptophanyl-tRNA synthetase [Streptomyces roseosporus NRRL 11379]
 gi|291447188|ref|ZP_06586578.1| tryptophanyl-tRNA synthetase 1 [Streptomyces roseosporus NRRL
           15998]
 gi|291350135|gb|EFE77039.1| tryptophanyl-tRNA synthetase 1 [Streptomyces roseosporus NRRL
           15998]
          Length = 355

 Score =  252 bits (643), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 140/346 (40%), Positives = 196/346 (56%), Gaps = 23/346 (6%)

Query: 9   VSGVQPT-GVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SG+QPT G  HLGNYLG +R  +  QE+  H   Y + DLHAIT       LR  +RL 
Sbjct: 27  LSGIQPTAGSFHLGNYLGAVRQWVALQES--HDAFYMVVDLHAITVPQDPAELRANTRLA 84

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
           VA  LAAG+DP R  +F QS V  HA L W+++C+   G  + M QFK+KS +   + A+
Sbjct: 85  VAQLLAAGLDPERCTLFVQSHVPEHAQLGWVMNCLTGFGEASRMTQFKDKSAKQGADRAT 144

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GLF YPVL  ADILLY+A  VPVGEDQRQH+E+TR +A+RFN            +Y Q 
Sbjct: 145 VGLFTYPVLQVADILLYQANQVPVGEDQRQHIELTRDLAERFNG-----------RYGQT 193

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F +    I    ++I  L+D + KMSKS S+    INLLD+P + AKK++ A 
Sbjct: 194 -------FTVPAPYILKETAKIFDLQDPAVKMSKSASTPKGLINLLDDPKVTAKKVKSAV 246

Query: 248 TDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
           TD D +       E +    NL+ I +T+    +E+  + + GK +   K  LA+A++E 
Sbjct: 247 TDTDTVIRFDE--EKKPGVSNLLTILSTLSGSSVEDLERSYEGKGYGALKTDLAEAMVEF 304

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + P   + Q  L D   LD+IL +GA +AR  A ET+    + +G 
Sbjct: 305 VTPFRARTQEYLDDPETLDSILAKGAEKARAVAAETLAQTYDRMGF 350


>gi|298242315|ref|ZP_06966122.1| tryptophanyl-tRNA synthetase [Ktedonobacter racemifer DSM 44963]
 gi|297555369|gb|EFH89233.1| tryptophanyl-tRNA synthetase [Ktedonobacter racemifer DSM 44963]
          Length = 345

 Score =  252 bits (643), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 147/347 (42%), Positives = 207/347 (59%), Gaps = 27/347 (7%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQPTG +HLGNYLG IRN +  Q    +  ++ I DLHAIT  I    L   +R   A
Sbjct: 24  SGVQPTGNIHLGNYLGAIRNWVVGQ--AQYENIFCIVDLHAITLPIDARELHENTRKLAA 81

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LA G+D     +F QS V  HA+L+WIL+C   MGW+N M QFK K+ ++ + + S G
Sbjct: 82  LYLAVGLDLEHCKLFVQSHVQEHAELTWILNCFTPMGWLNRMTQFKTKAADDLD-SVSNG 140

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L+ YPVLMA+DILLY A +VPVG+DQRQH+E+TR IAQRFN+ +++ +            
Sbjct: 141 LYSYPVLMASDILLYHAHYVPVGDDQRQHVELTRDIAQRFNSLYKQPV------------ 188

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                F + +  I   A+RI SL + +KKMSKSD    SRINLLD+P +I KKI +A+TD
Sbjct: 189 -----FTLPQAQIRDVAARIMSLSEPTKKMSKSDPDPQSRINLLDDPKVIKKKIGRAQTD 243

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFA--TMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
            + L   V     R    +L+ I+   T ++  + EA  +F GK +  FK AL + ++  
Sbjct: 244 SERL---VKFDPQRPGITSLLSIYQAITGKEQAVIEA--EFEGKGYGDFKAALTEQLVAT 298

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
           + PI ++    + D + L+ IL +GA+  R  AQET+  V  +VGL 
Sbjct: 299 LEPIQKRYYEYINDMAELENILKQGADAVRPIAQETVCNVKTVVGLG 345


>gi|320530797|ref|ZP_08031837.1| tryptophan--tRNA ligase [Selenomonas artemidis F0399]
 gi|320136956|gb|EFW28898.1| tryptophan--tRNA ligase [Selenomonas artemidis F0399]
          Length = 351

 Score =  251 bits (642), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 141/348 (40%), Positives = 202/348 (58%), Gaps = 24/348 (6%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           + +SG+QPTG   LGNYLG ++N    QE+ +    YF+ADLHA+T     E  R QSR 
Sbjct: 28  IILSGIQPTGTFTLGNYLGAVKNWRHLQESYD--CYYFVADLHALTVYNEPEKRRRQSRE 85

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A  LA G+DP  +++F QS V  HA + W+LSC++  G +  M QFK+KS ++ E+  
Sbjct: 86  AFALLLACGLDPKESLVFIQSHVPAHAQMGWMLSCLSPFGDLTRMTQFKDKSAKHPEDI- 144

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           + GLF YP LMA DILLY+A +VPVG DQ+QHLE TR +A+RFN    R   EV      
Sbjct: 145 NAGLFTYPALMAGDILLYQADYVPVGADQKQHLEFTRDVAERFN----RVYGEV------ 194

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F + EG      +R++SL++ + KMSKSD++  + I +LD+   I +K + A
Sbjct: 195 --------FRLPEGYYPKEGARVKSLQEPTAKMSKSDTNAKATIYILDDEKTILRKFRSA 246

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
            TD +   SEV+  E +    NL+ I+A +    ++E   +F GK +  FK A+   V  
Sbjct: 247 VTDSE---SEVAFREGKDGVNNLMTIYAAVTGKNMDEITAEFAGKGYGDFKTAVGTVVAN 303

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
           E+ PI +K   LL DK YLD  + EGA RA   A+ T++     +GL+
Sbjct: 304 ELRPIREKYAELLADKEYLDAAIREGAERASAIAERTLRKAKRKMGLT 351


>gi|326389494|ref|ZP_08211061.1| tryptophanyl-tRNA synthetase [Thermoanaerobacter ethanolicus JW
           200]
 gi|325994499|gb|EGD52924.1| tryptophanyl-tRNA synthetase [Thermoanaerobacter ethanolicus JW
           200]
          Length = 327

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 145/345 (42%), Positives = 208/345 (60%), Gaps = 28/345 (8%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQPTG +H+GNYLG +R  +  Q+  ++   +   DLHA+T     + L+ ++    A
Sbjct: 6   SGVQPTGDIHIGNYLGAMRQFVALQD--DYECFFCAVDLHALTVPQDPKVLKEKTIELAA 63

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LA G+DP +  IF QS V  HA+L+W+L C+   G ++ M QFK+KSK   +E+ S+G
Sbjct: 64  LYLAIGLDPKKVTIFIQSHVPAHAELAWLLQCITYFGELSRMTQFKDKSK--GKESVSVG 121

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LMAADILLY   +VPVGEDQ+QHLE+TR IAQRFN  F                
Sbjct: 122 LFTYPDLMAADILLYNTHYVPVGEDQKQHLELTRDIAQRFNNRFGET------------- 168

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                F + E +I    +RI SL D +KKMSKSDS   +RINLLD P +I KKI +A TD
Sbjct: 169 -----FVVPEPMILKLGARIMSLTDPTKKMSKSDSDPNNRINLLDEPSVIKKKIMRAVTD 223

Query: 250 GDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
            +   +E+    EN+    NL+ I++    ++IEE + +F G+ +   K  LA+ VI+++
Sbjct: 224 SE---TEIRIDWENKPGVSNLLTIYSLFTGMEIEEVVNKFKGQGYGTLKKELAEVVIDKL 280

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
             I +  + L +D  Y+  +L EGA RA+  A++T+K V E +GL
Sbjct: 281 TVIQKNYKDLSRD--YVLKVLKEGAERAQAVAEKTLKEVKEKMGL 323


>gi|42570921|ref|NP_973534.1| OVA4 (ovule abortion 4); ATP binding / aminoacyl-tRNA ligase/
           nucleotide binding / tryptophan-tRNA ligase [Arabidopsis
           thaliana]
 gi|330252665|gb|AEC07759.1| tryptophanyl-tRNA synthetase [Arabidopsis thaliana]
          Length = 396

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 147/348 (42%), Positives = 200/348 (57%), Gaps = 30/348 (8%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           VSGVQPTG +HLGNYLG I+N +  Q+T   L  + I D HA T +              
Sbjct: 68  VSGVQPTGSVHLGNYLGAIKNWVALQDTYETL--FIIVDHHAATTDTA------------ 113

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+D S+  +F QS V  H +L W+L     +GW+  MIQFKEKS++   E AS+
Sbjct: 114 ALYLACGIDVSKASVFVQSHVPAHVELMWLLCSSTPIGWLQKMIQFKEKSRKEGVENASV 173

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GLF YP LM ADILLY++  VPVGEDQ+QH+E+ R IAQR N  +        +K+ +  
Sbjct: 174 GLFTYPDLMTADILLYQSDFVPVGEDQKQHIELAREIAQRVNHLY------GGKKWKKLG 227

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                 F I E LI  + +R+ SL D   KMSKS  SD SRINLLD+ D+I  KI++ KT
Sbjct: 228 GRGGSLFKIPEPLIPQAGARVMSLTDGLSKMSKSAPSDQSRINLLDSKDLIVDKIKRCKT 287

Query: 249 DGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           D        +GLE     R E  NL+ I+  +   K EE +++    ++  FK  LADA+
Sbjct: 288 DS------FAGLEFDNAERPECNNLLSIYQIVSGKKKEEVMEECKDMSWGTFKPLLADAL 341

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVG 352
           IE + PI  + Q ++ +  YLD IL EGA+RA      TM+ + + +G
Sbjct: 342 IEHLSPIQARYQEIIAEPEYLDKILSEGADRAEELGAVTMRNMYQAMG 389


>gi|221635772|ref|YP_002523648.1| tryptophanyl-tRNA synthetase [Thermomicrobium roseum DSM 5159]
 gi|221158148|gb|ACM07266.1| tryptophanyl-tRNA synthetase [Thermomicrobium roseum DSM 5159]
          Length = 334

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 148/346 (42%), Positives = 199/346 (57%), Gaps = 26/346 (7%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QPTG +HLGNYLG IRN + +Q+  +++  + I DLHA+T       LR ++    +
Sbjct: 9   SGIQPTGGIHLGNYLGAIRNWVLQQDQYDNI--FSIVDLHAMTIPYDPRELRQRTLEVGS 66

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
             LAAG+DP R+I+F QSDV  H +L WIL  +A  G +  M QFKEKSK N  E    G
Sbjct: 67  VLLAAGIDPERSILFVQSDVREHTELCWILGTLATFGELRRMTQFKEKSKGN--ERVGAG 124

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YPVL AADILLY A  VPVGEDQ+QH+E+TR +A RFN  F                
Sbjct: 125 LFFYPVLQAADILLYDAAVVPVGEDQKQHIELTRDLAIRFNNTFGET------------- 171

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                F + E  I  + +RI SL D  KKMSKSD    SRI L D P++I +KI+KA TD
Sbjct: 172 -----FVVPEPDIKPAGARIMSLTDPLKKMSKSDPDPDSRIELRDPPEVIRRKIRKAVTD 226

Query: 250 GDVLPSEVSGLENRLEA-KNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
            + +   +   E R  A  NL+ I++ +  I I E  +++ GK + QFK  LA+ +I+ +
Sbjct: 227 SETV---IRYDEERKPAISNLLTIYSLLSGIPIPELEERYAGKGYGQFKQDLAEVIIQAL 283

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
            PI Q+++ L+     +   L EGA +AR  A   M  V E  GL 
Sbjct: 284 APIQQRLEELVAQPGIVIRTLQEGAAKARELASAKMALVRERCGLG 329


>gi|325576617|ref|ZP_08147335.1| tryptophan--tRNA ligase [Haemophilus parainfluenzae ATCC 33392]
 gi|325161180|gb|EGC73295.1| tryptophan--tRNA ligase [Haemophilus parainfluenzae ATCC 33392]
          Length = 334

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 142/344 (41%), Positives = 202/344 (58%), Gaps = 21/344 (6%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQP+G L +GNYLG +RN ++ QE  ++  ++ + DLHAIT       LR  +   +A
Sbjct: 8   SGVQPSGELTIGNYLGALRNWVKMQE--DYECIFCVVDLHAITVRQDPVALRKATLDVLA 65

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LA G+DP+++ IF QS V  H  LSW+L+C    G M+ M QFK+KS    E   ++G
Sbjct: 66  LYLACGIDPNKSTIFVQSHVPEHTQLSWVLNCYTYFGEMSRMTQFKDKSARYAENI-NVG 124

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YPVLMAADILLY+A  VPVG+DQ+QHLEITR IA RFN  +                
Sbjct: 125 LFDYPVLMAADILLYQAKSVPVGDDQKQHLEITRDIAARFNALY---------------- 168

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                F I E  +  + +RI SL+D  KKMSKSD +  + + LL++P  +AKKI++A TD
Sbjct: 169 --GDIFTIPEIFLGKAGARIMSLQDPDKKMSKSDDNRNNVVTLLEDPKSVAKKIKRAVTD 226

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            D  P     ++N+    NL++I + +    + E  K+F GK +   K A+AD V   + 
Sbjct: 227 SDEPPVVRYDVKNKAGVSNLLDILSAVTDKSVAELEKEFEGKMYGHLKTAVADEVSNLLA 286

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + ++      D++ LD IL +GA +AR RA+ET+  V E VG 
Sbjct: 287 GLQERFYQYRNDEALLDEILRQGAEKARARAKETLAKVYEAVGF 330


>gi|114558576|ref|XP_001143329.1| PREDICTED: similar to mitochondrial tryptophanyl-tRNA synthetase
           isoform 2 [Pan troglodytes]
          Length = 331

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 139/354 (39%), Positives = 214/354 (60%), Gaps = 25/354 (7%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENL 60
           M  S     SG+QPTG+LHLGNYLG I + +R Q+  + + +Y I DLH+IT       L
Sbjct: 1   MKDSKKRVFSGIQPTGILHLGNYLGAIESWVRLQDEYDSV-LYSIVDLHSITVPQDPAVL 59

Query: 61  RYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKE 120
           R       A  LA G++P ++I+F+QS V  H  LSWILSC+ R+  + ++ Q+K K+ +
Sbjct: 60  RQSILDMTAVLLACGINPEKSILFQQSQVSEHTQLSWILSCMVRLPRLQHLHQWKAKTTK 119

Query: 121 NKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEV 180
            K +  ++GL  YPVL AADILLY++THVPVGEDQ QH+E+ + +AQ FN          
Sbjct: 120 QKHD-GTVGLLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQGFN---------- 168

Query: 181 AQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIA 240
            +KY +       FFP+ E ++ +S  +++SLRD S KMSKSD    + + + D+P+ I 
Sbjct: 169 -KKYGE-------FFPVPESIL-TSMKKVKSLRDPSAKMSKSDPDKLATVRITDSPEEIV 219

Query: 241 KKIQKAKTDGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLA 299
           +K +KA TD     SEV+     R    N++ + A +  + +EE +++  G N +++KLA
Sbjct: 220 QKFRKAVTD---FTSEVTYDPAGRAGVSNIVAVHAAVTGLSVEEVVRRSAGMNTARYKLA 276

Query: 300 LADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           +ADAVIE+  PI ++I+ L  DK +L+ +L  G+ +A+  A    + V ++VG 
Sbjct: 277 VADAVIEKFAPIKREIEKLKLDKDHLEKVLQIGSAKAKELAYTVCQEVKKLVGF 330


>gi|219126869|ref|XP_002183670.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217404907|gb|EEC44852.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 360

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 145/361 (40%), Positives = 210/361 (58%), Gaps = 23/361 (6%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQ---ETCNHLG-------MYFIADLHAITNNIVQE 58
           +SGVQPTG LHLGNYLG IR  +  Q   +T +  G        + + DLHAIT     +
Sbjct: 3   LSGVQPTGTLHLGNYLGAIRQWVDFQNAPDTQDEEGNVIQTENFFCVVDLHAITMPHNPQ 62

Query: 59  NLRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKS 118
           +L   +    A +LAAG+DP+++ +F QS V  HA+L+W+L C+  M W+  MIQFK+K+
Sbjct: 63  DLGESTLSSAALYLAAGIDPTKSKVFVQSHVPQHAELAWLLMCITPMNWLERMIQFKDKA 122

Query: 119 KENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIK 178
           K+  E   + GLF YP LMAADILLY+A  +PVGEDQRQHLE+ R   +RF+  F  K  
Sbjct: 123 KKQGESVGT-GLFTYPSLMAADILLYQADKIPVGEDQRQHLELARDTTRRFHDLF-CKGN 180

Query: 179 EVAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDI 238
              ++       S+  F   E +I    +R+ SL+D + KMSKSD +D SRIN+LD PD+
Sbjct: 181 PYKKRCKAAGIPSRPVFVEPEAMIVKEGARVMSLQDGTSKMSKSDVNDGSRINVLDPPDV 240

Query: 239 IAKKIQKAKTDGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKI-EEALKQFGGKNF 293
           I +K+++ KTD       + G+E     R EA NL+ IFA ++  +  ++ L Q     +
Sbjct: 241 IREKVKRCKTDA------IKGIEWDNPERPEATNLLNIFAAVQPDRTRDDILAQVRDLTW 294

Query: 294 SQFKLALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
             FK  LADA++  + PI ++   +  D+ YL  +L EGA+ A   AQ T+      +G 
Sbjct: 295 GDFKPILADAIVNHLEPIQKRYHAVRADEEYLQAVLKEGADVASEVAQRTLHSARVAMGF 354

Query: 354 S 354
           +
Sbjct: 355 A 355


>gi|33151428|ref|NP_872781.1| tryptophanyl-tRNA synthetase [Haemophilus ducreyi 35000HP]
 gi|39932108|sp|Q7VPB2|SYW_HAEDU RecName: Full=Tryptophanyl-tRNA synthetase; AltName:
           Full=Tryptophan--tRNA ligase; Short=TrpRS
 gi|33147648|gb|AAP95170.1| tryptophanyl-tRNA synthetase [Haemophilus ducreyi 35000HP]
          Length = 342

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 139/350 (39%), Positives = 211/350 (60%), Gaps = 11/350 (3%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           + ++  SGVQP+G L +GNYLG +RN +  Q+  ++  ++ I DLHAIT       LR  
Sbjct: 2   TKSIVFSGVQPSGELTIGNYLGALRNWVTLQD--DYDCLFCIVDLHAITVRQDPIALRKS 59

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           +   +A +LA G+DP+++ IF QS V  H+ L+W+L+C    G M  M QFK+KS    E
Sbjct: 60  TLDVLALYLACGIDPNKSTIFIQSQVPEHSQLAWVLNCYTYFGEMGRMTQFKDKSARY-E 118

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
           E  ++GLF YPVLMAADILLY+A  VPVG+DQ+QHLEITR IA RFNT + +K       
Sbjct: 119 ENVNVGLFTYPVLMAADILLYQANQVPVGDDQKQHLEITRDIANRFNTLYGKK------- 171

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
              E +  +  F + E  I  + +R+ SL + +KKMSKSD +  + I LL++P  +AKKI
Sbjct: 172 -DAEGKLIESVFTVPECFIAKACARVMSLLEPTKKMSKSDDNRNNVIGLLEDPKAVAKKI 230

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           ++A TD D  P      +N+    NL++I A +    + E   +F GK +   K  +AD 
Sbjct: 231 KRAMTDSDEPPVIKYDQKNKAGVSNLLDILAAITGKSMVELEAEFEGKMYGHLKTEVADQ 290

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           V+  +  + ++ Q   +D++ L+ I  +GA +AR RA++T+  V +++G 
Sbjct: 291 VMAMLTGLQERYQRFRQDEALLEKIYRDGAEKARMRAKKTLDEVYKLIGF 340


>gi|319775422|ref|YP_004137910.1| tryptophanyl-tRNA synthetase [Haemophilus influenzae F3047]
 gi|329122552|ref|ZP_08251134.1| tryptophan--tRNA ligase [Haemophilus aegyptius ATCC 11116]
 gi|317450013|emb|CBY86226.1| tryptophanyl-tRNA synthetase [Haemophilus influenzae F3047]
 gi|327473135|gb|EGF18560.1| tryptophan--tRNA ligase [Haemophilus aegyptius ATCC 11116]
          Length = 334

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 141/344 (40%), Positives = 202/344 (58%), Gaps = 21/344 (6%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQP+G L +GNYLG +RN ++ QE  ++  ++ + DLHAIT       LR  +   +A
Sbjct: 8   SGVQPSGELTIGNYLGALRNWVKMQE--DYECIFCVVDLHAITVRQDPVALRKATLDVLA 65

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LA G+DP+++ IF QS V  H  LSW+L+C    G M+ M QFK+KS    E   ++G
Sbjct: 66  LYLACGIDPNKSTIFVQSHVPEHTQLSWVLNCYTYFGEMSRMTQFKDKSARYAENI-NVG 124

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YPVLMAADILLY+A  VPVG+DQ+QHLEITR IA RFN  +                
Sbjct: 125 LFDYPVLMAADILLYQAKSVPVGDDQKQHLEITRDIANRFNALY---------------- 168

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                F I E  I  + +RI SL+D  KKMSKSD +  + + LL++P  +AKKI++A TD
Sbjct: 169 --GNIFTIPEIFIGKAGARIMSLQDPEKKMSKSDDNRNNVVTLLEDPKSVAKKIKRAVTD 226

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            D  P     ++N+    NL++I + +    I +  K+F GK +   K A+AD V   + 
Sbjct: 227 SDEPPVVRYDVQNKAGVSNLLDILSAVTDKPIADLEKEFEGKMYGHLKTAVADEVSTLLA 286

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + ++      D++ LD IL +G ++AR +AQET+  V E +G 
Sbjct: 287 GLQERFHQYRNDEALLDNILRQGTDKARAKAQETLAKVYEALGF 330


>gi|123965898|ref|YP_001010979.1| tryptophanyl-tRNA synthetase [Prochlorococcus marinus str. MIT
           9515]
 gi|123200264|gb|ABM71872.1| Tryptophanyl-tRNA synthetase [Prochlorococcus marinus str. MIT
           9515]
          Length = 347

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 145/350 (41%), Positives = 202/350 (57%), Gaps = 29/350 (8%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQPTG LH+GN+LG I N +  QE   H     + DLHAIT     + L   +    
Sbjct: 17  LSGVQPTGDLHIGNWLGAINNWVALQE--KHETFLCVVDLHAITTEYDPKQLSRNTLSTA 74

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A ++A G+DP    IF QS +  H++L WIL+C+  + WM  MIQFKEKS + +    S+
Sbjct: 75  ALYVACGIDPKICSIFVQSQISAHSELCWILNCMTPINWMERMIQFKEKSVQ-QGNNVSI 133

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIA-QRFNTEFERKIKEVAQKYAQE 187
           GLF YP+LMAADILLY A +VPVGEDQ+QHLE+ R IA QR N +F +K           
Sbjct: 134 GLFDYPILMAADILLYDADYVPVGEDQKQHLELARDIAQQRINAKFSKK----------- 182

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
               K    I + +I    S+I SL D SKKMSKSD ++ SRINLLD P+II KKI++AK
Sbjct: 183 ----KNILKIPQPIIMKKGSKIMSLNDGSKKMSKSDINEGSRINLLDTPEIITKKIKRAK 238

Query: 248 TDGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           +D  +      G+E    +R E++NL+ I++ +   +I +    F    +  FK    + 
Sbjct: 239 SDSHI------GMEFNNPDRPESRNLLMIYSLLSGKEISDLENDFSQTGWGTFKKIFTEQ 292

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           VIE + PI ++   L+ D   L+ IL+EG  +A   A +T+  V   +G 
Sbjct: 293 VIESLEPIQERYNVLINDPYELNKILLEGKEKAELVANKTLSRVKSELGF 342


>gi|307264854|ref|ZP_07546416.1| tryptophanyl-tRNA synthetase [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306920112|gb|EFN50324.1| tryptophanyl-tRNA synthetase [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 327

 Score =  251 bits (640), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 144/345 (41%), Positives = 206/345 (59%), Gaps = 28/345 (8%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQP+G +H+GNYLG +R  +  QE  ++   + + DLHA+T       L+  +     
Sbjct: 6   SGVQPSGDIHIGNYLGAMRQFVALQE--DYECFFCVVDLHALTVPQDPIKLKENTIELAG 63

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LA G+DP +  +F QS V  HA+L+W+L C+   G ++ M QFKEKSK   +ET S+G
Sbjct: 64  LYLAIGLDPKKVTLFIQSHVAAHAELAWLLQCMTYFGELSRMTQFKEKSK--GKETVSVG 121

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LMAADILLY   +VPVGEDQ+QHLE+TR IAQRFN  F                
Sbjct: 122 LFTYPDLMAADILLYNTHYVPVGEDQKQHLELTRDIAQRFNNRFGET------------- 168

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                F + E +I    +RI SL D +KKMSKSDS   +RINLLD P +I KKI +A TD
Sbjct: 169 -----FVVPEPMILKFGARIMSLTDPTKKMSKSDSDPNNRINLLDEPSVIKKKIMRAVTD 223

Query: 250 GDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
            +   +E+    EN+    NL+ I++    ++IEE + +F G+ +   K  LA+ VI+++
Sbjct: 224 SE---TEIRLDWENKPGVSNLLTIYSLFTGMEIEEVVNKFKGQGYGTLKKELAEVVIDKL 280

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
             I +  + L +D  Y+  +L EGA RA+  A++T++ V E +GL
Sbjct: 281 TVIQKNYKDLSRD--YVLKVLKEGAERAQAVAEKTLREVKEKMGL 323


>gi|170764289|ref|ZP_02640490.2| tryptophanyl-tRNA synthetase [Clostridium perfringens CPE str.
           F4969]
 gi|170713690|gb|EDT25872.1| tryptophanyl-tRNA synthetase [Clostridium perfringens CPE str.
           F4969]
          Length = 341

 Score =  251 bits (640), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 140/348 (40%), Positives = 211/348 (60%), Gaps = 26/348 (7%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYF-IADLHAITNNIVQENLRYQSR 65
           +  SG+QP+G L LGNYLG I+N  + QE  +    YF + DLHAIT   +  +LR ++ 
Sbjct: 16  IIFSGIQPSGDLTLGNYLGAIKNWTKLQEEYD---CYFCVVDLHAITVKQLPADLRRRTL 72

Query: 66  LFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEET 125
             +A ++A+G+DP +N +F QS V  H++ SW+L+C + MG ++ M Q+K+KSK+  +  
Sbjct: 73  EVLAIYIASGIDPEKNTLFIQSHVPAHSEASWLLTCNSYMGELSRMTQYKDKSKKMGDSI 132

Query: 126 ASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYA 185
            + GLF YPVLMAADILLY A  VPVG+DQ QHLE+ R IA RFN  + +          
Sbjct: 133 GA-GLFNYPVLMAADILLYNADLVPVGKDQMQHLELARDIAARFNNSYSKT--------- 182

Query: 186 QEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQK 245
                    F I EG I    ++I  L+D SKKMSKSDS+  S I ++D P++I KKI +
Sbjct: 183 ---------FTIPEGYIPKEGAKIMDLQDPSKKMSKSDSNPNSFILMMDEPNVIRKKISR 233

Query: 246 AKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVI 305
           A TD   +   V+  + +   KNLI I   ++    EE +K + GK +++FK  +A++++
Sbjct: 234 AVTDSIGV---VNYTDEQPGVKNLINILCAIKGYTPEEVVKMYDGKGYAEFKNDVAESIV 290

Query: 306 EEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           EE+ PI ++ + LL DK  L+ I   GA +A   A +T++ + + +GL
Sbjct: 291 EELAPIQERAKDLLGDKKALEEIYKNGAEKANYAAMKTLRKMQKKIGL 338


>gi|145535025|ref|XP_001453251.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124420962|emb|CAK85854.1| unnamed protein product [Paramecium tetraurelia]
          Length = 330

 Score =  251 bits (640), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 134/354 (37%), Positives = 218/354 (61%), Gaps = 33/354 (9%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIV-------QEN 59
           ++ SG+QPTG +H+GNYLG +RN ++ Q+  N   +Y I DLHA+T+ +         +N
Sbjct: 1   MYFSGIQPTGKMHIGNYLGAVRNWVKLQQPGNQ-NIYCIVDLHALTDKLTIDHEIKFDQN 59

Query: 60  LRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSK 119
            +  +    A+ +A+G++P +++ F QS V  HA+L WILSC+A   W+N M Q+K+K  
Sbjct: 60  TKSDTLSLAATLIASGINPKQSVFFIQSHVPEHAELQWILSCIAPKNWLNKMTQYKDK-- 117

Query: 120 ENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKE 179
             K+E ++LGL+ YP+LMAADI+LY+A +VPVG DQ+QH+E+TR   QR N+ F+  I  
Sbjct: 118 --KKEYSTLGLYTYPLLMAADIILYQAQYVPVGLDQKQHIELTRDYVQRLNSLFKLNI-- 173

Query: 180 VAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDII 239
                  E QY           ++S+  +I SLRD +KKMSKSD+ D +RIN+ D+ + I
Sbjct: 174 ------VEPQY-----------LESTCPKIMSLRDGNKKMSKSDAIDGNRINIDDSKEEI 216

Query: 240 AKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLA 299
            +KI+++KTD   +P      + R E  NL+ I++    + +E+ ++++  K    FK  
Sbjct: 217 FEKIKRSKTDS--IPQIYFDQDKRPEISNLLRIYSAFSNLSMEQVIEKYLTKTTVDFKRD 274

Query: 300 LADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           L++ +  E+  I+QK + +L ++S L+  L EG+ +AR  A + +K + E +GL
Sbjct: 275 LSELIANELNTIAQKKKQILNNQSELEQTLKEGSMKAREIASKNLKLIKENIGL 328


>gi|317969698|ref|ZP_07971088.1| tryptophanyl-tRNA synthetase [Synechococcus sp. CB0205]
          Length = 342

 Score =  251 bits (640), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 148/350 (42%), Positives = 203/350 (58%), Gaps = 23/350 (6%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQPTG LHLGN+LG IRN +  QET  H   + + DLHAIT       L   +R   
Sbjct: 7   LSGVQPTGALHLGNWLGAIRNWVGLQET--HDTFFCVVDLHAITVPHDAAALARDTRNTA 64

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+DP +  +F QS V  H++L W+L+CV  + W+  MIQFKEK+ +  ++  S+
Sbjct: 65  ALYLACGIDPEKATVFVQSHVSAHSELCWLLNCVTPLNWLERMIQFKEKAVKQGDQV-SV 123

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIA-QRFNTEFERKIKEVAQKYAQE 187
           GL  YPVLMAADILLY A  VPVGEDQ+QHLE+ R IA QR N  F       A + A+ 
Sbjct: 124 GLLDYPVLMAADILLYDADLVPVGEDQKQHLELARDIAQQRINARF-------APRDAEG 176

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
           E        + E LI    +R+ SL D   KMSKSD ++ SR+NLLD+P++I KK+++AK
Sbjct: 177 EPIP--VLKVPEPLILKEGARVMSLTDGRSKMSKSDPNEGSRVNLLDSPEVITKKVKRAK 234

Query: 248 TDGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           TD       V GLE     R E  NL+ ++A +     E A  +     +  FK  LA+ 
Sbjct: 235 TD------PVMGLEFGNPERPETDNLLGLYALLSGKGREAAAAECAAMGWGTFKPLLAET 288

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           ++E + PI ++   L  D + LD +L  G+ RA   AQ T++   E +G 
Sbjct: 289 LVEALRPIQERYNDLSADPAELDRVLKAGSERANAVAQATLERTREALGF 338


>gi|167040341|ref|YP_001663326.1| tryptophanyl-tRNA synthetase [Thermoanaerobacter sp. X514]
 gi|256750726|ref|ZP_05491611.1| tryptophanyl-tRNA synthetase [Thermoanaerobacter ethanolicus CCSD1]
 gi|300914425|ref|ZP_07131741.1| tryptophanyl-tRNA synthetase [Thermoanaerobacter sp. X561]
 gi|307724339|ref|YP_003904090.1| tryptophanyl-tRNA synthetase [Thermoanaerobacter sp. X513]
 gi|166854581|gb|ABY92990.1| tryptophanyl-tRNA synthetase [Thermoanaerobacter sp. X514]
 gi|256750309|gb|EEU63328.1| tryptophanyl-tRNA synthetase [Thermoanaerobacter ethanolicus CCSD1]
 gi|300889360|gb|EFK84506.1| tryptophanyl-tRNA synthetase [Thermoanaerobacter sp. X561]
 gi|307581400|gb|ADN54799.1| tryptophanyl-tRNA synthetase [Thermoanaerobacter sp. X513]
          Length = 327

 Score =  251 bits (640), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 146/345 (42%), Positives = 207/345 (60%), Gaps = 28/345 (8%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQP+G +H+GNYLG +R  +  Q+  ++   +   DLHA+T     + L+ ++    A
Sbjct: 6   SGVQPSGDIHIGNYLGAMRQFVALQD--DYECFFCAVDLHALTVPQDPKVLKEKTIELAA 63

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LA G+DP +  IF QS V  HA+L+W+L C+   G ++ M QFK+KSK   +E+ S+G
Sbjct: 64  LYLAIGLDPKKVTIFIQSHVPAHAELAWLLQCITYFGELSRMTQFKDKSK--GKESVSVG 121

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LMAADILLY   +VPVGEDQ+QHLE+TR IAQRFN  F                
Sbjct: 122 LFTYPDLMAADILLYNTHYVPVGEDQKQHLELTRDIAQRFNNRFGET------------- 168

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                F + E +I    +RI SL D +KKMSKSDS   +RINLLD P  I KKI KA TD
Sbjct: 169 -----FVVPEPMILKLGARIMSLTDPTKKMSKSDSDPNNRINLLDEPSSIKKKIMKAVTD 223

Query: 250 GDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
            +   SE+    +N+    NL+ I++    ++IEE + +F G+ +   K  LA+ VI+++
Sbjct: 224 SE---SEIRLDWDNKPGVSNLLTIYSLFTGMEIEEVINKFNGQGYGTLKKELAEVVIDKL 280

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
             I +  + L +D  Y+  +L EGA RA+  A++T+K V E VGL
Sbjct: 281 TVIQKNYKDLSRD--YVLKVLKEGAERAQAVAEKTLKEVKEKVGL 323


>gi|190151248|ref|YP_001969773.1| tryptophanyl-tRNA synthetase [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|307264599|ref|ZP_07546181.1| Tryptophanyl-tRNA synthetase [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|189916379|gb|ACE62631.1| Tryptophanyl-tRNA synthetase [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|306870062|gb|EFN01824.1| Tryptophanyl-tRNA synthetase [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
          Length = 342

 Score =  251 bits (640), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 142/344 (41%), Positives = 204/344 (59%), Gaps = 11/344 (3%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQP+G L +GNYLG +RN ++ Q+  + L  + I DLHAIT       LR  S   +A
Sbjct: 8   SGVQPSGELTIGNYLGALRNWVKMQDDYDCL--FCIVDLHAITVRQDPAALRKASLDVLA 65

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LA G+DP+++ IF QS V  H  L+W+L+C    G M+ M QFK+KS    EE  ++G
Sbjct: 66  LYLACGIDPNKSTIFIQSHVPEHTQLAWVLNCYTYFGEMSRMTQFKDKSAR-YEENVNVG 124

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YPVLMAADILLY+A  VPVG+DQ+QHLEITR IA RFN  + +K          E  
Sbjct: 125 LFTYPVLMAADILLYQANQVPVGDDQKQHLEITRDIANRFNALYSKK--------DAEGN 176

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
             +  F + E  I  + +R+ SL + +KKMSKSD +  + I LL++P  +AKKI++A TD
Sbjct: 177 VLEPVFQVPEVFIGKAGARVMSLLEPTKKMSKSDENRNNVIGLLEDPKAVAKKIKRAMTD 236

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
           GD  P      EN+    NL++I + +    I E   +F GK +   K  +A+ V   + 
Sbjct: 237 GDEPPVVRYDRENKAGVSNLLDILSAVSGKTIAELEAEFEGKMYGHLKTEVAEQVSTLLT 296

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            +  +     +D++ L+ I  EGA +AR RA++T+  V ++VG 
Sbjct: 297 DLQARYNQFRQDEALLERIFREGAEKARVRARKTLDEVYKLVGF 340


>gi|221119697|ref|XP_002156729.1| PREDICTED: similar to predicted protein [Hydra magnipapillata]
          Length = 339

 Score =  251 bits (640), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 147/351 (41%), Positives = 218/351 (62%), Gaps = 31/351 (8%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQ-ETCNH--LGMYFIADLHAITNNIVQENLRYQSRL 66
           SG+QPTGV HLGNYLG IR+ +  Q E  N+  + M+ I DLH+ T   VQ++   +  +
Sbjct: 11  SGIQPTGVPHLGNYLGAIRHWVELQSENKNNKDMVMFCIMDLHSYTR--VQDSNEMKDNI 68

Query: 67  F--VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEE 124
           F  +AS LA G++PS+++IF+QS V YH +LSW L C+  +G +  M Q+K KSKE K +
Sbjct: 69  FNMLASLLACGINPSQSLIFQQSQVSYHTELSWFLGCLTPVGRLTRMHQWKTKSKETKND 128

Query: 125 TASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKY 184
           T +LG+  YP LMAADILLY++THVPVG+DQ QH+E+TR +A  FN  +           
Sbjct: 129 T-NLGILSYPALMAADILLYKSTHVPVGDDQVQHMELTRDVATLFNKTY----------- 176

Query: 185 AQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQ 244
                Y+   FP+ E L+ +S  RI SLRD ++KMSKSD ++ SRINL D+PD I  KI+
Sbjct: 177 ----TYT---FPVPETLL-TSTPRISSLRDPTQKMSKSDINENSRINLNDSPDTITNKIR 228

Query: 245 KAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNF--SQFKLALAD 302
           KA TD +   S+   L+ R   +NLIEI +++ +   E  + ++    +  +Q K  + D
Sbjct: 229 KAVTDSEPYISDC--LDKRHGVRNLIEILSSLSRTSNENIINKYRNTKYFTAQLKKDVTD 286

Query: 303 AVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            +I  +  +  +   L +DK+YL+ +LV+G+ +A   A  TMK V + +G+
Sbjct: 287 ILISSLNNVRTEFNVLSQDKNYLEKVLVDGSFKANELAAVTMKEVFQKIGV 337


>gi|297663910|ref|XP_002810402.1| PREDICTED: tryptophanyl-tRNA synthetase, mitochondrial-like isoform
           1 [Pongo abelii]
          Length = 360

 Score =  251 bits (640), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 137/345 (39%), Positives = 212/345 (61%), Gaps = 25/345 (7%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QPTG+LHLGNYLG I + +R Q+  + + +Y I DLH+IT       LR       A
Sbjct: 39  SGIQPTGILHLGNYLGAIESWVRLQDEYDSV-LYSIVDLHSITVPQDPAVLRQSILDMTA 97

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
             LA G++P ++I+F+QS V  H  LSWILSC+ R+  + ++ Q+K K+ + K +  ++G
Sbjct: 98  VLLACGINPEKSILFQQSQVSEHTQLSWILSCMVRLPRLQHLHQWKAKTTKQKHD-GTVG 156

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L  YPVL AADILLY++THVPVGEDQ QH+E+ + +AQ FN           +KY +   
Sbjct: 157 LLTYPVLQAADILLYKSTHVPVGEDQIQHMELVQDLAQSFN-----------KKYGE--- 202

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
               FFP+ E ++ +S  +++SLRD S KMSKSD    + + + D+P+ I +K +KA TD
Sbjct: 203 ----FFPVPESIL-TSMKKVKSLRDPSAKMSKSDPDKLATVRITDSPEEIVQKFRKAVTD 257

Query: 250 GDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
                SEV+     R    N++ + A +  + +EE +++  G N +++KLA+ADAVIE+ 
Sbjct: 258 ---FTSEVTYDPAGRAGVSNIVAVHAAVTGLSVEEVVRRSAGMNTARYKLAVADAVIEKF 314

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            PI ++I+ L  DK +L+ +L  G+ +A+  A    + V ++VG 
Sbjct: 315 APIKREIEKLKLDKDHLEKVLQIGSAKAKELAYTVCQEVKKLVGF 359


>gi|297544721|ref|YP_003677023.1| tryptophanyl-tRNA synthetase [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
 gi|296842496|gb|ADH61012.1| tryptophanyl-tRNA synthetase [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
          Length = 327

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 145/345 (42%), Positives = 206/345 (59%), Gaps = 28/345 (8%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQP+G +H+GNYLG +R  +  QE  ++   + + DLHA+T       L+  +     
Sbjct: 6   SGVQPSGDIHIGNYLGAMRQFVALQE--DYECFFCVVDLHALTVPQDPIKLKENTIELAG 63

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LA G+DP +  +F QS V  HA+L+W+L C+   G ++ M QFKEKSK   +ET S+G
Sbjct: 64  LYLAIGLDPKKVNLFVQSHVSAHAELAWLLQCMTYFGELSRMTQFKEKSK--GKETVSVG 121

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LMAADILLY   +VPVGEDQ+QHLE+TR IAQRFN  F                
Sbjct: 122 LFTYPDLMAADILLYNTHYVPVGEDQKQHLELTRDIAQRFNNRFGET------------- 168

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                F + E +I    +RI SL D +KKMSKSDS   +RINLLD P +I KKI +A TD
Sbjct: 169 -----FVVPEPMILKFGARIMSLTDPTKKMSKSDSDPNNRINLLDEPSVIKKKIMRAVTD 223

Query: 250 GDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
            +   +E+    EN+    NL+ I++    ++IEE + +F G+ +   K  LA+ VI+++
Sbjct: 224 SE---TEIRLDWENKPGVSNLLTIYSLFTGMEIEEVVNKFKGQGYGTLKKELAEVVIDKL 280

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
             I +  + L +D  Y+  +L EGA RA+  A++T+K V E +GL
Sbjct: 281 TVIQKNYKDLSRD--YVLKVLKEGAERAQAVAEKTLKEVKEKMGL 323


>gi|47221966|emb|CAG08221.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 392

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 147/347 (42%), Positives = 209/347 (60%), Gaps = 30/347 (8%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF-- 67
           SG+QPTGV HLGNYLG + N +  Q T N   +Y I DLH+IT  + QE  + +S +   
Sbjct: 73  SGIQPTGVPHLGNYLGALENWVALQ-TQNPCVLYSIVDLHSIT--LPQEPAQLRSSILDM 129

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            AS LA G+DP R+++F+QS V  HA+LSWIL C+  M  +  + Q+K KSK+  E   S
Sbjct: 130 AASLLACGIDPERSVLFQQSQVSEHAELSWILGCLTSMPRLRQLPQWKMKSKQKNE--GS 187

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GL+ YPVL AADILLY++THVPVGEDQ QHLE+ + +A+ FN            +Y + 
Sbjct: 188 VGLYTYPVLQAADILLYKSTHVPVGEDQVQHLELAQDLARIFNG-----------RYGE- 235

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  FP    L+ S   +++SLRD S KMSKSD    + + + D+PD IA KI++A 
Sbjct: 236 ------LFPEPRALL-SMTRKVKSLRDPSSKMSKSDPHAMATVRITDSPDDIALKIRRAV 288

Query: 248 TDGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
           TD     SEV+   E R    NL+ I A + +I +EEA+ Q  G +   +K  +++AVI+
Sbjct: 289 TD---FTSEVTFDPETRPGVSNLVIIHAAVARISVEEAVSQAKGLDTGAYKQLVSEAVIQ 345

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + PI ++I  L KD  +L+ +L  G+ RAR  A   ++ V + VGL
Sbjct: 346 RLTPIREEIHRLRKDPGHLEGVLALGSGRARELAAPVLREVRQRVGL 392


>gi|229473319|gb|ACQ73211.1| tryptophanyl-tRNA synthetase 1 [Streptomyces griseus subsp.
           griseus]
          Length = 352

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 139/346 (40%), Positives = 196/346 (56%), Gaps = 23/346 (6%)

Query: 9   VSGVQPT-GVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SG+QPT G  HLGNYLG +R  +  QE+  H   Y + DLHAIT       LR  +RL 
Sbjct: 24  LSGIQPTAGSFHLGNYLGAVRQWVALQES--HDAFYMVVDLHAITVPQDPAELRANTRLA 81

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
           VA  LAAG+DP R  +F QS V  HA L W+++C+   G  + M QFK+KS +   + A+
Sbjct: 82  VAQLLAAGLDPDRCTLFVQSHVPEHAQLGWVMNCLTGFGEASRMTQFKDKSAKQGADRAT 141

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GLF YPVL  ADILLY+A  VPVGEDQRQH+E+TR +A+RFN            +Y Q 
Sbjct: 142 VGLFTYPVLQVADILLYQANQVPVGEDQRQHIELTRDLAERFNG-----------RYGQT 190

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F +    I    ++I  L+D + KMSKS S+    INLLD+P   AKK++ A 
Sbjct: 191 -------FTVPAPYILKETAKIFDLQDPAVKMSKSASTPKGLINLLDDPKATAKKVKSAV 243

Query: 248 TDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
           TD D +       E +    NL+ I +T+    +E+  +++ GK +   K  +A+A++E 
Sbjct: 244 TDTDTVIR--FDAEKKPGVSNLLTILSTLSGSPVEDLERRYEGKGYGALKTDVAEAMVEF 301

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + P   + Q  L D   LD+IL +GA +AR  A ET+    + +G 
Sbjct: 302 VTPFRSRTQEYLDDPETLDSILAKGAEKARAVAAETLAQTYDRMGF 347


>gi|7710154|ref|NP_056651.1| tryptophanyl-tRNA synthetase, mitochondrial isoform 1 precursor
           [Homo sapiens]
 gi|55587830|ref|XP_513688.1| PREDICTED: mitochondrial tryptophanyl tRNA synthetase 2 isoform 4
           [Pan troglodytes]
 gi|332809866|ref|XP_001143402.2| PREDICTED: tryptophanyl-tRNA synthetase, mitochondrial isoform 3
           [Pan troglodytes]
 gi|21362967|sp|Q9UGM6|SYWM_HUMAN RecName: Full=Tryptophanyl-tRNA synthetase, mitochondrial; AltName:
           Full=(Mt)TrpRS; AltName: Full=Tryptophan--tRNA ligase;
           Short=TrpRS; Flags: Precursor
 gi|6572289|emb|CAB63107.1| mitochondrial tryptophanyl-tRNA synthetase [Homo sapiens]
 gi|55665627|emb|CAH71367.1| tryptophanyl tRNA synthetase 2, mitochondrial [Homo sapiens]
 gi|56204630|emb|CAI22501.1| tryptophanyl tRNA synthetase 2, mitochondrial [Homo sapiens]
 gi|56205847|emb|CAI21995.1| tryptophanyl tRNA synthetase 2, mitochondrial [Homo sapiens]
 gi|119577097|gb|EAW56693.1| tryptophanyl tRNA synthetase 2 (mitochondrial), isoform CRA_a [Homo
           sapiens]
 gi|189053974|dbj|BAG36481.1| unnamed protein product [Homo sapiens]
          Length = 360

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 137/345 (39%), Positives = 212/345 (61%), Gaps = 25/345 (7%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QPTG+LHLGNYLG I + +R Q+  + + +Y I DLH+IT       LR       A
Sbjct: 39  SGIQPTGILHLGNYLGAIESWVRLQDEYDSV-LYSIVDLHSITVPQDPAVLRQSILDMTA 97

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
             LA G++P ++I+F+QS V  H  LSWILSC+ R+  + ++ Q+K K+ + K +  ++G
Sbjct: 98  VLLACGINPEKSILFQQSQVSEHTQLSWILSCMVRLPRLQHLHQWKAKTTKQKHD-GTVG 156

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L  YPVL AADILLY++THVPVGEDQ QH+E+ + +AQ FN           +KY +   
Sbjct: 157 LLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQGFN-----------KKYGE--- 202

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
               FFP+ E ++ +S  +++SLRD S KMSKSD    + + + D+P+ I +K +KA TD
Sbjct: 203 ----FFPVPESIL-TSMKKVKSLRDPSAKMSKSDPDKLATVRITDSPEEIVQKFRKAVTD 257

Query: 250 GDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
                SEV+     R    N++ + A +  + +EE +++  G N +++KLA+ADAVIE+ 
Sbjct: 258 ---FTSEVTYDPAGRAGVSNIVAVHAAVTGLSVEEVVRRSAGMNTARYKLAVADAVIEKF 314

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            PI ++I+ L  DK +L+ +L  G+ +A+  A    + V ++VG 
Sbjct: 315 APIKREIEKLKLDKDHLEKVLQIGSAKAKELAYTVCQEVKKLVGF 359


>gi|188589962|ref|YP_001922295.1| tryptophanyl-tRNA synthetase [Clostridium botulinum E3 str. Alaska
           E43]
 gi|188500243|gb|ACD53379.1| tryptophanyl-tRNA synthetase [Clostridium botulinum E3 str. Alaska
           E43]
          Length = 336

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 138/352 (39%), Positives = 211/352 (59%), Gaps = 24/352 (6%)

Query: 2   LSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLR 61
           + S  +  SG+QP+G L LGNYLG ++N ++ Q+       Y + DLHAIT      +LR
Sbjct: 6   VESKKVIFSGIQPSGDLTLGNYLGALKNWVKLQDEFET--YYCVVDLHAITVRQKPADLR 63

Query: 62  YQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKEN 121
            ++   ++ +LAAG+DP++N +F QS V  H + +WIL+C   MG ++ M Q+K+KS++ 
Sbjct: 64  RRTLELLSIYLAAGIDPNKNTLFIQSHVPAHTEAAWILTCNTYMGELSRMTQYKDKSQKY 123

Query: 122 KEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVA 181
            +  AS GLF YPVLMAADILLY    VPVG DQ+QHLE+TR IA RFNT +        
Sbjct: 124 GDSIAS-GLFNYPVLMAADILLYNTDLVPVGADQKQHLELTRDIAARFNTTYSDT----- 177

Query: 182 QKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAK 241
                        F I +  I  + ++I SL+D  KKMSKSD +    I ++D PD+I +
Sbjct: 178 -------------FKIPDPYIPKAGAKIMSLQDPLKKMSKSDDNPNGFILIMDPPDVIKR 224

Query: 242 KIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALA 301
           KI K+ TD   +   V+  +++   KNL+ I  T++ ++    +  + GK +++ K  +A
Sbjct: 225 KISKSVTDSLGI---VNYTDDQPGVKNLLNILGTIKGVEPTSLVANYEGKGYAELKNDVA 281

Query: 302 DAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           DAVIEE++P+ +K++  LKDK  L+ I  EGA +A   A +T++ + + VG 
Sbjct: 282 DAVIEELIPVQEKVKEFLKDKKKLEEIYSEGAKKASYIANKTLRKMQKKVGF 333


>gi|62897955|dbj|BAD96917.1| mitochondrial tryptophanyl tRNA synthetase 2 isoform 1 precursor
           variant [Homo sapiens]
          Length = 360

 Score =  250 bits (638), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 137/345 (39%), Positives = 212/345 (61%), Gaps = 25/345 (7%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QPTG+LHLGNYLG I + +R Q+  + + +Y I DLH+IT       LR       A
Sbjct: 39  SGIQPTGILHLGNYLGAIESWVRLQDEYDSV-LYSIVDLHSITVPQDPAVLRQSILDMTA 97

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
             LA G++P ++I+F+QS V  H  LSWILSC+ R+  + ++ Q+K K+ + K +  ++G
Sbjct: 98  VLLACGINPEKSILFQQSQVSEHTQLSWILSCMVRLPRLQHLHQWKAKTTKQKRD-GTVG 156

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L  YPVL AADILLY++THVPVGEDQ QH+E+ + +AQ FN           +KY +   
Sbjct: 157 LLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQGFN-----------KKYGE--- 202

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
               FFP+ E ++ +S  +++SLRD S KMSKSD    + + + D+P+ I +K +KA TD
Sbjct: 203 ----FFPVPESIL-TSMKKVKSLRDPSAKMSKSDPDKLATVRITDSPEEIVQKFRKAVTD 257

Query: 250 GDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
                SEV+     R    N++ + A +  + +EE +++  G N +++KLA+ADAVIE+ 
Sbjct: 258 ---FTSEVTYDPAGRAGVSNIVAVHAAVTGLSVEEVVRRSAGMNTARYKLAVADAVIEKF 314

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            PI ++I+ L  DK +L+ +L  G+ +A+  A    + V ++VG 
Sbjct: 315 APIKREIEKLKLDKDHLEKVLQIGSAKAKELAYTVCQEVKKLVGF 359


>gi|295396426|ref|ZP_06806588.1| tryptophan--tRNA ligase [Brevibacterium mcbrellneri ATCC 49030]
 gi|294970728|gb|EFG46641.1| tryptophan--tRNA ligase [Brevibacterium mcbrellneri ATCC 49030]
          Length = 337

 Score =  250 bits (638), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 141/346 (40%), Positives = 200/346 (57%), Gaps = 25/346 (7%)

Query: 9   VSGVQPT-GVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SGVQ T G LHLGNY+G ++  + +QET  H   +FIA++HAIT     E LR ++   
Sbjct: 15  LSGVQATSGSLHLGNYIGALQQFVAQQET--HDAFFFIANMHAITVEQNPEELRERTLRT 72

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A F+AAG+DP ++ IF QS V  H  LSWIL C   +G    M QFK+KS +N  E  S
Sbjct: 73  AAQFIAAGLDPEKSTIFVQSHVDAHTKLSWILECTTSLGEAQRMTQFKDKSAKN--EHVS 130

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           LGL  YP LMAADILLY+A  VPVGEDQRQHLE+TR +A+RFN  +              
Sbjct: 131 LGLLTYPALMAADILLYQADVVPVGEDQRQHLELTRNLAERFNNRYGET----------- 179

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F + E  I    ++I  L+D S KMSKS  +   RI++LD P ++ KK + A 
Sbjct: 180 -------FKVPEAGILKQTAKIYDLQDPSAKMSKSGKNPAGRIDILDEPKVLQKKFKSAV 232

Query: 248 TDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
           TD D + +     +N+    NL+ I++++    I+  + +F GK +   K+ALAD  +E 
Sbjct: 233 TDNDTVIA--YDPDNKPGVSNLLTIYSSLSGQSIDSIVAEFDGKMYGHLKVALADLAVEA 290

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + P+  +   LL+D++ L  IL+ GA++A   A  T+K   + VG 
Sbjct: 291 LTPVRTRTNELLEDRAELQRILLNGAHKATQIADVTVKNAYDRVGF 336


>gi|254387233|ref|ZP_05002497.1| tryptophanyl-tRNA synthetase 1 [Streptomyces sp. Mg1]
 gi|194346042|gb|EDX27008.1| tryptophanyl-tRNA synthetase 1 [Streptomyces sp. Mg1]
          Length = 337

 Score =  250 bits (638), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 142/355 (40%), Positives = 198/355 (55%), Gaps = 25/355 (7%)

Query: 1   MLSSDNLFVSGVQPT-GVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQEN 59
           M S     +SG+QPT G  HLGNYLG IR  +  QET  H   Y + DLHAIT     ++
Sbjct: 1   MASDRPRALSGIQPTSGSFHLGNYLGAIRQYVALQET--HDAFYMVVDLHAITMPQDPKD 58

Query: 60  LRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSK 119
           LR  +RL  A  LAAG+DP R  +F QS V  HA L W+++C+   G  + M QFK+KS 
Sbjct: 59  LRANTRLSAAQLLAAGLDPERCTLFIQSHVPEHAQLGWVMNCITGFGEASRMTQFKDKSA 118

Query: 120 ENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKE 179
           ++    A++GLF YP+L  ADILLY+A  VPVGEDQRQH+E+TR +A+RFNT F +    
Sbjct: 119 KSGANNATVGLFTYPILQVADILLYQANAVPVGEDQRQHIELTRDLAERFNTRFGKT--- 175

Query: 180 VAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDII 239
                          F +    I    ++I  L+D + KMSKS SS    INLLD P + 
Sbjct: 176 ---------------FTLPAAHIVKEVAKIYDLQDPAIKMSKSASSPKGLINLLDEPKVT 220

Query: 240 AKKIQKAKTDGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKL 298
            KKI+ A TD +   +E+    E +    NL+ I++T+    I    +++ GK +   K 
Sbjct: 221 EKKIKSAVTDTE---AEIRFDTEKKPGVSNLLTIYSTLTGETIAALEERYEGKGYGALKT 277

Query: 299 ALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            LA  +++ + P  Q+ Q  L D   LD+IL +GA +AR  A ET+    + +G 
Sbjct: 278 DLAGVMVDFVTPFRQRTQAYLDDPETLDSILAKGAEKARAVAAETLAQAYDRLGF 332


>gi|111023204|ref|YP_706176.1| tryptophanyl-tRNA synthetase [Rhodococcus jostii RHA1]
 gi|110822734|gb|ABG98018.1| tryptophan--tRNA ligase [Rhodococcus jostii RHA1]
          Length = 344

 Score =  250 bits (638), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 141/350 (40%), Positives = 196/350 (56%), Gaps = 31/350 (8%)

Query: 9   VSGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SG+QPT    HLGN+LG ++  +  Q+  +    YFI DLHAIT     + LR ++++ 
Sbjct: 16  LSGIQPTADSFHLGNFLGALQQWVPLQDDFD--AFYFIPDLHAITVAQDPKELRRRTKIA 73

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A  LA G+DP R  +F QS V  HA L+W+L+C+   G  + M QFK+KS +   E AS
Sbjct: 74  AAQLLALGIDPDRATLFVQSQVPEHAQLAWVLNCITGFGEASRMTQFKDKSAKQGSENAS 133

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GLF YPVLMAADILLYR   VPVGEDQRQHLE++R +AQRFNT F +            
Sbjct: 134 VGLFTYPVLMAADILLYRPQRVPVGEDQRQHLELSRDLAQRFNTRFGKA----------- 182

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F I E  I    ++I  L+D + KMSKS  S    INLLD+P + AKKI+ A 
Sbjct: 183 -------FVIPEAQIIKGTAKIYDLQDPTSKMSKSGPSPAGLINLLDDPKVSAKKIKSAV 235

Query: 248 TDGD----VLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           TD +      P    G+       NL+ I + +    +E  +  + GK +   K   AD 
Sbjct: 236 TDNEREIRYDPQAKPGVS------NLLTIQSALSGTPVETLVAGYEGKGYGDLKTDTADV 289

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + E + P+  K++  L D++ LD I+  GA+RAR  + +T+  V E VG 
Sbjct: 290 LAEFVTPLKAKVEGYLSDEAELDRIIAAGAHRAREVSSQTLAAVYEKVGF 339


>gi|322513721|ref|ZP_08066812.1| tryptophan--tRNA ligase [Actinobacillus ureae ATCC 25976]
 gi|322120464|gb|EFX92379.1| tryptophan--tRNA ligase [Actinobacillus ureae ATCC 25976]
          Length = 342

 Score =  250 bits (638), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 142/344 (41%), Positives = 205/344 (59%), Gaps = 11/344 (3%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQP+G L +GNYLG +RN ++ Q+  + L  + I DLHAIT       LR  S   +A
Sbjct: 8   SGVQPSGELTIGNYLGALRNWVKMQDDYDCL--FCIVDLHAITVRQDPVALRKASLDVLA 65

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LA G+DP+++ IF QS V  H  L+W+L+C    G M+ M QFK+KS    EE  ++G
Sbjct: 66  LYLACGIDPNKSTIFIQSHVPEHTQLAWVLNCYTYFGEMSRMTQFKDKSAR-YEENVNVG 124

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YPVLMAADILLY+A  VPVG+DQ+QHLEITR IA RFN  + +K          E  
Sbjct: 125 LFTYPVLMAADILLYQANQVPVGDDQKQHLEITRDIANRFNALYGKK--------DAEGN 176

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
             +  F + E  I  + +R+ SL + +KKMSKSD +  + I LL++P  +AKKI++A TD
Sbjct: 177 VIEPVFQVPEVFIVKAGARVMSLLEPTKKMSKSDDNRNNVIGLLEDPKAVAKKIKRAMTD 236

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
           GD  P      EN+    NL++I + +    I E   +  GK +   K  +A  V   + 
Sbjct: 237 GDEPPVVRYDRENKAGVSNLLDILSAVSGKTIAELEVELEGKMYGHLKTEVAKQVSALLT 296

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + ++  H  +D++ L+ I  EGA +AR RA++T++ V ++VG 
Sbjct: 297 DLQERYNHFRQDEALLEKIFREGAEKARARARKTLEEVYKLVGF 340


>gi|251777729|ref|ZP_04820649.1| tryptophan--tRNA ligase [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
 gi|243082044|gb|EES47934.1| tryptophan--tRNA ligase [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
          Length = 336

 Score =  249 bits (637), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 139/353 (39%), Positives = 212/353 (60%), Gaps = 24/353 (6%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENL 60
           ++ S  +  SG+QP+G L LGNYLG ++N ++ Q+       Y + DLHAIT      +L
Sbjct: 5   IVESKKVIFSGIQPSGDLTLGNYLGALKNWVKLQDEFET--YYCVVDLHAITVRQKPADL 62

Query: 61  RYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKE 120
           R ++   ++ +LAAG+DP++N +F QS V  H + +WIL+C   MG ++ M Q+K+KS++
Sbjct: 63  RRRTLELLSIYLAAGIDPNKNTLFIQSHVPAHTEAAWILTCNTYMGELSRMTQYKDKSQK 122

Query: 121 NKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEV 180
             +  AS GLF YPVLMAADILLY    VPVG DQ+QHLE+TR IA RFNT +       
Sbjct: 123 YGDSIAS-GLFNYPVLMAADILLYNTDLVPVGADQKQHLELTRDIAARFNTTYSDT---- 177

Query: 181 AQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIA 240
                         F I +  I  + ++I SL+D  KKMSKSD +    I ++D PD+I 
Sbjct: 178 --------------FKIPDPYIPKAGAKIMSLQDPLKKMSKSDDNPNGFILIMDPPDVIK 223

Query: 241 KKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLAL 300
           +KI K+ TD   +   V+  +++   KNL+ I  T++ ++    +  + GK +++ K  +
Sbjct: 224 RKISKSVTDSLGI---VNYTDDQPGVKNLLNILGTIKGVEPISLVANYEGKGYAELKNDV 280

Query: 301 ADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           ADAVIEE+VP+ +K++  LKDK  L+ I  EGA +A   A +T++ + + VG 
Sbjct: 281 ADAVIEELVPVQEKVKEFLKDKKKLEEIYSEGAKKASYIANKTLRKMQKKVGF 333


>gi|308176501|ref|YP_003915907.1| tryptophan--tRNA ligase [Arthrobacter arilaitensis Re117]
 gi|307743964|emb|CBT74936.1| tryptophan--tRNA ligase [Arthrobacter arilaitensis Re117]
          Length = 338

 Score =  249 bits (637), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 137/347 (39%), Positives = 203/347 (58%), Gaps = 25/347 (7%)

Query: 9   VSGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SG+QP+G  LHLGNYLG + N ++ Q+  +H   +FI D+HAIT       LR ++R  
Sbjct: 9   LSGMQPSGDSLHLGNYLGALVNWVKTQD--DHEAFFFIPDMHAITTPQDPAELRARTRKT 66

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A F+A G+D  ++ +F QS V  HA L+W+ +C+   G  + M QFK+KS +   + AS
Sbjct: 67  AAQFIAGGIDLDKSTLFVQSQVPEHAQLAWVFNCITGFGEASRMTQFKDKSSKGGADAAS 126

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GLF YPVLMAADILLY+   VPVG+DQRQH+E+ R +A+RFN  F +            
Sbjct: 127 VGLFTYPVLMAADILLYQPEGVPVGDDQRQHVELARDLAKRFNHRFGQT----------- 175

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F + E  I    +RI  L++ + KMSKS  S    IN+LD P +IAK+I+ A 
Sbjct: 176 -------FTVPEAFIPKEGARIYDLQNPTSKMSKSAESPAGLINVLDEPKLIAKRIKSAV 228

Query: 248 TD-GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
           TD G V+  + +    +    NL++I A +    + E + +F GK +   K+A+A+AV+E
Sbjct: 229 TDAGSVVAYDKA---EKPGVSNLLDILAAVTGKHVPELVNEFEGKMYGHLKVAVAEAVVE 285

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + PI  +   LL D + LD +L+ GA +AR  A +T+  V + VG 
Sbjct: 286 RLTPIRTRTLELLDDPAELDRLLLVGATKAREVASKTVADVYQKVGF 332


>gi|310659176|ref|YP_003936897.1| tryptophanyl-tRNA synthetase [Clostridium sticklandii DSM 519]
 gi|308825954|emb|CBH21992.1| tryptophanyl-tRNA synthetase [Clostridium sticklandii]
          Length = 339

 Score =  249 bits (637), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 140/344 (40%), Positives = 210/344 (61%), Gaps = 24/344 (6%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G L LGNYLG ++N +  Q+  N    Y + DLHAIT   V ++LR  +   +A
Sbjct: 13  SGMQPSGKLTLGNYLGAMKNWVALQDEYN--CYYCVVDLHAITVPQVPKDLRKTTLDVLA 70

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            ++A+G+DP +N +F QS V  HA+LSW+L+ +  MG +N M QFKEKS++ K E  + G
Sbjct: 71  QYIASGIDPEKNTLFIQSHVPEHAELSWVLNTMTYMGELNRMTQFKEKSQK-KAENLNAG 129

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YPVLMAADILLY    VPVGEDQ+QHLE+ R ++QRFN+                 +
Sbjct: 130 LFTYPVLMAADILLYSTDLVPVGEDQKQHLELARDLSQRFNS-----------------R 172

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
           YS  F  + EG I    +RI SL++ S+KMSKSD +  + I +LD+ D I  KI++A TD
Sbjct: 173 YSDTFI-VPEGFIPKEGARIMSLQEPSQKMSKSDENPNATILMLDSADAITNKIKRAVTD 231

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
              +   V+  + +   KNLI I++T      E  + ++ GK +  FK   A+ ++E + 
Sbjct: 232 SIGI---VAYNDEQKGIKNLINIYSTFTGESTEAIVSKYEGKGYGDFKRETAEVIVEGLR 288

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           P+ +K ++L+++K YL+ I  +GA +A  +A++T+  V   VG 
Sbjct: 289 PVREKYEYLMENKDYLEEIYAKGAAKAHNKARKTLDKVYRKVGF 332


>gi|78778983|ref|YP_397095.1| tryptophanyl-tRNA synthetase [Prochlorococcus marinus str. MIT
           9312]
 gi|78712482|gb|ABB49659.1| tryptophanyl-tRNA synthetase [Prochlorococcus marinus str. MIT
           9312]
          Length = 338

 Score =  249 bits (637), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 145/351 (41%), Positives = 204/351 (58%), Gaps = 29/351 (8%)

Query: 8   FVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
            +SGVQPTG LH+GN+LG I N +  QE   +     + DLHAIT     + L   +   
Sbjct: 7   ILSGVQPTGDLHIGNWLGAINNWVTLQE--EYETFLCVVDLHAITAAYNPKELSKNTIST 64

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A ++A G+DP    IF QS +  H++L WIL+C+  + WM  MIQFKEKS + +    S
Sbjct: 65  AALYVACGIDPKICSIFVQSQISAHSELCWILNCMTPINWMERMIQFKEKSIQ-QGNNVS 123

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIA-QRFNTEFERKIKEVAQKYAQ 186
           +GLF YP+LMAADILLY A +VPVGEDQ+QHLE+ R IA QR N +F +           
Sbjct: 124 IGLFDYPILMAADILLYDADYVPVGEDQKQHLELARDIAQQRINAKFSK----------- 172

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                K    I + +I  + S+I SL D SKKMSKSD ++ SRINLLD P+II KKI++A
Sbjct: 173 ----DKNILKIPQPIIMKNGSKIMSLVDGSKKMSKSDPNEGSRINLLDPPEIITKKIKRA 228

Query: 247 KTDGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALAD 302
           K+D  +      G+E     R E+KNL+ I++ +   +I +   +F    +  FK  + +
Sbjct: 229 KSDSSI------GIEFNNPERPESKNLLMIYSILSGKEISQCENEFSETGWGTFKKLITE 282

Query: 303 AVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            +IE + PI +K + L+ D   L+ IL EG  +A   A +T+K V   +G 
Sbjct: 283 KLIESLEPIQKKYKLLINDPYQLNNILDEGKEKAEDLANQTLKRVKSKLGF 333


>gi|116669683|ref|YP_830616.1| tryptophanyl-tRNA synthetase [Arthrobacter sp. FB24]
 gi|116609792|gb|ABK02516.1| tryptophanyl-tRNA synthetase [Arthrobacter sp. FB24]
          Length = 347

 Score =  249 bits (636), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 137/352 (38%), Positives = 202/352 (57%), Gaps = 35/352 (9%)

Query: 9   VSGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SG +PT   LHLGNY+G +RN +  Q    +  ++FI DLHAIT +     L  ++R+ 
Sbjct: 14  LSGAKPTADSLHLGNYIGAVRNWVDMQ--AEYDAVFFIPDLHAITVDFEPAELAKRTRVV 71

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A ++AAG+DP ++I F QS V  HA L+W L+C+   G  + M QFK+K++++  ++A+
Sbjct: 72  AAQYIAAGIDPDKSIFFVQSHVPEHAQLAWALNCITGFGEASRMTQFKDKTQKSGADSAT 131

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           LGLF YP LMAADILLY+   VPVGEDQRQHLE+TR +AQRFNT F              
Sbjct: 132 LGLFAYPTLMAADILLYQTDLVPVGEDQRQHLELTRNLAQRFNTRFGHT----------- 180

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F + E  I  + ++I  L+  + KMSK+  S    I LL++P I AK+I+ A 
Sbjct: 181 -------FTVPEATILKATAKIYDLQSPTAKMSKTGGSPHGSIQLLEDPKIAAKRIKSAV 233

Query: 248 TDGDVLPSEVSGLENRLEAK------NLIEIFATMRQIKIEEALKQFGGKNFSQFKLALA 301
           TD        +G E R +A+      NL+ I++T+    + E   ++ GK +   K  LA
Sbjct: 234 TD--------TGTEIRFDAEAKPGVSNLLTIYSTLTGKSVPELEAEYQGKMYGHLKKDLA 285

Query: 302 DAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           D +++ I P+  +   L+ D + LD +L +GA RAR  A  T+  V E +G 
Sbjct: 286 DVMVDFITPLRDRTNELMADPAELDRLLAQGAERAREIASVTLGQVYERMGF 337


>gi|186685152|ref|YP_001868348.1| tryptophanyl-tRNA synthetase [Nostoc punctiforme PCC 73102]
 gi|186467604|gb|ACC83405.1| tryptophanyl-tRNA synthetase [Nostoc punctiforme PCC 73102]
          Length = 336

 Score =  249 bits (635), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 147/351 (41%), Positives = 209/351 (59%), Gaps = 29/351 (8%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQ-ETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SGVQPTG  HLGNYLG IRN +  Q E  N+L   F+ADLHAIT     + L   +   
Sbjct: 7   LSGVQPTGNYHLGNYLGAIRNWVEGQSEYENYL---FVADLHAITVPHDPKQLAADTYTL 63

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A +LA G+D + + IF QS V  H++L+W+L+C+  + W+ +MIQFKEK+ + + E  S
Sbjct: 64  AALYLACGLDLNHSTIFVQSHVSAHSELTWLLNCITPLNWLQDMIQFKEKAVK-QGENVS 122

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
            GL  YPVLMAADILLY+A  VPVGEDQ+QHLE+TR IA R N +F +  + V +     
Sbjct: 123 AGLLDYPVLMAADILLYQADKVPVGEDQKQHLELTRDIAARLNHQFGKPDQPVLK----- 177

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                    + + LI    +R+ SL D ++KMSKSD S+ SRI+LLD+P+ I  KI++ K
Sbjct: 178 ---------LPDPLIRKEGARVMSLADGTRKMSKSDPSELSRISLLDSPEQIQYKIKRCK 228

Query: 248 TDGDVLPSEVSGL----ENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           TD       + GL      R E  NL+ ++  +   + E+   +     + QFK  L D 
Sbjct: 229 TD------PIRGLTFDDPARPECNNLLTLYTLLSGKRKEDVAVECQDMGWGQFKPLLTDT 282

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
           +IE + PI +K Q +  DKSYL+++L +G  +AR  A +T+  V   +G S
Sbjct: 283 IIESLKPIQEKYQAVTADKSYLESVLRDGGEKARAIANQTLSQVKAALGYS 333


>gi|332237814|ref|XP_003268103.1| PREDICTED: tryptophanyl-tRNA synthetase, mitochondrial isoform 1
           [Nomascus leucogenys]
          Length = 360

 Score =  249 bits (635), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 135/345 (39%), Positives = 211/345 (61%), Gaps = 25/345 (7%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QPTG+LHLGNYLG I + +R Q+  + + +Y I DLH+IT       LR       A
Sbjct: 39  SGIQPTGILHLGNYLGAIESWVRLQDEYDSV-LYSIVDLHSITVPQDPAVLRQSILDMTA 97

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
             LA G++P ++I+F+QS V  H  LSWILSC+ R+  + ++ Q+K K+ + K +  ++G
Sbjct: 98  VLLACGINPEKSILFQQSQVSEHTQLSWILSCMVRLPRLQHLHQWKAKTAKQKHD-GTVG 156

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L  YPVL AADILLY++THVP+GEDQ QH+E+ + +AQ FN           +KY +   
Sbjct: 157 LLTYPVLQAADILLYKSTHVPIGEDQVQHMELVQDLAQGFN-----------KKYGE--- 202

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
               FFP+ E ++ +S  +++SLRD S KMSKSD    + + + D+P+ I +K +KA TD
Sbjct: 203 ----FFPVPESIL-TSMKKVKSLRDPSAKMSKSDPDKLATVRITDSPEEIVQKFRKAVTD 257

Query: 250 GDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
                SEV+     R    N++ + A +  + +EE +++  G + + +KLA+ADAVIE+ 
Sbjct: 258 ---FTSEVTYDPAGRAGVSNIVAVHAAVTGLSVEEVVRRSAGMDTAHYKLAVADAVIEKF 314

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            PI ++I+ L  DK +L+ +L  G+ +A+  A    + V ++VG 
Sbjct: 315 APIKREIEKLKLDKDHLEKVLQTGSAKAKELAYTVCQEVKKLVGF 359


>gi|303252726|ref|ZP_07338887.1| tryptophanyl-tRNA synthetase [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|307248965|ref|ZP_07530975.1| Tryptophanyl-tRNA synthetase [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|302648376|gb|EFL78571.1| tryptophanyl-tRNA synthetase [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|306854576|gb|EFM86769.1| Tryptophanyl-tRNA synthetase [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
          Length = 342

 Score =  249 bits (635), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 141/344 (40%), Positives = 203/344 (59%), Gaps = 11/344 (3%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQP+G L +GNYLG +RN ++ Q+  + L  + I DLHAIT       LR  S   +A
Sbjct: 8   SGVQPSGELTIGNYLGALRNWVKMQDDYDCL--FCIVDLHAITVRQDPAALRKASLDVLA 65

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LA G+DP+++ IF QS V  H  L+W+L+C    G M+ M QFK+KS    EE  ++G
Sbjct: 66  LYLACGIDPNKSTIFIQSHVPEHTQLAWVLNCYTYFGEMSRMTQFKDKSAR-YEENVNVG 124

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YPVLMAADILLY+A  VPVG+DQ+QHLEITR IA RFN  + +K          E  
Sbjct: 125 LFTYPVLMAADILLYQANQVPVGDDQKQHLEITRDIANRFNALYGKK--------DAEGN 176

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
             +  F + E  I  + +R+ SL + +KKMSKSD +  + I LL++P  + KKI++A TD
Sbjct: 177 VLEPVFQVPEVFIGKAGARVMSLLEPTKKMSKSDENRNNVIGLLEDPKAVTKKIKRAMTD 236

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
           GD  P      EN+    NL++I + +    I E   +F GK +   K  +A+ V   + 
Sbjct: 237 GDEPPVVRYDRENKAGVSNLLDILSAVSGKTIAELEAEFEGKMYGHLKTEVAEQVSTLLT 296

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            +  +     +D++ L+ I  EGA +AR RA++T+  V ++VG 
Sbjct: 297 DLQARYNQFRQDEALLERIFREGAEKARVRARKTLDEVYKLVGF 340


>gi|326334110|ref|ZP_08200337.1| tryptophan--tRNA ligase [Nocardioidaceae bacterium Broad-1]
 gi|325948086|gb|EGD40199.1| tryptophan--tRNA ligase [Nocardioidaceae bacterium Broad-1]
          Length = 345

 Score =  248 bits (634), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 149/352 (42%), Positives = 205/352 (58%), Gaps = 35/352 (9%)

Query: 9   VSGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SG+QPT    HLGNYLG +R  +  QE   H   +FIADLHAIT     + LR ++R  
Sbjct: 14  LSGIQPTADSYHLGNYLGAVRQWVSLQE--EHEPFFFIADLHAITVEQDPKVLRERTRRA 71

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A  LAAGVDP R+ IF QS +  HA L W++ C+   G    M QFK+KS +  E  AS
Sbjct: 72  AAQLLAAGVDPERSAIFVQSHLPEHAQLGWVMQCITSFGEARRMTQFKDKSAKGGEGAAS 131

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GLF YP+LMAADILLYR  +VPVGEDQRQHLE+TR +AQRFN+ +++            
Sbjct: 132 VGLFSYPMLMAADILLYRPAYVPVGEDQRQHLELTRDLAQRFNSRYKKT----------- 180

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F + E  I    ++I  L+D S KMSKS SS    I++LD+P + AKKI+ A 
Sbjct: 181 -------FRLPEPYILKEVAKIYDLQDPSIKMSKSASSPSGLIDMLDDPKVSAKKIRSAV 233

Query: 248 TDGDVLPSEVSGLENRL--EAK----NLIEIFATMRQIKIEEALKQFGGKNFSQFKLALA 301
           TD        S +E R   EAK    NL+ I++ +    I+  + ++ GK +   K  LA
Sbjct: 234 TD--------SEMEIRFDEEAKPGVSNLLRIYSALTGSDIDTLVGKYAGKGYGDLKKDLA 285

Query: 302 DAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + V++ + P  +K   +L+D+ YLD IL +GA +A   A++T+  V E VG 
Sbjct: 286 EVVVDYVTPFREKTFEVLEDRDYLDGILAQGAEKAGAVARKTLADVYERVGF 337


>gi|187932977|ref|YP_001887357.1| tryptophanyl-tRNA synthetase [Clostridium botulinum B str. Eklund
           17B]
 gi|187721130|gb|ACD22351.1| tryptophan--tRNA ligase [Clostridium botulinum B str. Eklund 17B]
          Length = 336

 Score =  248 bits (634), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 137/353 (38%), Positives = 212/353 (60%), Gaps = 24/353 (6%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENL 60
           ++ S  +  SG+QP+G L LGNYLG ++N ++ Q+       Y + DLHAIT      +L
Sbjct: 5   IVESKKVIFSGIQPSGDLTLGNYLGALKNWVKLQDEFET--YYCVVDLHAITVRQKPADL 62

Query: 61  RYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKE 120
           R ++   ++ +LAAG+DP++N +F QS V  H + +WIL+C   MG ++ M Q+K+KS++
Sbjct: 63  RRRTLELLSIYLAAGIDPNKNTLFIQSHVPAHTEAAWILTCNTYMGELSRMTQYKDKSQK 122

Query: 121 NKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEV 180
             +  AS GLF YPVLMAADILLY    VPVG DQ+QHLE+TR IA RFN  +       
Sbjct: 123 YGDSIAS-GLFNYPVLMAADILLYNTDLVPVGADQKQHLELTRDIAARFNNTYSDT---- 177

Query: 181 AQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIA 240
                         F I +  I  + ++I SL+D  KKMSKSD +    I ++D PD+I 
Sbjct: 178 --------------FKIPDPYIPKAGAKIMSLQDPLKKMSKSDDNPNGFILIMDPPDVIK 223

Query: 241 KKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLAL 300
           +K+ K+ TD   +   V+  +++   KNL+ I +T++ ++    +  + GK +++ K  +
Sbjct: 224 RKVSKSVTDSLGI---VNYTDDQPGVKNLLNILSTIKGVEPTSLVANYEGKGYAELKNDV 280

Query: 301 ADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           ADAVIEE+VP+ +K++  LKDK  L+ I  EGA +A   A +T++ + + VG 
Sbjct: 281 ADAVIEELVPVQEKVKEFLKDKKKLEEIYSEGAKKASYIANKTLRKMQKKVGF 333


>gi|54022903|ref|YP_117145.1| tryptophanyl-tRNA synthetase [Nocardia farcinica IFM 10152]
 gi|54014411|dbj|BAD55781.1| putative tryptophanyl-tRNA synthetase [Nocardia farcinica IFM
           10152]
          Length = 343

 Score =  248 bits (634), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 143/352 (40%), Positives = 202/352 (57%), Gaps = 35/352 (9%)

Query: 9   VSGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SG+QPT    HLGNYLG ++  +  Q+  ++  +YFI D+HAIT     + LR ++R  
Sbjct: 17  LSGIQPTSNSFHLGNYLGALQYWVGMQD--DYDALYFIPDMHAITVAQEPKQLRARTRAA 74

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A  LA G+DP R+ +F QS V  HA+L+W+LSC+   G  + M QFK+KS  +  + A+
Sbjct: 75  AAQLLAIGIDPKRSTLFVQSQVPQHAELAWVLSCITGFGEASRMTQFKDKSARHGADNAT 134

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GLF YPVLMAADILLYR   VPVGEDQRQHLE+TR +AQRFNT F++            
Sbjct: 135 VGLFTYPVLMAADILLYRPHQVPVGEDQRQHLELTRNLAQRFNTRFKKT----------- 183

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F + E  I    ++I  L+D + KMSKS +SD   INLLD+P + AKKI+ A 
Sbjct: 184 -------FVVPEAHIVKGTAKIYDLQDPTSKMSKSAASDAGLINLLDDPKVSAKKIRSAV 236

Query: 248 TDGDVLPSEVSGLENRLEA------KNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALA 301
           TD        +G E R +        NL+ I   +    ++   + + GK +   K  +A
Sbjct: 237 TD--------TGREIRYDPDTKPGVSNLLVILGALTGTSLDTLERDYDGKGYGDLKSDVA 288

Query: 302 DAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           DA++E + P+  +++  L D+  LD IL  GA RAR  A  T+  V + VG 
Sbjct: 289 DALVEFVTPLQAQVREYLADQGELDRILAAGAERAREIAGNTLAQVYDRVGF 340


>gi|220909601|ref|YP_002484912.1| tryptophanyl-tRNA synthetase [Cyanothece sp. PCC 7425]
 gi|219866212|gb|ACL46551.1| tryptophanyl-tRNA synthetase [Cyanothece sp. PCC 7425]
          Length = 337

 Score =  248 bits (633), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 143/351 (40%), Positives = 203/351 (57%), Gaps = 29/351 (8%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYF-IADLHAITNNIVQENLRYQSRLF 67
           +SGVQPTG LHLGNYLG IRN +  Q   ++   YF + DLHAIT     + L   +   
Sbjct: 7   LSGVQPTGSLHLGNYLGAIRNWVAGQAQYDN---YFCVVDLHAITVPHDPKTLAENTYKV 63

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A +LA G+DP+++ IF QS +  HA+L+W+ +C+  + W+ +MIQFKEK+   + E  +
Sbjct: 64  AALYLACGIDPAQSTIFIQSHIPAHAELTWLFNCITPLNWLESMIQFKEKAIR-QGENVN 122

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
            GL  YPVLMAADILLY+A  VPVGEDQ+QHLE+TR IA R N  F             E
Sbjct: 123 TGLLDYPVLMAADILLYQADLVPVGEDQKQHLELTRDIALRVNYLF-----------GSE 171

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
           EQ       + + LI ++ +R+ SL D +KKMSKSD S+ SRINLLD P+ I KKI++ K
Sbjct: 172 EQ---PILKLPQPLIQAAGARVMSLTDGTKKMSKSDPSEMSRINLLDPPEEIQKKIKRCK 228

Query: 248 TDGDVLPSEVSGL----ENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           TD       V GL     +R E  NL+ ++  +     E   ++     + QFK  L +A
Sbjct: 229 TD------PVRGLTFDDPDRPECHNLLSLYMLLSGQSKEAVARECAEMGWGQFKPLLTEA 282

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
            I  + PI      ++ ++ YL ++L EG  +A   A +T+  V + +G +
Sbjct: 283 TIAALQPIQTTYAEVMAEEGYLASVLQEGRRKAAALANQTLNQVRQAMGFA 333


>gi|332289738|ref|YP_004420590.1| tryptophanyl-tRNA synthetase [Gallibacterium anatis UMN179]
 gi|330432634|gb|AEC17693.1| tryptophanyl-tRNA synthetase [Gallibacterium anatis UMN179]
          Length = 332

 Score =  248 bits (633), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 141/350 (40%), Positives = 202/350 (57%), Gaps = 21/350 (6%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  +  SGVQP+G L +GNYLG +R  ++ Q+  ++  ++ + DLHAIT       L   
Sbjct: 2   SKPIVFSGVQPSGELTIGNYLGALRQWVKMQD--DYECLFCVVDLHAITVRQDPVALHKA 59

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           +   +A +LA G+DP+++ IF QS V  H  L+W+L+C    G M  M QFK+KS    E
Sbjct: 60  TLDVLALYLACGIDPNKSTIFVQSHVPEHTQLAWVLNCYTYFGEMGRMTQFKDKSARY-E 118

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
              S+GLF YPVLMAADILLY+A  VPVG+DQ+QHLEITR IAQRFN  +          
Sbjct: 119 GNVSVGLFTYPVLMAADILLYQAKQVPVGDDQKQHLEITRDIAQRFNALY---------- 168

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
                      F I E  I  + +R+ SL D +KKMSKSD +  + I LL++P  +AKKI
Sbjct: 169 --------GDIFTIPEVFIPKAGARVMSLLDPNKKMSKSDDNRNNVIGLLEDPKAVAKKI 220

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           ++A TD +  P     +EN+    NL+ I + + +  I E   +F GK +   K A+AD 
Sbjct: 221 KRAVTDSEEPPRVKFDVENKPGVSNLLSILSAITEKSIPELEAEFEGKMYGHLKGAVADE 280

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           V   +  + ++  H   D++ L+ IL EGA +AR +A+ET+  V + VG 
Sbjct: 281 VSAMLTQLQERYYHFRNDEALLNKILHEGAEKARAKAKETLDKVYQAVGF 330


>gi|91070251|gb|ABE11170.1| tryptophanyl-tRNA synthetase [uncultured Prochlorococcus marinus
           clone HF10-11H7]
          Length = 338

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 146/351 (41%), Positives = 203/351 (57%), Gaps = 29/351 (8%)

Query: 8   FVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
            +SGVQPTG LH+GN+LG I N +  QE   +     + DLHAIT +   E L   +   
Sbjct: 7   ILSGVQPTGDLHIGNWLGAINNWVTLQE--QYETFLCVVDLHAITASYNPEELSKNTIST 64

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A ++A G+DP+   IF QS +  H++L WIL+C+  + WM  MIQFKEKS + +    S
Sbjct: 65  AALYVACGIDPNICSIFVQSQISAHSELCWILNCMTPINWMERMIQFKEKSIQ-QGNNVS 123

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIA-QRFNTEFERKIKEVAQKYAQ 186
           +GLF YP+LMAADILLY A  VPVGEDQ+QHLE+ R IA QR N  F +           
Sbjct: 124 IGLFDYPILMAADILLYDADFVPVGEDQKQHLELARDIAQQRINARFSK----------- 172

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                K    I + +I  + S+I SL D SKKMSKSD ++ SRINLLD P+II KKI++A
Sbjct: 173 ----DKNILKIPQPIIMKNGSKIMSLIDGSKKMSKSDPNEGSRINLLDPPEIITKKIKRA 228

Query: 247 KTDGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALAD 302
           K+D  +      G+E     R E+KNL+ I++ +   +I +   +F    +  FK  + +
Sbjct: 229 KSDSSI------GIEFNNPERPESKNLLMIYSILSGKEISQCENEFLETGWGTFKKLITE 282

Query: 303 AVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            +IE + PI +K   L+ D   L+ IL EG  +A   A +T+K V   +G 
Sbjct: 283 QLIESLEPIQKKYTLLINDPYQLNKILNEGKEKAEDLANQTLKRVKSKLGF 333


>gi|158334898|ref|YP_001516070.1| tryptophanyl-tRNA synthetase [Acaryochloris marina MBIC11017]
 gi|158305139|gb|ABW26756.1| tryptophanyl-tRNA synthetase [Acaryochloris marina MBIC11017]
          Length = 336

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 147/353 (41%), Positives = 201/353 (56%), Gaps = 33/353 (9%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQPTG LHLGNYLG IRN +  Q   N+   +FIADLHAIT     + L   +    
Sbjct: 7   LSGVQPTGTLHLGNYLGAIRNWVEGQS--NYENYFFIADLHAITVPHDPQQLADNTYSLA 64

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+DP    IF QS +  HA+L+W+ +C+  + W+  MIQFKEK+ + + E  S+
Sbjct: 65  ALYLACGLDPEHTTIFVQSHISAHAELAWLFNCITPLNWLERMIQFKEKALK-QGENVSI 123

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GL  YPVL AADILLY+A  VPVGEDQ+QHLE+TR IA R N +           Y  EE
Sbjct: 124 GLLDYPVLQAADILLYQADLVPVGEDQKQHLELTRDIAARLNFQ-----------YGTEE 172

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                   + E LI    +RI SL D + KMSKSD S+ SRI LLD PD I  KI++ KT
Sbjct: 173 ---NPILKVPEPLIRPEGARIMSLTDGTNKMSKSDPSEQSRITLLDTPDQIRNKIKRCKT 229

Query: 249 DGDVLPSEVSGL----ENRLEAKNLIEIFATMR---QIKIEEALKQFGGKNFSQFKLALA 301
           D       V GL     +R E +NL+ ++  M    +  + E   + G   + QFK  L 
Sbjct: 230 D------PVRGLSFDDPDRPECQNLLTLYQLMSGQAKTAVAEECAEMG---WGQFKPLLT 280

Query: 302 DAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
           + +IE + PI  +   L+ +K  L+ +L +G ++A   A +T+  V + +G S
Sbjct: 281 EVMIEGLRPIQDRYTALMTNKQDLEGVLQQGKDQASEIANKTLTKVKDALGYS 333


>gi|28278717|gb|AAH44575.1| Tryptophanyl tRNA synthetase 2, mitochondrial [Homo sapiens]
 gi|312152904|gb|ADQ32964.1| tryptophanyl tRNA synthetase 2, mitochondrial [synthetic construct]
          Length = 360

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 136/345 (39%), Positives = 211/345 (61%), Gaps = 25/345 (7%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QPTG+LHL NYLG I + +R Q+  + + +Y I DLH+IT       LR       A
Sbjct: 39  SGIQPTGILHLSNYLGAIESWVRLQDEYDSV-LYSIVDLHSITVPQDPAVLRQSILDMTA 97

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
             LA G++P ++I+F+QS V  H  LSWILSC+ R+  + ++ Q+K K+ + K +  ++G
Sbjct: 98  VLLACGINPEKSILFQQSQVSEHTQLSWILSCMVRLPRLQHLHQWKAKTTKQKHD-GTVG 156

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L  YPVL AADILLY++THVPVGEDQ QH+E+ + +AQ FN           +KY +   
Sbjct: 157 LLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQGFN-----------KKYGE--- 202

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
               FFP+ E ++ +S  +++SLRD S KMSKSD    + + + D+P+ I +K +KA TD
Sbjct: 203 ----FFPVPESIL-TSMKKVKSLRDPSAKMSKSDPDKLATVRITDSPEEIVQKFRKAVTD 257

Query: 250 GDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
                SEV+     R    N++ + A +  + +EE +++  G N +++KLA+ADAVIE+ 
Sbjct: 258 ---FTSEVTYDPAGRAGVSNIVAVHAAVTGLSVEEVVRRSAGMNTARYKLAVADAVIEKF 314

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            PI ++I+ L  DK +L+ +L  G+ +A+  A    + V ++VG 
Sbjct: 315 APIKREIEKLKLDKDHLEKVLQIGSAKAKELAYTVCQEVKKLVGF 359


>gi|210615900|ref|ZP_03290841.1| hypothetical protein CLONEX_03060 [Clostridium nexile DSM 1787]
 gi|210150041|gb|EEA81050.1| hypothetical protein CLONEX_03060 [Clostridium nexile DSM 1787]
          Length = 334

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 137/353 (38%), Positives = 208/353 (58%), Gaps = 24/353 (6%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENL 60
           M++   +  SG+Q TG L LGNYLG ++N I   +   +   Y + D+H+IT       L
Sbjct: 1   MINDKKVLFSGMQATGNLTLGNYLGALKNWITLSD--EYECFYSVVDMHSITVRQDPATL 58

Query: 61  RYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKE 120
           R ++R  +  ++AAG+DP +N I+ QS V  HA+L+WIL+C   MG +N M QFK+KS +
Sbjct: 59  RKRARALLTLYIAAGLDPEKNCIYYQSHVSGHAELAWILNCYTYMGELNRMTQFKDKSAK 118

Query: 121 NKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEV 180
           + +   + GLF YPVLMAADILL+++  VPVG DQ QHLE+TR IAQRFN  +       
Sbjct: 119 HADNINA-GLFTYPVLMAADILLFQSDVVPVGIDQMQHLELTRDIAQRFNGVY------- 170

Query: 181 AQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIA 240
                         F I E  I    ++I SL+D +KKMSKSD +    I L+D+PD I 
Sbjct: 171 -----------GDVFTIPEAYIGKVGAKIMSLQDPAKKMSKSDENVNGSIYLMDDPDTIM 219

Query: 241 KKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLAL 300
           +K ++A TD +   +++   E +   KNLI+I++    +  ++ +K+F GK +  FK A+
Sbjct: 220 RKCKRAVTDSE---AQILYREEQPGVKNLIDIYSACMNVTPQDVVKEFDGKGYGDFKTAV 276

Query: 301 ADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            +AVI  + P+  ++  L KDK+Y+D+I+   A +A   A +T++ V   VG 
Sbjct: 277 GEAVISVLKPLQDEVARLEKDKAYIDSIIKNNAEKANYYATKTLRKVQRKVGF 329


>gi|297158130|gb|ADI07842.1| tryptophanyl-tRNA synthetase [Streptomyces bingchenggensis BCW-1]
          Length = 337

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 139/347 (40%), Positives = 194/347 (55%), Gaps = 25/347 (7%)

Query: 9   VSGVQPT-GVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SG+QPT G  HLGNYLG IR  +  QET  H   Y + DLHAIT       LR  +RL 
Sbjct: 9   LSGIQPTAGSFHLGNYLGAIRQYVALQET--HDAFYMVVDLHAITVPQDPAALRANTRLA 66

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A  LA+G+DP R  +F QS V  HA L+W+++C+   G  + M QFK+K+ +   + A+
Sbjct: 67  AAQLLASGLDPDRCTLFIQSHVPEHAQLAWVMNCLTGFGEASRMTQFKDKTAKQGADRAT 126

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GLF YP+L  ADILLY+A HVPVGEDQRQH+E+TR IA+RFN  F              
Sbjct: 127 VGLFTYPILQVADILLYQANHVPVGEDQRQHVELTRDIAERFNGRFGDT----------- 175

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F I    I     +I  L+D + KMSKS S+    I+LLD P + AKKI+ A 
Sbjct: 176 -------FTIPAPHIVKETGKIYDLQDPAIKMSKSASTPKGIISLLDEPKVSAKKIKSAV 228

Query: 248 TDGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
           TD +   +E+    E +    NL+ I++T+    I +  +++ GK +   K  LA+ ++E
Sbjct: 229 TDTE---TEIRYDEEKKPGVSNLLTIYSTLTGTTIADLERKYEGKGYGALKTELAEVLVE 285

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + P  ++ Q  L D   LD IL  GA +AR  A +T+    + VG 
Sbjct: 286 WVTPFRERTQEYLADPETLDGILARGAEKARAVASDTLARAYDKVGF 332


>gi|225016586|ref|ZP_03705778.1| hypothetical protein CLOSTMETH_00493 [Clostridium methylpentosum
           DSM 5476]
 gi|224950695|gb|EEG31904.1| hypothetical protein CLOSTMETH_00493 [Clostridium methylpentosum
           DSM 5476]
          Length = 338

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 142/347 (40%), Positives = 199/347 (57%), Gaps = 24/347 (6%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           + +SG+QPTGV  LGNY+G IRN    QE   +L  YFIADLHAIT       LR Q+  
Sbjct: 13  VILSGIQPTGVFTLGNYIGAIRNWKALQE--EYLCEYFIADLHAITVRQDPAKLRRQTLE 70

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A  LA G+DP +++ F QS V  HA+L+W+L C  + G ++ M QFK+KS ++  +  
Sbjct: 71  AYALLLACGIDPEKSLAFIQSHVHTHAELAWVLECYTQFGELSRMTQFKDKSAKHA-DNV 129

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           + GLF YP LMAADILLY+   VPVG DQ+QHLEITR IA RFN  +             
Sbjct: 130 NAGLFSYPALMAADILLYKPDFVPVGADQKQHLEITRDIAIRFNNLY------------- 176

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F I +  I  + +R+ SL D +KKMSKSD +    I++LD P+ I KK ++A
Sbjct: 177 -----GNVFRIPDAYIPKTGARVMSLADPTKKMSKSDENVNGFISILDKPETIVKKFKRA 231

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
            TD ++   EV+  E +    NL+ I++ +     EE  ++F GK +  FK A+ +AV E
Sbjct: 232 VTDSEM---EVAYREGKDGINNLMTIYSVITDKSFEEIEQEFSGKGYGDFKTAVGEAVAE 288

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + PI +    L++DK YL+     GA RA   +  T++ V + VG 
Sbjct: 289 HLRPIRENFDRLMQDKGYLEQCYKTGAERALQISSRTLEKVYKKVGF 335


>gi|182625755|ref|ZP_02953523.1| tryptophanyl-tRNA synthetase [Clostridium perfringens D str.
           JGS1721]
 gi|177909017|gb|EDT71499.1| tryptophanyl-tRNA synthetase [Clostridium perfringens D str.
           JGS1721]
          Length = 332

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 137/354 (38%), Positives = 211/354 (59%), Gaps = 26/354 (7%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYF-IADLHAITNNIVQEN 59
           M     +  SG++P+G L LGNYLG I+N  + QE  +    YF + DLHAIT   +  +
Sbjct: 1   MEDKKKIIFSGIKPSGDLTLGNYLGAIKNWTKLQEEYD---CYFCVVDLHAITVKQLPAD 57

Query: 60  LRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSK 119
           LR ++   +A ++A+G++P  N +F QS V  H++ SW+L+C + MG ++ M Q+K+KSK
Sbjct: 58  LRRRTLEVLAIYIASGINPEENTLFIQSHVPAHSEASWLLTCNSYMGELSRMTQYKDKSK 117

Query: 120 ENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKE 179
           +  +   + GLF YPVLMAADILLY A  VPVG+DQ QHLE+ R I  RFN  + +    
Sbjct: 118 KMGDSIGA-GLFNYPVLMAADILLYNADLVPVGKDQMQHLELARDIGTRFNNSYSKT--- 173

Query: 180 VAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDII 239
                          F I EG +    ++I  L+D SKKMSKSD++    I ++D P++I
Sbjct: 174 ---------------FTIPEGYVPKEGAKIMDLQDPSKKMSKSDANPNGFILIMDEPNVI 218

Query: 240 AKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLA 299
            KKI +A TD   +   V+  + +   KNLI I   ++    EE +K + GK +++FK  
Sbjct: 219 RKKISRAVTDSIGV---VNYTDEQPGVKNLINILCAIKGYTPEEVVKMYDGKGYAEFKND 275

Query: 300 LADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           +A+A++EE+ P+ +K++ LL DK  LD I  +GA +A   A +T++ + + +GL
Sbjct: 276 VAEAIVEELAPVQEKVKALLGDKKALDEIYKKGAEKANYAAMKTLRKMQKKIGL 329


>gi|91070151|gb|ABE11073.1| tryptophanyl-tRNA synthetase [uncultured Prochlorococcus marinus
           clone HF10-11A3]
          Length = 338

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 145/351 (41%), Positives = 204/351 (58%), Gaps = 29/351 (8%)

Query: 8   FVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
            +SGVQPTG LH+GN+LG I N +  QE   +     + DLHAIT +   + L   +   
Sbjct: 7   ILSGVQPTGDLHIGNWLGAINNWVTLQE--QYETFLCVVDLHAITASYNPKELSKNTIST 64

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A ++A G+DP+   IF QS +  H++L WIL+C+  + WM  MIQFKEKS + +    S
Sbjct: 65  AALYVACGIDPNICSIFVQSQISAHSELCWILNCMTPINWMERMIQFKEKSIQ-QGNNVS 123

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIA-QRFNTEFERKIKEVAQKYAQ 186
           +GLF YP+LMAADILLY A  VPVGEDQ+QHLE+ R IA QR N  F +           
Sbjct: 124 IGLFDYPILMAADILLYDADFVPVGEDQKQHLELARDIAQQRINARFSK----------- 172

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                K    I + +I  + S+I SL D SKKMSKSD ++ SRINLLD P+II KKI++A
Sbjct: 173 ----DKNILKIPQPIIMKNGSKIMSLIDGSKKMSKSDPNEGSRINLLDPPEIITKKIKRA 228

Query: 247 KTDGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALAD 302
           K+D  +      G+E     R E+KNL+ I++ +   +I +   +F    +  FK  + +
Sbjct: 229 KSDSSI------GIEFKNPERPESKNLLMIYSILSGKEISQCENEFLETGWGTFKKLITE 282

Query: 303 AVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            +IE + PI +K + L+ D   L+ IL EG  +A   A +T+K V   +G 
Sbjct: 283 QLIESLEPIQKKYKLLINDPYQLNKILNEGNEKAEYLANQTLKRVKSKLGF 333


>gi|239917013|ref|YP_002956571.1| tryptophanyl-tRNA synthetase [Micrococcus luteus NCTC 2665]
 gi|281414525|ref|ZP_06246267.1| tryptophanyl-tRNA synthetase [Micrococcus luteus NCTC 2665]
 gi|239838220|gb|ACS30017.1| tryptophanyl-tRNA synthetase [Micrococcus luteus NCTC 2665]
          Length = 360

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 144/358 (40%), Positives = 201/358 (56%), Gaps = 35/358 (9%)

Query: 3   SSDNLFVSGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLR 61
           S+ +  +SG+QP+   LHLGNYLG + N  R Q   +    +FI DLHAIT       L 
Sbjct: 26  SARHRVLSGMQPSADSLHLGNYLGALVNWERTQ--ADFEAFFFIPDLHAITVPQDPAALA 83

Query: 62  YQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKEN 121
            ++R+  A F+A G+DP R+ +F QS V  HA L+W+L+C+  MG    M QFK+KS + 
Sbjct: 84  ERTRVAAAQFIAGGIDPERSTLFVQSQVPEHAQLAWVLTCMTGMGEAMRMTQFKDKSAKQ 143

Query: 122 KEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVA 181
             + A +GL  YP+LMAADILLY+   VPVG+DQRQH+E+TR +AQRFN           
Sbjct: 144 GADAAGVGLLAYPMLMAADILLYQPHGVPVGDDQRQHVELTRDLAQRFN----------- 192

Query: 182 QKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAK 241
            +Y +      GF+P        + +RI  L+D + KMSKS +S    IN+LD P   AK
Sbjct: 193 HRYGETFVVPTGFYP-------ETGARIYDLQDPTSKMSKSAASPNGLINVLDEPKKTAK 245

Query: 242 KIQKAKTDGDVLPSEVSGLENRL--EAK----NLIEIFATMRQIKIEEALKQFGGKNFSQ 295
           KI+ A TD         G E R   EAK    NL+ I + +    I +  ++F GK +  
Sbjct: 246 KIKSAVTD--------DGTEARFDREAKPGVSNLLTILSAVSGTPIPQLEEEFVGKMYGH 297

Query: 296 FKLALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            K+A+ADAV+E + P+ ++   LL D + LD IL  GA +AR  A   ++ V   VG 
Sbjct: 298 LKVAVADAVVERLAPVRERALALLDDPAELDRILAAGAEKARAVATPVLEDVYAKVGF 355


>gi|325962566|ref|YP_004240472.1| tryptophanyl-tRNA synthetase [Arthrobacter phenanthrenivorans
           Sphe3]
 gi|323468653|gb|ADX72338.1| tryptophanyl-tRNA synthetase [Arthrobacter phenanthrenivorans
           Sphe3]
          Length = 342

 Score =  247 bits (630), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 137/360 (38%), Positives = 205/360 (56%), Gaps = 35/360 (9%)

Query: 1   MLSSDNLFVSGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQEN 59
           M ++    +SG +PT   LHLGNY+G +RN +  Q    +  ++FI DLHAIT +     
Sbjct: 1   MPAAKKRILSGAKPTADSLHLGNYIGAVRNWVDMQ--AEYDAVFFIPDLHAITVDFDPAE 58

Query: 60  LRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSK 119
           L  ++R+  A ++AAG+DP ++I F QS V  HA L+W L+C+   G  + M QFK+K++
Sbjct: 59  LAKRTRIVAAQYIAAGIDPDKSIFFVQSHVPEHAQLAWALNCITGFGEASRMTQFKDKTQ 118

Query: 120 ENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKE 179
           ++  + A+LGLF YP LMAADILLY+   VPVGEDQRQHLE+TR +AQRFNT F      
Sbjct: 119 KSGADAATLGLFAYPTLMAADILLYQTDLVPVGEDQRQHLELTRNLAQRFNTRFGPT--- 175

Query: 180 VAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDII 239
                          F + E  I   +++I  L++ S KMSK+  S    I LL++P I 
Sbjct: 176 ---------------FTVPEATIVKESAKIYDLQNPSAKMSKTGESPNGAIQLLEDPKIA 220

Query: 240 AKKIQKAKTDGDVLPSEVSGLENRLEAK------NLIEIFATMRQIKIEEALKQFGGKNF 293
           AK+I+ A TD        +G E R +A+      NL+ I++++    + E   ++ GK +
Sbjct: 221 AKRIKSAVTD--------AGTEIRFDAEEKPGVSNLLTIYSSLTGKSVAELEAEYQGKMY 272

Query: 294 SQFKLALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
              K+ LA+ V++ + P+  +   L+ D + LD +L  GA RAR  A  T+  V E +G 
Sbjct: 273 GHLKVDLAEVVVDFVTPLRNRTNELMADPAELDRLLAHGAERAREIASVTLAQVYERMGF 332


>gi|169630762|ref|YP_001704411.1| tryptophanyl-tRNA synthetase [Mycobacterium abscessus ATCC 19977]
 gi|169242729|emb|CAM63757.1| Tryptophanyl-tRNA synthetase (TrpS) [Mycobacterium abscessus]
          Length = 340

 Score =  247 bits (630), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 139/346 (40%), Positives = 200/346 (57%), Gaps = 25/346 (7%)

Query: 10  SGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           SG+QPT   LHLGN LG ++  +R Q    +  ++ + DLHAIT     E LR ++R  V
Sbjct: 13  SGIQPTADSLHLGNVLGAVQQWVRLQH--EYEALFCVVDLHAITVAQDPEELRRRTRAVV 70

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A ++A GVDP+++ IF QS V  HA+L+W+L C+   G    M QFK+KS +   +  ++
Sbjct: 71  AQYVALGVDPAKSAIFVQSHVPAHAELAWVLGCLTGYGEAARMTQFKDKSAKQGNDATTV 130

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GLF YPVLMAADILLY+   VPVG+DQRQHLE+TR +AQRFN            +Y Q  
Sbjct: 131 GLFTYPVLMAADILLYQTNVVPVGDDQRQHLELTRDVAQRFNG-----------RYGQT- 178

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                 F + E  +  +A+RI  L+D + KMSKS S+    INLLD P + AKK++ A+T
Sbjct: 179 ------FVLPETFVPKNAARIYDLQDPTVKMSKSASTPAGLINLLDEPAVSAKKVKSAQT 232

Query: 249 DGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
           D D    E+    + +    NL+ I + +    IE  +  + G+ +   K   A+A+IE 
Sbjct: 233 DSD---REIRFDRDAKPGVSNLLSIQSALTGADIETLVDGYAGRGYGDLKKDTAEALIEF 289

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + P+  +   LL D + LD IL  GA RAR  A++T+  V + +G 
Sbjct: 290 VTPVRDRTNELLSDTAALDDILASGAARARELAEKTLTEVYDRIGF 335


>gi|123968189|ref|YP_001009047.1| tryptophanyl-tRNA synthetase [Prochlorococcus marinus str. AS9601]
 gi|123198299|gb|ABM69940.1| Tryptophanyl-tRNA synthetase [Prochlorococcus marinus str. AS9601]
          Length = 338

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 145/351 (41%), Positives = 204/351 (58%), Gaps = 29/351 (8%)

Query: 8   FVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
            +SGVQPTG LH+GN+LG I N +  Q+   +     + DLHAIT +   + L   +   
Sbjct: 7   ILSGVQPTGDLHIGNWLGAINNWVELQD--QYETFLCVVDLHAITASYNPKELSKNTIST 64

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A ++A G+DP+   IF QS +  H++L WIL+C+  + WM  MIQFKEKS + +    S
Sbjct: 65  AALYVACGIDPNICSIFVQSQISAHSELCWILNCMTPINWMERMIQFKEKSIQ-QGNNVS 123

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIA-QRFNTEFERKIKEVAQKYAQ 186
           +GLF YP+LMAADILLY A  VPVGEDQ+QHLE+ R IA QR N  F +           
Sbjct: 124 IGLFDYPILMAADILLYNADFVPVGEDQKQHLELARDIAQQRINARFSK----------- 172

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                K    I + +I  + S+I SL D SKKMSKSD ++ SRINLLD P+II KKI++A
Sbjct: 173 ----DKNILKIPQPIIMKNGSKIMSLIDGSKKMSKSDPNEGSRINLLDPPEIITKKIKRA 228

Query: 247 KTDGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALAD 302
           K+D  V      G+E     R E+KNL+ I++ +   +I +   +F    +  FK  + +
Sbjct: 229 KSDSSV------GIEFNNPERPESKNLLMIYSILSGKEISQCENEFLETGWGTFKKLITE 282

Query: 303 AVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            +IE + PI +K + L+ D   L+ IL EG  +A   A +T+K V   +G 
Sbjct: 283 QLIESLEPIQKKYKLLINDPYQLNKILNEGKEKAEDLANQTLKRVKSKLGF 333


>gi|33862695|ref|NP_894255.1| tryptophanyl-tRNA synthetase [Prochlorococcus marinus str. MIT
           9313]
 gi|39932062|sp|Q7TV34|SYW_PROMM RecName: Full=Tryptophanyl-tRNA synthetase; AltName:
           Full=Tryptophan--tRNA ligase; Short=TrpRS
 gi|33634611|emb|CAE20597.1| t-RNA synthetase, class Ib:Tryptophanyl-tRNA synthetase
           [Prochlorococcus marinus str. MIT 9313]
          Length = 337

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 148/349 (42%), Positives = 201/349 (57%), Gaps = 28/349 (8%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQPTG LHLGN+LG IRN +  Q +  H     + DLHAIT     E L  +S    
Sbjct: 7   LSGVQPTGALHLGNWLGAIRNWVDLQSS--HDTYVCVVDLHAITVPHDPERLAEESLSTA 64

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+DP    IF QS V  H++L W+L+CV  + W+  MIQFKEKS + + +  S+
Sbjct: 65  ALYLACGMDPDLCSIFVQSQVSAHSELCWLLNCVTPLNWLERMIQFKEKSVK-QGDNVSV 123

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIA-QRFNTEFERKIKEVAQKYAQE 187
           GL  YPVLMAADILLY A  VPVGEDQ+QHLE+ R IA QR N  F  + K V +     
Sbjct: 124 GLLDYPVLMAADILLYDADLVPVGEDQKQHLELARDIAQQRINARFGSEEKPVLK----- 178

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                    + + LI    +R+ SL D   KMSKSD ++ SRI LLD P++I KKI++AK
Sbjct: 179 ---------VPDPLIIKEGARVMSLSDGRSKMSKSDPNEGSRITLLDPPELITKKIKRAK 229

Query: 248 TDGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           TD  +      GL+    +R EA NL+ I+A +     + A ++     +  FK  LADA
Sbjct: 230 TDPQM------GLQFGNPDRPEADNLLGIYAILSGRGRDAAAQECAEMGWGTFKPLLADA 283

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVG 352
            +  + PI  + Q L+ D+  L  +L +G  RA   AQ T++ V + +G
Sbjct: 284 TVSALEPIQHRYQQLMGDRIELIRVLDQGRTRAEETAQATLQRVRQALG 332


>gi|168206748|ref|ZP_02632753.1| tryptophanyl-tRNA synthetase [Clostridium perfringens E str.
           JGS1987]
 gi|170661847|gb|EDT14530.1| tryptophanyl-tRNA synthetase [Clostridium perfringens E str.
           JGS1987]
          Length = 332

 Score =  246 bits (628), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 136/354 (38%), Positives = 212/354 (59%), Gaps = 26/354 (7%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYF-IADLHAITNNIVQEN 59
           M     +  SG++P+G L LGNYLG I+N  + QE  +    YF + DLHAIT   +  +
Sbjct: 1   MEDKKKIIFSGIKPSGDLTLGNYLGAIKNWTKLQEEYD---CYFCVVDLHAITVKQLPAD 57

Query: 60  LRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSK 119
           LR ++   +A ++A+G++P +N +F QS V  H++ SW+L+C + MG ++ M Q+K+KSK
Sbjct: 58  LRRRTLEVLAIYIASGINPEKNTLFIQSHVPAHSEASWLLTCNSYMGELSRMTQYKDKSK 117

Query: 120 ENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKE 179
           +  +   + GLF YPVLMAADILLY A  VPVG+DQ QHLE+ R I  RFN  + +    
Sbjct: 118 KMGDSIGA-GLFNYPVLMAADILLYNADLVPVGKDQMQHLELARDIGTRFNNSYSKT--- 173

Query: 180 VAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDII 239
                          F I EG +    ++I  L+D SKKMSKSD++    I ++D P++I
Sbjct: 174 ---------------FTIPEGYVPKEGAKIMDLQDPSKKMSKSDANPNGFILIMDEPNVI 218

Query: 240 AKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLA 299
            KKI +A TD   +   V+  + +   KNLI I   ++    EE +K + GK +++FK  
Sbjct: 219 RKKISRAVTDSIGV---VNYTDEQPGVKNLINILCAIKGYTPEEVVKMYDGKGYAEFKND 275

Query: 300 LADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           +A+A++EE+ P+ +K++ LL DK  L+ I  +GA +A   A +T++ + + +GL
Sbjct: 276 VAEAIVEELAPVQEKVKALLGDKKALEEIYKKGAEKANYAAMKTLRKMQKKIGL 329


>gi|226305497|ref|YP_002765457.1| tryptophanyl-tRNA synthetase [Rhodococcus erythropolis PR4]
 gi|229489670|ref|ZP_04383533.1| tryptophan-tRNA ligase [Rhodococcus erythropolis SK121]
 gi|226184614|dbj|BAH32718.1| tryptophanyl-tRNA synthetase [Rhodococcus erythropolis PR4]
 gi|229323767|gb|EEN89525.1| tryptophan-tRNA ligase [Rhodococcus erythropolis SK121]
          Length = 344

 Score =  246 bits (628), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 141/350 (40%), Positives = 196/350 (56%), Gaps = 31/350 (8%)

Query: 9   VSGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SG+QPT    HLGNYLG ++  +  Q+  +    YFI DLHAIT     + LR ++++ 
Sbjct: 16  LSGIQPTSDSFHLGNYLGALQQWVPLQDDFD--AFYFIPDLHAITVTQDPKELRRRTKVA 73

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
           VA  LA G+DP R  +F QS V  HA L+W+L+C+   G  + M QFK+KS +   + AS
Sbjct: 74  VAQLLAVGIDPDRATLFVQSQVPEHAQLAWVLNCITGFGEASRMTQFKDKSAKQGSDNAS 133

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GLF YPVLMAADILLYR   VPVGEDQRQHLE+ R +A RFNT                
Sbjct: 134 VGLFTYPVLMAADILLYRPQRVPVGEDQRQHLELARDLAGRFNT---------------- 177

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
            +Y K F  + E  I    ++I  L+D + KMSKS +S    INLLD+P + AKKI+ A 
Sbjct: 178 -RYGKAFV-VPEPQIIKGTAKIYDLQDPTAKMSKSAASAAGLINLLDDPKVSAKKIKSAV 235

Query: 248 TDGD----VLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           TD +      P    G+       NL+ I + +  + IE  +  + GK +   K   AD 
Sbjct: 236 TDNEREIRFDPQAKPGVS------NLLTIQSALSGVPIETLVAGYEGKGYGDLKTDTADV 289

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + E + P+  K+   L D++ LD I+  GA+RAR  +  T+  V + VG 
Sbjct: 290 LTEFVTPLKAKVDGYLADEAELDRIIAAGAHRAREVSSRTLAAVYDKVGF 339


>gi|170059894|ref|XP_001865561.1| conserved hypothetical protein [Culex quinquefasciatus]
 gi|167878506|gb|EDS41889.1| conserved hypothetical protein [Culex quinquefasciatus]
          Length = 372

 Score =  246 bits (628), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 143/347 (41%), Positives = 200/347 (57%), Gaps = 26/347 (7%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQPTG LH+GNYLG I+  +  Q +   +  Y I DLH+IT     + LR+ S    A
Sbjct: 33  SGVQPTGALHIGNYLGAIKRWVDLQNSGEDV-TYCIVDLHSITLPQDPDLLRHNSLQMAA 91

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           + LA G+DP+++ +F QS V  HA+LSWIL C+  M  + ++ Q+KEKS + KE    LG
Sbjct: 92  TLLACGIDPAKSTLFLQSGVPQHAELSWILGCMTTMARLTHLPQYKEKSAKLKE--IPLG 149

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L++YPVL AADI+LY+ATHVPVGEDQ QHL++ + +A+ FN  F                
Sbjct: 150 LYIYPVLQAADIMLYKATHVPVGEDQVQHLQLAQSLARAFNNRFGPT------------- 196

Query: 190 YSKGFFPIIEGLI-DSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                FP    +I D ++ R++SLRD +KKMSKSD    S I L D  D+I +KI+K+ T
Sbjct: 197 -----FPFCNPIISDDTSCRLKSLRDPTKKMSKSDPDPKSCIMLTDKADVIREKIRKSVT 251

Query: 249 DGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
           D     SEV+   E R    NL+ I +       ++   +  G N  Q+K  +ADA++  
Sbjct: 252 D---FTSEVTFEPETRPGVANLLTIHSLASGKSPQQICAEAKGLNTGQYKGLVADALVAH 308

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
           + PI   I   L D  YL T++ EG  RAR  A+ T+  V E VG++
Sbjct: 309 LEPIRSDIDRYLADPGYLATVIEEGCERARETAERTLHEVKEKVGMN 355


>gi|126695962|ref|YP_001090848.1| tryptophanyl-tRNA synthetase [Prochlorococcus marinus str. MIT
           9301]
 gi|126543005|gb|ABO17247.1| Tryptophanyl-tRNA synthetase [Prochlorococcus marinus str. MIT
           9301]
          Length = 338

 Score =  246 bits (628), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 145/351 (41%), Positives = 203/351 (57%), Gaps = 29/351 (8%)

Query: 8   FVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
            +SGVQPTG LH+GN+LG I N +  QE   +     + DLHAIT +   + L   +   
Sbjct: 7   ILSGVQPTGDLHIGNWLGAINNWVTLQE--QYETFLCVVDLHAITASYNPKELSKNTFST 64

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A ++A G+DP+   IF QS +  H++L WIL+C+  + WM  MIQFKEKS + +    S
Sbjct: 65  AALYVACGIDPNICSIFVQSQISAHSELCWILNCMTPINWMERMIQFKEKSIQ-QGNNVS 123

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIA-QRFNTEFERKIKEVAQKYAQ 186
           +GLF YP+LMAADILLY A  VPVGEDQ+QHLE+ R IA QR N  F +           
Sbjct: 124 IGLFDYPILMAADILLYDADFVPVGEDQKQHLELARDIAQQRINARFSK----------- 172

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                K    I + +I  + S+I SL D SKKMSKSD ++ SRINLLD P+II KKI++A
Sbjct: 173 ----DKNILKIPQPIIMKNGSKIMSLIDGSKKMSKSDPNEGSRINLLDPPEIITKKIKRA 228

Query: 247 KTDGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALAD 302
           K+D  +      G+E     R E+KNL+ I++ +   +I +   +F    +  FK  + +
Sbjct: 229 KSDSSI------GIEFNNPERPESKNLMMIYSILSGKEISQCENEFLETGWGTFKKLITE 282

Query: 303 AVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            +IE + PI +K + L+ D   L  IL EG  +A   A +T+K V   +G 
Sbjct: 283 QLIESLEPIQKKYKLLMNDPYQLSKILNEGKEKAEDLANQTLKRVKSKLGF 333


>gi|220911967|ref|YP_002487276.1| tryptophanyl-tRNA synthetase [Arthrobacter chlorophenolicus A6]
 gi|219858845|gb|ACL39187.1| tryptophanyl-tRNA synthetase [Arthrobacter chlorophenolicus A6]
          Length = 347

 Score =  246 bits (627), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 136/350 (38%), Positives = 201/350 (57%), Gaps = 31/350 (8%)

Query: 9   VSGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SG +PT   LHLGNY+G +RN +  Q    +  ++FI DLHAIT +     L  ++R+ 
Sbjct: 14  LSGAKPTADSLHLGNYIGAVRNWVDMQ--AEYDAVFFIPDLHAITVDFDPAELAKRTRIV 71

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A ++AAG+DP ++I F QS V  HA L+W L+C+   G  + M QFK+K++++  +TA+
Sbjct: 72  AAQYIAAGIDPDKSIFFVQSHVPEHAQLAWALNCITGFGEASRMTQFKDKTQKSGADTAT 131

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           LGLF YP LMAADILLY+   VPVGEDQRQHLE+TR +AQRFNT+F              
Sbjct: 132 LGLFAYPTLMAADILLYQTDLVPVGEDQRQHLELTRNLAQRFNTKF-------------- 177

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F + E  I   +++I  L++ S KMSK+  S    I LL++P I AK+I+ A 
Sbjct: 178 ----GATFTVPEATILKESAKIYDLQNPSAKMSKTGESPNGAIQLLEDPKIAAKRIKSAV 233

Query: 248 TDGDVL----PSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           TD        P E  G+       NL+ I++++    + +   ++ GK +   K+ LA+ 
Sbjct: 234 TDAGTEIRFNPEEKPGV------SNLLTIYSSLTGKPVADLEAEYEGKMYGHLKVDLAEV 287

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           V++ + P+  +   L+ D + LD +L  GA RAR  A  TM  V E +G 
Sbjct: 288 VVDFVTPLRNRTNELMADPAELDRLLALGAERAREIASVTMAQVYERMGF 337


>gi|168211953|ref|ZP_02637578.1| tryptophanyl-tRNA synthetase [Clostridium perfringens B str. ATCC
           3626]
 gi|170710122|gb|EDT22304.1| tryptophanyl-tRNA synthetase [Clostridium perfringens B str. ATCC
           3626]
          Length = 332

 Score =  246 bits (627), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 136/354 (38%), Positives = 211/354 (59%), Gaps = 26/354 (7%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYF-IADLHAITNNIVQEN 59
           M     +  SG++P+G L LGNYLG I+N  + QE  +    YF + DLHAIT   +  +
Sbjct: 1   MEDKKKIIFSGIKPSGDLTLGNYLGAIKNWTKLQEEYD---CYFCVVDLHAITVKQLPAD 57

Query: 60  LRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSK 119
           LR ++   +A ++A+G++P  N +F QS V  H++ SW+L+C + MG ++ M Q+K+KSK
Sbjct: 58  LRRRTLEVLAIYIASGINPEENTLFIQSHVPAHSEASWLLTCNSYMGELSRMTQYKDKSK 117

Query: 120 ENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKE 179
           +  +   + GLF YPVLMAADILLY A  VPVG+DQ QHLE+ R I  RFN  + +    
Sbjct: 118 KMGDSIGA-GLFNYPVLMAADILLYNADLVPVGKDQMQHLELARDIGTRFNNSYSKT--- 173

Query: 180 VAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDII 239
                          F I EG +    ++I  L+D SKKMSKSD++    I ++D P++I
Sbjct: 174 ---------------FTIPEGYVPKEGAKIMDLQDPSKKMSKSDANPNGFILIMDEPNVI 218

Query: 240 AKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLA 299
            KKI +A TD   +   V+  + +   KNLI I   ++    EE +K + GK +++FK  
Sbjct: 219 RKKISRAVTDSIGV---VNYTDEQPGVKNLINILCAIKGYTPEEVVKMYDGKGYAEFKSD 275

Query: 300 LADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           +A+A++EE+ P+ +K++ LL DK  L+ I  +GA +A   A +T++ + + +GL
Sbjct: 276 VAEAIVEELAPVQEKVKALLGDKKALEEIYKKGAEKANYAAMKTLRKMQKKIGL 329


>gi|300718759|ref|YP_003743562.1| Tryptophanyl-tRNA synthetase [Erwinia billingiae Eb661]
 gi|299064595|emb|CAX61715.1| Tryptophanyl-tRNA synthetase [Erwinia billingiae Eb661]
          Length = 334

 Score =  246 bits (627), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 139/350 (39%), Positives = 201/350 (57%), Gaps = 21/350 (6%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  +  SG QP+G L +GNY+G +R  +  Q++  H  +Y I DLHAIT       LR  
Sbjct: 2   SKPIVFSGAQPSGELTIGNYMGALRQWVSMQDS--HDCIYCIVDLHAITVRQDPTALRKA 59

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           +   +A +LA G+DP ++ IF QS V  H  LSWIL+C    G ++ M QFK+KS    E
Sbjct: 60  TLDTLALYLACGIDPEKSTIFVQSHVPEHTQLSWILNCYTYFGELSRMTQFKDKSTR-YE 118

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
           E  + GLF YPVLMAADILLY+ T VPVGEDQ+QHLE++R +A RFN  +          
Sbjct: 119 ENINAGLFDYPVLMAADILLYQTTQVPVGEDQKQHLELSRDVASRFNALY---------- 168

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
                      F + E  I  S +R+ SL + +KKMSKSD +  + I LL++P  + KKI
Sbjct: 169 --------GDIFKVPEPFIPKSGARVMSLLEPTKKMSKSDDNRNNVIGLLEDPKAVVKKI 220

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           ++A TDGD  P     ++N+    NL++I + +    I E  +QF G+ +   K A+A+A
Sbjct: 221 KRAMTDGDEPPVVRYDVKNKAGVSNLLDILSGVTGTSIPELEQQFEGQMYGHLKGAVAEA 280

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           V   +  + ++      D++ LD I+ +GA +AR +AQ T+K V E +G 
Sbjct: 281 VSGMLTDLQERYYRFRNDEALLDQIMRDGAAKARSQAQVTLKKVYEAIGF 330


>gi|169344712|ref|ZP_02865672.1| tryptophanyl-tRNA synthetase [Clostridium perfringens C str.
           JGS1495]
 gi|169297147|gb|EDS79262.1| tryptophanyl-tRNA synthetase [Clostridium perfringens C str.
           JGS1495]
          Length = 332

 Score =  246 bits (627), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 136/354 (38%), Positives = 211/354 (59%), Gaps = 26/354 (7%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYF-IADLHAITNNIVQEN 59
           M     +  SG++P+G L LGNYLG I+N  + QE  +    YF + DLHAIT   +  +
Sbjct: 1   MEDKKKIIFSGIKPSGDLTLGNYLGAIKNWTKLQEEYD---CYFCVVDLHAITVKQLPAD 57

Query: 60  LRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSK 119
           LR ++   +A ++A+G++P  N +F QS V  H++ SW+L+C + MG ++ M Q+K+KSK
Sbjct: 58  LRRRTLEVLAIYIASGINPEENTLFIQSHVPAHSEASWLLTCNSYMGELSRMTQYKDKSK 117

Query: 120 ENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKE 179
           +  +   + GLF YPVLMAADILLY A  VPVG+DQ QHLE+ R I  RFN  + +    
Sbjct: 118 KMGDSIGA-GLFNYPVLMAADILLYNADLVPVGKDQMQHLELARDIGTRFNNSYSKT--- 173

Query: 180 VAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDII 239
                          F I EG +    ++I  L+D SKKMSKSD++    I ++D P++I
Sbjct: 174 ---------------FTIPEGYVPKEGAKIMDLQDPSKKMSKSDANPNGFILIMDEPNVI 218

Query: 240 AKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLA 299
            KKI +A TD   +   V+  + +   KNLI I   ++    EE +K + GK +++FK  
Sbjct: 219 RKKISRAVTDSIGV---VNYTDEQPGVKNLINILCAIKGYNPEEVVKMYDGKGYAEFKND 275

Query: 300 LADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           +A+A++EE+ P+ +K++ LL DK  L+ I  +GA +A   A +T++ + + +GL
Sbjct: 276 VAEAIVEELAPVQEKVKALLGDKKALEEIYKKGAEKANYAAMKTLRKMQKKIGL 329


>gi|227112145|ref|ZP_03825801.1| tryptophanyl-tRNA synthetase [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 334

 Score =  245 bits (626), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 137/350 (39%), Positives = 204/350 (58%), Gaps = 21/350 (6%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  +  SG QP+G L +GNY+G +R  +  Q+  ++  +Y I DLHAIT     + LR  
Sbjct: 2   SKPIVFSGAQPSGELTIGNYMGALRQWVNMQD--DYDCIYCIVDLHAITVRQDPQALRKA 59

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           +   +A +LA G+DP ++ IF QS V  H+ LSWIL+C A  G ++ M QFK+KS    E
Sbjct: 60  TLDTLALYLACGIDPKKSTIFVQSHVPEHSQLSWILNCYAYFGELSRMTQFKDKSAR-YE 118

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
           E  + GLF YPVLMAADILLY+   VPVGEDQ+QHLE++R + QRFN+ +          
Sbjct: 119 ENINAGLFSYPVLMAADILLYQTNQVPVGEDQKQHLELSRDVGQRFNSLY---------- 168

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
                      F + E  I  S +R+ SL + +KKMSKSD +  + I LL++P  + KKI
Sbjct: 169 --------GDIFKVPEPFIPKSGARVMSLLEPTKKMSKSDDNRNNVIGLLEDPKAVVKKI 220

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           ++A TD D  P     ++N+    NL++I + +    I E  ++F G+ +   K A+ADA
Sbjct: 221 KRAMTDSDEPPVIRYDVKNKAGVSNLLDILSGVTGKPIPELEQEFDGQMYGHLKGAVADA 280

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           V   +  + ++      D+++L  I+ EGA++A  RAQET+K V + +G 
Sbjct: 281 VSGMLSELQERYHRFRNDEAFLQQIMREGADKASARAQETLKKVYDAIGF 330


>gi|110799150|ref|YP_695067.1| tryptophanyl-tRNA synthetase [Clostridium perfringens ATCC 13124]
 gi|110673797|gb|ABG82784.1| tryptophanyl-tRNA synthetase [Clostridium perfringens ATCC 13124]
          Length = 332

 Score =  245 bits (626), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 136/354 (38%), Positives = 211/354 (59%), Gaps = 26/354 (7%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYF-IADLHAITNNIVQEN 59
           M     +  SG++P+G L LGNYLG I+N  + QE  +    YF + DLHAIT   +  +
Sbjct: 1   MEDKKKIIFSGIKPSGDLTLGNYLGAIKNWTKLQEEYD---CYFCVVDLHAITVKQLPAD 57

Query: 60  LRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSK 119
           LR ++   +A ++A+G++P  N +F QS V  H++ SW+L+C + MG ++ M Q+K+KSK
Sbjct: 58  LRRRTLEVLAIYIASGINPDENTLFIQSHVPAHSEASWLLTCNSYMGELSRMTQYKDKSK 117

Query: 120 ENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKE 179
           +  +   + GLF YPVLMAADILLY A  VPVG+DQ QHLE+ R I  RFN  + +    
Sbjct: 118 KMGDSIGA-GLFNYPVLMAADILLYNADLVPVGKDQMQHLELARDIGTRFNNSYSKT--- 173

Query: 180 VAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDII 239
                          F I EG +    ++I  L+D SKKMSKSD++    I ++D P++I
Sbjct: 174 ---------------FTIPEGYVPKEGAKIMDLQDPSKKMSKSDANPNGFILIMDEPNVI 218

Query: 240 AKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLA 299
            KKI +A TD   +   V+  + +   KNLI I   ++    EE +K + GK +++FK  
Sbjct: 219 RKKISRAVTDSIGV---VNYTDEQPGVKNLINILCAIKGYTPEEVVKMYDGKGYAEFKND 275

Query: 300 LADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           +A+A++EE+ P+ +K++ LL DK  L+ I  +GA +A   A +T++ + + +GL
Sbjct: 276 VAEAIVEELAPVQEKVKALLGDKKALEEIYKKGAEKANYAAMKTLRKMQKKIGL 329


>gi|168218147|ref|ZP_02643772.1| tryptophanyl-tRNA synthetase [Clostridium perfringens NCTC 8239]
 gi|182379840|gb|EDT77319.1| tryptophanyl-tRNA synthetase [Clostridium perfringens NCTC 8239]
          Length = 332

 Score =  245 bits (626), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 136/354 (38%), Positives = 211/354 (59%), Gaps = 26/354 (7%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYF-IADLHAITNNIVQEN 59
           M     +  SG++P+G L LGNYLG I+N  + QE  +    YF + DLHAIT   +  +
Sbjct: 1   MEDKKKIIFSGIKPSGDLTLGNYLGAIKNWTKLQEEYD---CYFCVVDLHAITVKQLPAD 57

Query: 60  LRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSK 119
           LR ++   +A ++A+G++P  N +F QS V  H++ SW+L+C + MG ++ M Q+K+KSK
Sbjct: 58  LRRRTLEVLAIYIASGINPEENTLFIQSHVPAHSEASWLLTCNSYMGELSRMTQYKDKSK 117

Query: 120 ENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKE 179
           +  +   + GLF YPVLMAADILLY A  VPVG+DQ QHLE+ R I  RFN  + +    
Sbjct: 118 KMGDSIGA-GLFNYPVLMAADILLYNADLVPVGKDQMQHLELARDIGTRFNNSYSKT--- 173

Query: 180 VAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDII 239
                          F I EG +    ++I  L+D SKKMSKSD++    I ++D P++I
Sbjct: 174 ---------------FTIPEGYVPKEGAKIMDLQDPSKKMSKSDANPNGFILIMDEPNVI 218

Query: 240 AKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLA 299
            KKI +A TD   +   V+  + +   KNLI I   ++    EE +K + GK +++FK  
Sbjct: 219 RKKISRAVTDSIGV---VNYTDEQPGVKNLINILCAIKGYTPEEVVKMYDGKGYAEFKND 275

Query: 300 LADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           +A+A++EE+ P+ +K++ LL DK  L+ I  +GA +A   A +T++ + + +GL
Sbjct: 276 VAEAIVEELAPVQEKVKALLGDKKALEEIYKKGAEKANYAAMKTLRKMQKKIGL 329


>gi|116075454|ref|ZP_01472714.1| tryptophanyl-tRNA synthetase [Synechococcus sp. RS9916]
 gi|116067651|gb|EAU73405.1| tryptophanyl-tRNA synthetase [Synechococcus sp. RS9916]
          Length = 337

 Score =  245 bits (626), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 143/350 (40%), Positives = 199/350 (56%), Gaps = 28/350 (8%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQPTG LHLGN+LG IRN +  Q +  H   + + DLHAIT       L   +    
Sbjct: 7   LSGVQPTGALHLGNWLGAIRNWVDLQHS--HDTFFCVVDLHAITVPHDPSRLAEDTLSTA 64

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+DP ++ +F QS V  HA+L W+L+CV  + W+  MIQFKEK+ ++ +   S+
Sbjct: 65  ALYLACGIDPEKSTVFVQSHVPAHAELCWLLNCVTPLNWLERMIQFKEKAVKHGDNV-SV 123

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIA-QRFNTEFERKIKEVAQKYAQE 187
           GL  YPVLMAADILLY A  VPVGEDQ+QHLE+ R IA QR N  F      V +     
Sbjct: 124 GLLDYPVLMAADILLYDADLVPVGEDQKQHLELARDIAQQRINARFGNDDAPVLK----- 178

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                    + + LI    +R+ SL D   KMSKSD ++ SRI LLD PD+I KKI++AK
Sbjct: 179 ---------VPKPLILKEGARVMSLTDGRSKMSKSDPNEGSRITLLDPPDLITKKIKRAK 229

Query: 248 TDGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           TD  +      GLE    +R E  NL+ ++A +     E A ++     + +FK  LA++
Sbjct: 230 TDPQM------GLEFGNPDRPETDNLLGLYAILTGKGREAAAEECADMGWGKFKPLLAES 283

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            +  + PI  +   L+ D+  LD +L EG +RA   A+ T+  V   +G 
Sbjct: 284 AVAALEPIQARYNELMADRGELDRVLREGRDRANAVAEATVDRVRTSLGF 333


>gi|145298159|ref|YP_001141000.1| tryptophanyl-tRNA synthetase [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142850931|gb|ABO89252.1| tryptophanyl-tRNA synthetase [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 334

 Score =  245 bits (626), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 138/347 (39%), Positives = 200/347 (57%), Gaps = 21/347 (6%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           + +SG QP+G L +GNY+G +R  +  Q+  + L  Y I DLHAIT       LR     
Sbjct: 5   IVLSGAQPSGQLTIGNYMGALRQWVNMQDDFDCL--YCIVDLHAITTRQEPAALRKACLD 62

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A +LA G+DP+++ +F QS V  HA+L WIL+C  +MG ++ M QFK+KS    E   
Sbjct: 63  AAALYLAVGIDPAKSTVFIQSHVPQHAELGWILNCYTQMGELSRMTQFKDKSARF-ENNV 121

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           ++GLF YPVLMAADILLY+A  VPVG DQ+QHLE+TR I  RFN  +             
Sbjct: 122 NVGLFGYPVLMAADILLYQANQVPVGNDQKQHLELTRDICTRFNNLYGE----------- 170

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F + E  I +  +R+ SL+D +KKMSKSD ++ + I LL++P  I KKI++A
Sbjct: 171 -------VFTLPEPFIPTDGARVMSLQDPTKKMSKSDDNEANFIGLLEDPKQIVKKIKRA 223

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
            TD D         EN+    NL+ + + +    I E  + F GK +   K   A+AV+ 
Sbjct: 224 VTDSDEPAVVRFDPENKPGVSNLLTLMSGVTGRSIPELEQHFEGKMYGHLKTETAEAVVA 283

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + PI  + + L +D+++L TIL  GA +AR RA++T+  V ++VG 
Sbjct: 284 LLEPIQARFRELRQDEAHLQTILAAGAQKARERAEKTLTSVYDVVGF 330


>gi|291298422|ref|YP_003509700.1| tryptophanyl-tRNA synthetase [Stackebrandtia nassauensis DSM 44728]
 gi|290567642|gb|ADD40607.1| tryptophanyl-tRNA synthetase [Stackebrandtia nassauensis DSM 44728]
          Length = 344

 Score =  245 bits (626), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 144/347 (41%), Positives = 199/347 (57%), Gaps = 27/347 (7%)

Query: 9   VSGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SG+QPT    HLGNYLG +RN +  Q+T  H   Y + DLHAIT +   + LR +SR+ 
Sbjct: 17  LSGIQPTADSFHLGNYLGALRNWVAMQDT--HDAFYCVVDLHAITVDHDPKLLRKRSRIA 74

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A  LA G+DP+R+ +F QS V  H  LSWIL C    G    M QFK+KS +N  E  S
Sbjct: 75  AAQLLAVGIDPARSTLFVQSQVPEHPMLSWILECHTGFGEAGRMTQFKDKSAKN--ERVS 132

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GLF YP+L AADILLYRA  VPVGEDQRQHLE++R +AQRFNT++              
Sbjct: 133 VGLFTYPILQAADILLYRADAVPVGEDQRQHLELSRDLAQRFNTKY-------------- 178

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F + E  I  +   I+ L + ++KMSKS+S     I+LLD+P+ I KKI+ A 
Sbjct: 179 ----GNVFTVPEAHIIKATGTIQDLTEPARKMSKSNSQPAGIIDLLDDPNRIRKKIKSAV 234

Query: 248 TD-GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
           TD G  +   V   EN+    NL+ I++++ +  IEE   ++    +  FK  LA+ V +
Sbjct: 235 TDTGREI---VFDPENKPGVSNLLTIYSSLTETSIEELQNRYADSGYGDFKKDLAEIVAD 291

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
              PI+Q+ +  L D + LD IL+ GA +A   A  T+  V   +G 
Sbjct: 292 FCAPIAQRTKSYLDDTAELDKILLAGAEKAHSVAAHTLARVYRKMGF 338


>gi|296209005|ref|XP_002751342.1| PREDICTED: tryptophanyl-tRNA synthetase, mitochondrial isoform 1
           [Callithrix jacchus]
          Length = 360

 Score =  245 bits (626), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 134/345 (38%), Positives = 210/345 (60%), Gaps = 25/345 (7%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QPTG+ HLGNYLG I N +R Q+  + + +Y I DLH+IT       LR       A
Sbjct: 39  SGIQPTGIPHLGNYLGAIENWVRLQDEYDSV-LYSIVDLHSITVPQDPAVLRQSILDMTA 97

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           + LA G++P ++I+F+QS V  H  LSWILSC+ R+  + ++ Q+K K+ + K +  + G
Sbjct: 98  TLLACGINPEKSILFQQSQVSEHTQLSWILSCMVRLPRLQHLHQWKAKTAKQKHD-GTAG 156

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L  YPVL AADILLY++THVPVGEDQ QH+E+ + +AQ FN           +KY +   
Sbjct: 157 LLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQGFN-----------KKYGE--- 202

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
               FFP+ + ++ +S  +++SLRD S KMSKSD    + + + D+P+ I +K +KA TD
Sbjct: 203 ----FFPVPKSIL-TSMKKVKSLRDPSAKMSKSDPDKLATVGITDSPEEIVRKFRKAVTD 257

Query: 250 GDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
                SEV+     R    NL+ + A +  + ++E +++  G + +++KLA+ADAVIE+ 
Sbjct: 258 ---FTSEVTYDPAGRPGVSNLVAVHAAVTGLPVQEVVRRSAGMDTARYKLAVADAVIEKF 314

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            PI ++++ L  DK +L+ +L  G+ +A   A    + V ++VG 
Sbjct: 315 APIKRELEKLKLDKDHLEKVLQAGSAKAEELACPVCQEVKKLVGF 359


>gi|86606016|ref|YP_474779.1| tryptophanyl-tRNA synthetase [Synechococcus sp. JA-3-3Ab]
 gi|86554558|gb|ABC99516.1| tryptophanyl-tRNA synthetase [Synechococcus sp. JA-3-3Ab]
          Length = 331

 Score =  245 bits (626), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 147/349 (42%), Positives = 202/349 (57%), Gaps = 31/349 (8%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SG+QP+G LHLGNYLG I+N +  QE   +   + I D HAIT     + LR ++R   
Sbjct: 7   LSGIQPSGELHLGNYLGAIKNWVAEQE--RYENFFCIVDQHAITVPQDPKLLRERTRSLF 64

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+     ++F QS V  H +L+W+ + +  M W   MIQ+KEK ++  EET S+
Sbjct: 65  ALYLACGLSLEHCVLFVQSHVPAHTELAWLFTTITPMNWAERMIQYKEKKEKQGEET-SV 123

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GLF YP+L AADILLY+  +VPVGEDQRQH+E+ R IA+RFN  F     EV        
Sbjct: 124 GLFSYPILQAADILLYQPKYVPVGEDQRQHIELCRDIARRFNDRF----GEV-------- 171

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                 F I E LI    +RI SL D ++KMSKSD SDFSRI+LLD+PD I KKIQK KT
Sbjct: 172 ------FVIPEALIRPQGARIMSLTDGTRKMSKSDPSDFSRIHLLDDPDTIRKKIQKCKT 225

Query: 249 DGDVLPSEVSGL----ENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           D       + G+      R EA NL+ I+        EE   +     + QFK  LAD++
Sbjct: 226 DS------IRGIAFDDPARPEAHNLLTIYMLTSGKSKEEVAAECAEMGWGQFKPLLADSI 279

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           I  + PI ++ + L  D  YL  ++ E A +AR  A++T++   + +G 
Sbjct: 280 IATLEPIQKRYRELSSDPDYLHGLMRENAAKARAVAEQTLQKARDAMGF 328


>gi|109014635|ref|XP_001113563.1| PREDICTED: tryptophanyl-tRNA synthetase, mitochondrial isoform 2
           [Macaca mulatta]
          Length = 360

 Score =  245 bits (626), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 135/345 (39%), Positives = 209/345 (60%), Gaps = 25/345 (7%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QPTG+LHLGNYLG I N +R Q+  + + +Y I DLH+IT       LR       A
Sbjct: 39  SGIQPTGILHLGNYLGAIENWVRLQDEYDSV-LYSIVDLHSITVPQDPAVLRQSILDMTA 97

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
             LA G++P ++I+F+QS V  H  LSWILSC+ R+  + ++ Q+K K+ + K +    G
Sbjct: 98  VLLACGINPEKSILFQQSQVSEHTQLSWILSCMVRLPRLQHLHQWKAKTTKQKHDGTG-G 156

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L  YPVL AADILLY++THVPVGEDQ QH+E+ + +A+ FN           +KY +   
Sbjct: 157 LLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAEGFN-----------KKYGE--- 202

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
               FFP+ + ++ +S  +++SLRD S KMSKSD    + + + D+P+ I +K +KA TD
Sbjct: 203 ----FFPVPKSVL-TSMKKVKSLRDPSAKMSKSDPDKLATVRITDSPEEIVQKFRKAVTD 257

Query: 250 GDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
                SEV+     R    N++ + A +  + +EE +++  G + + +KLA+ADAVIE+ 
Sbjct: 258 ---FTSEVTYDPAGRAGVSNMVAVHAAVTGLSVEEVVRRSAGMDTAHYKLAVADAVIEKF 314

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            PI ++I+ L  DK +L+ +L  G+ +A+  A    + V ++VG 
Sbjct: 315 APIKREIEKLKLDKDHLEKVLQIGSAKAKELAYPVCQEVKKLVGF 359


>gi|307330674|ref|ZP_07609812.1| tryptophanyl-tRNA synthetase [Streptomyces violaceusniger Tu 4113]
 gi|306883653|gb|EFN14701.1| tryptophanyl-tRNA synthetase [Streptomyces violaceusniger Tu 4113]
          Length = 337

 Score =  245 bits (625), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 136/331 (41%), Positives = 187/331 (56%), Gaps = 25/331 (7%)

Query: 9   VSGVQPT-GVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SG+QPT G  HLGNYLG IR  +  QET  H   Y + DLHAIT       LR  SRL 
Sbjct: 9   LSGIQPTAGSFHLGNYLGAIRQYVALQET--HDAFYTVVDLHAITVPQDPAELRANSRLA 66

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A  LA+G+DP R  +F QS V  HA L W+++C+   G  + M QFK+KS  +  + A+
Sbjct: 67  AAQLLASGLDPDRCTLFIQSHVPEHAQLGWVMNCLTGFGEASRMTQFKDKSARHGADRAT 126

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GLF YP+L  ADILLY+A HVPVGEDQRQH+E+TR +A RFN  F              
Sbjct: 127 VGLFTYPILQVADILLYQANHVPVGEDQRQHIELTRDLADRFNGRFGET----------- 175

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F + E  I     +I  L+D + KMSKS S+    ++LLD P + AKKI+ A 
Sbjct: 176 -------FTVPEAYIVKETGKIYDLQDPTIKMSKSASTPKGIVSLLDEPKVSAKKIKSAV 228

Query: 248 TDGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
           TD   L +E+    E +    NL+ I++T+    I E   ++ GK +   K  L++ ++E
Sbjct: 229 TD---LETEIRYDEEKKPGVSNLLTIYSTLTGTSIPELESRYEGKGYGALKTELSEVLVE 285

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRAR 337
            + P  ++ Q  L D + LD IL +GA +AR
Sbjct: 286 WVTPFRERTQEYLADPATLDGILAKGAEKAR 316


>gi|227326814|ref|ZP_03830838.1| tryptophanyl-tRNA synthetase [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 334

 Score =  245 bits (625), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 137/350 (39%), Positives = 204/350 (58%), Gaps = 21/350 (6%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  +  SG QP+G L +GNY+G +R  +  Q+  ++  +Y I DLHAIT     + LR  
Sbjct: 2   SKPIVFSGAQPSGELTIGNYMGALRQWVNMQD--DYDCIYCIVDLHAITVRQDPQALRKA 59

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           +   +A +LA G+DP ++ IF QS V  H+ LSWIL+C A  G ++ M QFK+KS    E
Sbjct: 60  TLDTLALYLACGIDPKKSTIFVQSHVPEHSQLSWILNCYAYFGELSRMTQFKDKSAR-YE 118

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
           E  + GLF YPVLMAADILLY+   VPVGEDQ+QHLE++R + QRFN+ +          
Sbjct: 119 ENINAGLFSYPVLMAADILLYQTNQVPVGEDQKQHLELSRDVGQRFNSLY---------- 168

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
                      F + E  I  S +R+ SL + +KKMSKSD +  + I LL++P  + KKI
Sbjct: 169 --------GDIFKVPEPFIPKSGARVMSLLEPTKKMSKSDDNRNNVIGLLEDPKAVVKKI 220

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           ++A TD D  P     ++N+    NL++I + +    I E  ++F G+ +   K A+ADA
Sbjct: 221 KRAMTDSDEPPVIRYDVKNKAGVSNLLDILSGVTGKPIPELEQEFNGQMYGHLKGAVADA 280

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           V   +  + ++      D+++L  I+ EGA++A  RAQET+K V + +G 
Sbjct: 281 VSGMLSELQERYHRYRNDEAFLQQIMREGADKASARAQETLKKVYDAIGF 330


>gi|254525995|ref|ZP_05138047.1| tryptophanyl-tRNA synthetase [Prochlorococcus marinus str. MIT
           9202]
 gi|221537419|gb|EEE39872.1| tryptophanyl-tRNA synthetase [Prochlorococcus marinus str. MIT
           9202]
          Length = 338

 Score =  245 bits (625), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 145/351 (41%), Positives = 203/351 (57%), Gaps = 29/351 (8%)

Query: 8   FVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
            +SGVQPTG LH+GN+LG I N +  QE   +     + DLHAIT +   + L   +   
Sbjct: 7   ILSGVQPTGDLHIGNWLGAINNWVTLQE--QYETFLCVVDLHAITASYNPKELSQNTIST 64

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A ++A G+DP+   IF QS +  H++L WIL+C+  + WM  MIQFKEKS + +    S
Sbjct: 65  AALYVACGIDPNICSIFVQSQISAHSELCWILNCMTPINWMERMIQFKEKSIQ-QGNNVS 123

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIA-QRFNTEFERKIKEVAQKYAQ 186
           +GLF YP+LMAADILLY A  VPVGEDQ+QHLE+ R IA QR N  F +           
Sbjct: 124 IGLFDYPILMAADILLYEADFVPVGEDQKQHLELARDIAQQRINARFSK----------- 172

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                K    I + +I  + S+I SL D SKKMSKSD ++ SRINLLD P+II KKI++A
Sbjct: 173 ----DKNILKIPQPIIMKNGSKIMSLLDGSKKMSKSDLNEGSRINLLDPPEIITKKIKRA 228

Query: 247 KTDGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALAD 302
           K+D  +      G+E     R E+KNL+ I++ +   +I +    F    +  FK  + +
Sbjct: 229 KSDSYI------GIEFNNPERPESKNLLMIYSILSGKEISQCENDFSETGWGTFKNLITE 282

Query: 303 AVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            +IE + PI +K + L+ D   L+ IL EG  +A   A +T+K V   +G 
Sbjct: 283 KLIESLEPIQKKYKLLINDPYELNKILDEGKEKAEELANQTLKRVKSKLGF 333


>gi|196006329|ref|XP_002113031.1| hypothetical protein TRIADDRAFT_25667 [Trichoplax adhaerens]
 gi|190585072|gb|EDV25141.1| hypothetical protein TRIADDRAFT_25667 [Trichoplax adhaerens]
          Length = 329

 Score =  245 bits (625), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 138/347 (39%), Positives = 194/347 (55%), Gaps = 26/347 (7%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQ--ENLRYQS 64
           +  SG+QPT   H+GNYLG I+  I  Q+T   L +Y I DLHA+T+ + Q  +++ Y  
Sbjct: 1   VIFSGIQPTSKPHIGNYLGAIKRWIELQDTPAQL-IYCIVDLHALTS-VYQNPDSVSYTI 58

Query: 65  RLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEE 124
           +    S LA G+DP+R I+F+QS +  HA+LSW+LSC+  +GW+  M Q+K +   N   
Sbjct: 59  KELTLSLLACGLDPTRCILFQQSQIPQHAELSWMLSCLTPIGWLTRMTQWKSQGLSNNN- 117

Query: 125 TASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKY 184
              +G+  YPVLMAADILLY+ THVPVG+DQ QHLE+T+ + + FN  ++        +Y
Sbjct: 118 -VHVGMLTYPVLMAADILLYKTTHVPVGDDQVQHLELTKTLVRTFNKRYD-------CQY 169

Query: 185 AQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQ 244
                   G  P           R+++LR   +KMSKSD S  SRI L D PD I  KI+
Sbjct: 170 LTSPNVIMGDVP-----------RVKNLRSPDQKMSKSDKSILSRIELTDQPDEIRNKIK 218

Query: 245 KAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           +A TD +   S    L  R    NL+ +F+   Q  +EE  KQF G N  QFK ALAD +
Sbjct: 219 RAVTDSNSAISYDPDL--RPGVSNLVTLFSAFNQCTVEETCKQFEGSNTEQFKEALADVI 276

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIV 351
           I  + PI +    L  +  Y+D +L EG  +A   A   M  +  I+
Sbjct: 277 ITCLKPIREAAYKLQNEHGYIDLVLKEGREKALEIAANNMNKIKSII 323


>gi|15603486|ref|NP_246560.1| tryptophanyl-tRNA synthetase [Pasteurella multocida subsp.
           multocida str. Pm70]
 gi|13431912|sp|P57956|SYW_PASMU RecName: Full=Tryptophanyl-tRNA synthetase; AltName:
           Full=Tryptophan--tRNA ligase; Short=TrpRS
 gi|12722021|gb|AAK03705.1| TrpS [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 333

 Score =  245 bits (625), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 138/350 (39%), Positives = 201/350 (57%), Gaps = 21/350 (6%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  + +SGVQP+G L +GNYLG +R  ++ Q+  ++  ++ I DLHAIT     E+LR  
Sbjct: 2   SKPVVLSGVQPSGELTIGNYLGALRQWVKMQD--DYECLFCIVDLHAITVRQDPESLRKA 59

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           +   +A +LA G+DP ++ IF QS V  H  L+W+L+C    G M  M QFK+KS  + E
Sbjct: 60  TLDVLALYLACGIDPEKSTIFIQSHVPEHTQLAWVLNCYTYFGEMGRMTQFKDKSARHAE 119

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
              ++GLF YPVLMAADILLY+A  VPVGEDQ+QHLEITR IA RFN  +          
Sbjct: 120 NI-NVGLFTYPVLMAADILLYQANQVPVGEDQKQHLEITRDIANRFNALY---------- 168

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
                      F + E  I  + +R+ SL +  KKMSKSD +  + I LL++P  +AKKI
Sbjct: 169 --------GDLFAVPEPFIPKAGARVMSLLEPEKKMSKSDENRNNVIGLLEDPKAVAKKI 220

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           ++A TD D  P     ++N+    NL++I + +    I E   +F GK +   K  +AD 
Sbjct: 221 KRAVTDSDEPPVVRYDVQNKAGVSNLLDILSGVTGKSIAELETEFEGKMYGHLKGTVADE 280

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           V   +  + ++  H   +++ L+ I  EGA +AR RA+ T+  V + VG 
Sbjct: 281 VSAMLTTLQERFHHFRNNEALLNDIAREGAQKARERAKATLDAVYQAVGF 330


>gi|157413015|ref|YP_001483881.1| tryptophanyl-tRNA synthetase [Prochlorococcus marinus str. MIT
           9215]
 gi|157387590|gb|ABV50295.1| Tryptophanyl-tRNA synthetase [Prochlorococcus marinus str. MIT
           9215]
          Length = 342

 Score =  245 bits (625), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 145/351 (41%), Positives = 203/351 (57%), Gaps = 29/351 (8%)

Query: 8   FVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
            +SGVQPTG LH+GN+LG I N +  QE   +     + DLHAIT +   + L   +   
Sbjct: 7   ILSGVQPTGDLHIGNWLGAINNWVTLQE--QYETFLCVVDLHAITASYNPKELSQNTIST 64

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A ++A G+DP+   IF QS +  H++L WIL+C+  + WM  MIQFKEKS + +    S
Sbjct: 65  AALYVACGIDPNICSIFVQSQISAHSELCWILNCMTPINWMERMIQFKEKSIQ-QGNNVS 123

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIA-QRFNTEFERKIKEVAQKYAQ 186
           +GLF YP+LMAADILLY A  VPVGEDQ+QHLE+ R IA QR N  F +           
Sbjct: 124 IGLFDYPILMAADILLYDADFVPVGEDQKQHLELARDIAQQRINARFSK----------- 172

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                K    I + +I  + S+I SL D SKKMSKSD ++ SRINLLD P+II KKI++A
Sbjct: 173 ----DKNILKIPQPIIMKNGSKIMSLLDGSKKMSKSDLNEGSRINLLDAPEIITKKIKRA 228

Query: 247 KTDGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALAD 302
           K+D  +      G+E     R E+KNL+ I++ +   +I +    F    +  FK  + +
Sbjct: 229 KSDSYI------GIEFNNPERPESKNLLMIYSILSGKEISQCENDFSETGWGTFKNLITE 282

Query: 303 AVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            +IE + PI +K + L+ D   L+ IL EG  +A   A +T+K V   +G 
Sbjct: 283 KLIESLEPIQKKYKLLINDPYQLNKILDEGKEKAEDLANQTLKRVKTKLGF 333


>gi|331090981|ref|ZP_08339823.1| tryptophanyl-tRNA synthetase [Lachnospiraceae bacterium 2_1_46FAA]
 gi|330405203|gb|EGG84739.1| tryptophanyl-tRNA synthetase [Lachnospiraceae bacterium 2_1_46FAA]
          Length = 334

 Score =  245 bits (625), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 134/353 (37%), Positives = 207/353 (58%), Gaps = 24/353 (6%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENL 60
           M++   +  SG+Q TG L LGNYLG ++N I   +   +   Y + D+H+IT       L
Sbjct: 1   MINDKKVLFSGMQATGNLTLGNYLGALKNWITLSD--EYECFYSVVDMHSITVRQDPATL 58

Query: 61  RYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKE 120
           R ++R  +  ++AAG+DP +N I+ QS V  HA+L+WIL+C   MG +N M QFK+K+ +
Sbjct: 59  RKRARALLTLYIAAGLDPEKNCIYYQSHVSGHAELAWILNCYTYMGELNRMTQFKDKAAK 118

Query: 121 NKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEV 180
           + +   + GLF YPVLMAADILL++A  VPVG DQ QHLE+TR IAQRFN  +       
Sbjct: 119 HADNINA-GLFTYPVLMAADILLFQADVVPVGIDQMQHLELTRDIAQRFNGIY------- 170

Query: 181 AQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIA 240
                         F + E  I    ++I SL++ +KKMSKSD +    I L+D+PD I 
Sbjct: 171 -----------GDVFTVPEAYIGKVGAKIMSLQEPTKKMSKSDENPNGSIYLMDDPDTIM 219

Query: 241 KKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLAL 300
           +K ++A TD +   +++   + +   KNLI+I+       ++E +K+F GK +  FK+A+
Sbjct: 220 RKCKRAVTDSE---AQILYRDEQPGVKNLIDIYRACTNKTVDEVVKEFDGKGYGDFKMAV 276

Query: 301 ADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            +AV+  + P+  ++  L KDK Y+D+I+   A +A   A +T++ V   VG 
Sbjct: 277 GEAVVSVLKPLQDEVARLEKDKGYIDSIIKNNAEKANYYATKTLRKVQRKVGF 329


>gi|331082981|ref|ZP_08332101.1| tryptophanyl-tRNA synthetase [Lachnospiraceae bacterium 6_1_63FAA]
 gi|330399976|gb|EGG79634.1| tryptophanyl-tRNA synthetase [Lachnospiraceae bacterium 6_1_63FAA]
          Length = 334

 Score =  245 bits (625), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 135/353 (38%), Positives = 208/353 (58%), Gaps = 24/353 (6%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENL 60
           M++   +  SG+Q TG L LGNYLG ++N +   +   +   Y + D+H+IT       L
Sbjct: 1   MINDKKVLFSGMQATGNLTLGNYLGALKNWVTLND--EYECFYSVVDMHSITVRQDPATL 58

Query: 61  RYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKE 120
           R ++R  +  ++AAG+DP +N I+ QS V  HA+L+WIL+C   MG +N M QFK+KS +
Sbjct: 59  RKRARALLTLYIAAGLDPKKNCIYYQSHVSGHAELAWILNCFTYMGELNRMTQFKDKSAK 118

Query: 121 NKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEV 180
           + +   + GLF YPVLMAADILLY+A  VPVG DQ QHLE+TR IA RFN  +       
Sbjct: 119 HADNINA-GLFTYPVLMAADILLYQADVVPVGIDQMQHLELTRDIATRFNNIY------- 170

Query: 181 AQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIA 240
                         F I E  I    ++I SL++ SKKMSKSD +  + I L+D+PD I 
Sbjct: 171 -----------GDVFTIPEAYIGKVGAKIMSLQEPSKKMSKSDENPNASIYLMDDPDTIM 219

Query: 241 KKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLAL 300
           +K ++A TD +     ++  + +   KNLI+I+        +EA+K+F GK + + K+A+
Sbjct: 220 RKCKRAVTDSEAC---IAYRDEQPGIKNLIDIYCACLNKTSQEAVKEFEGKGYGELKMAV 276

Query: 301 ADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            +AV+  + P+  ++  L K+K+Y+D+I+ E   +A+  A +T++ V   VG 
Sbjct: 277 GEAVVSVLKPLQDEVARLEKEKAYIDSIIKENGEKAQYFANKTLRKVQRKVGF 329


>gi|289705978|ref|ZP_06502352.1| tryptophan--tRNA ligase [Micrococcus luteus SK58]
 gi|289557315|gb|EFD50632.1| tryptophan--tRNA ligase [Micrococcus luteus SK58]
          Length = 360

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 143/358 (39%), Positives = 201/358 (56%), Gaps = 35/358 (9%)

Query: 3   SSDNLFVSGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLR 61
           S+ +  +SG+QP+   LHLGNYLG + N  R Q   +    +FI DLHAIT       L 
Sbjct: 26  SARHRVLSGMQPSADSLHLGNYLGALVNWERTQ--ADFEAFFFIPDLHAITVPQDPAALA 83

Query: 62  YQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKEN 121
            ++R+  A F+A G+DP R+ +F QS V  HA L+W+L+C+  MG    M QFK+KS + 
Sbjct: 84  ERTRVAAAQFIAGGIDPERSTLFVQSQVPEHAQLAWVLTCMTGMGEAMRMTQFKDKSAKQ 143

Query: 122 KEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVA 181
             + A +GL  YP+LMAADILLY+   VPVG+DQRQH+E+TR +AQRFN           
Sbjct: 144 GADAAGVGLLAYPMLMAADILLYQPHGVPVGDDQRQHVELTRDLAQRFN----------- 192

Query: 182 QKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAK 241
            +Y +      GF+P        + +RI  L+D + KMSKS +S    IN+L+ P   AK
Sbjct: 193 HRYGETFVVPTGFYP-------ETGARIYDLQDPTSKMSKSAASPNGLINILEEPKKTAK 245

Query: 242 KIQKAKTDGDVLPSEVSGLENRL--EAK----NLIEIFATMRQIKIEEALKQFGGKNFSQ 295
           KI+ A TD         G E R   EAK    NL+ I + +    I +  ++F GK +  
Sbjct: 246 KIKSAVTD--------DGTEVRFDREAKPGVSNLLTILSAVSGTPIPQLEEEFVGKMYGH 297

Query: 296 FKLALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            K+A+ADAV+E + P+ ++   LL D + LD IL  GA +AR  A   ++ V   VG 
Sbjct: 298 LKVAVADAVVERLAPVRERALALLDDPAELDRILAAGAEKARAVATPVLEDVYAKVGF 355


>gi|189183071|ref|YP_001936856.1| tryptophanyl-tRNA synthetase [Orientia tsutsugamushi str. Ikeda]
 gi|189179842|dbj|BAG39622.1| tryptophanyl-tRNA synthetase [Orientia tsutsugamushi str. Ikeda]
          Length = 335

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 139/348 (39%), Positives = 211/348 (60%), Gaps = 26/348 (7%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SG+Q TG  HLGNYLG I+  ++ Q       ++F+A+LH+IT +  QE+L+    +F 
Sbjct: 6   LSGIQVTGKQHLGNYLGSIQKWVQMQSKFQ--SIFFLANLHSITTS--QESLKLSESIFS 61

Query: 69  AS--FLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
           ++   LA G++P ++IIF QSDV  H++L+WIL+CV  +G +  M QFK+K+ +      
Sbjct: 62  SACMLLACGINPKQSIIFLQSDVKEHSELAWILNCVTPLGQLKRMTQFKDKATKCSSNNI 121

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           +LGL  YPVLMAAD+LLY+A  VPVG DQ+QHLE+ R I +  + +F             
Sbjct: 122 NLGLLAYPVLMAADVLLYQADLVPVGADQKQHLELVRDIVKIIHHKFN------------ 169

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F + E  ID +A +I SL+D  KKMSKSD SDFSRINL D+ DII +K+QKA
Sbjct: 170 ----DDTIFKLPELFIDHTAGKIMSLKDGRKKMSKSDISDFSRINLTDSQDIIFRKLQKA 225

Query: 247 KTDGDV-LPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVI 305
           KTD    +  + +G   R E  NLI IFA +      + +K++     ++FK  LA  +I
Sbjct: 226 KTDCYTQITYDPTG---RPEISNLINIFAALSNKTTNDIVKEYEYAELTKFKKDLAMLII 282

Query: 306 EEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + + PI ++  + + +  Y++ +L+ GAN+A+  A++T+  V +  GL
Sbjct: 283 DCLNPILKEYNNYMNNLDYVNQVLITGANQAKIIAEKTITKVKQKFGL 330


>gi|296138678|ref|YP_003645921.1| tryptophanyl-tRNA synthetase [Tsukamurella paurometabola DSM 20162]
 gi|296026812|gb|ADG77582.1| tryptophanyl-tRNA synthetase [Tsukamurella paurometabola DSM 20162]
          Length = 341

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 138/347 (39%), Positives = 200/347 (57%), Gaps = 25/347 (7%)

Query: 9   VSGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SG+QPT    HLGNYLG ++  +  Q+       YFI ++H IT     + LR ++   
Sbjct: 15  LSGIQPTSDSFHLGNYLGAVKQWVDLQDEFETF--YFIPNMHGITTPHDPKVLRERTVFA 72

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
           VA  LA GVDP R+ IF QS +  HA+LSW+LSC+   G  + M QFK+KS +N  +++S
Sbjct: 73  VAQLLALGVDPERSTIFVQSQIPEHAELSWVLSCITGFGEASRMTQFKDKSAKNGTDSSS 132

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GLF YP+LMAADILLYR   VPVGEDQRQHLE+TR +AQRFNT F++            
Sbjct: 133 VGLFTYPILMAADILLYRPQVVPVGEDQRQHLELTRNLAQRFNTRFKKT----------- 181

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F + E  I S  ++I  L++ + KMSKS  SD   I++LD P +IAK+++ A 
Sbjct: 182 -------FVVPEPYIVSGTAKIYDLQNPTAKMSKSAESDAGLISILDEPAVIAKRVKSAV 234

Query: 248 TDGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
           TD +    E+     N+    NL+ I +      +E+   ++ GK +   K  +ADA+++
Sbjct: 235 TDTE---REIRFDRANKPGVSNLLTIESAFTGASMEQLEAKYEGKGYGDLKADVADALVD 291

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
              P+  ++Q  L D++ L  IL +G  RAR  A  T+  V + VG 
Sbjct: 292 FATPLRGRVQEYLDDRTELGRILGQGRERARDIASRTLADVYDRVGF 338


>gi|282858100|ref|ZP_06267295.1| tryptophan--tRNA ligase [Pyramidobacter piscolens W5455]
 gi|282584022|gb|EFB89395.1| tryptophan--tRNA ligase [Pyramidobacter piscolens W5455]
          Length = 337

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 140/347 (40%), Positives = 206/347 (59%), Gaps = 24/347 (6%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           + +SG+QPTG+  LGNY+G +RN  + QE  ++   YFIADLH++T       LR Q+  
Sbjct: 12  VILSGIQPTGIFTLGNYIGAVRNWGKMQE--DYDCAYFIADLHSLTVRQEPAKLRKQTLD 69

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A  LA G+DP ++++F QS V  HA+LSWILSC +  G +  M QFK+KS ++ +   
Sbjct: 70  AFALLLACGIDPEKSLVFIQSHVHAHAELSWILSCYSMFGELARMTQFKDKSAKHVDNV- 128

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           + GLF YP LMAADILLY+A +VPVGEDQRQHLE TR +  RFN  +     EV      
Sbjct: 129 NAGLFTYPALMAADILLYQADYVPVGEDQRQHLEFTRDVVTRFNNIY----GEV------ 178

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F + +  I  + +RI SL++ +KKMSKSD++  + I++LD P+ I  K ++A
Sbjct: 179 --------FRMPDAYIPEAGARIMSLQEPTKKMSKSDTNVNAFISILDEPNAIVNKFKRA 230

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
            TD + +   V   E +    NL+ I++ +     E   + F GK +  FKLA+ +AV E
Sbjct: 231 VTDSETV---VCHREGKDGINNLMSIYSVVTGESYERIERDFAGKGYGDFKLAVGEAVAE 287

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           E+ PI +K   L  DK+ L+ +  +GA  A   A++T+  V + +GL
Sbjct: 288 ELRPIREKFAALTADKAALEALYRQGAETAAHIAEKTLGKVKKKLGL 334


>gi|159028858|emb|CAO90663.1| trpS [Microcystis aeruginosa PCC 7806]
          Length = 336

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 141/349 (40%), Positives = 194/349 (55%), Gaps = 27/349 (7%)

Query: 8   FVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
            +SGVQPTG LHLGNYLG IRN +  Q+  ++   + + DLHAIT       L   +   
Sbjct: 6   ILSGVQPTGNLHLGNYLGAIRNWVEGQQ--DYDNFFCVVDLHAITVPHNPATLAEDTLAI 63

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A +LA G+D     IF QS V  H +L+W+L+C+  + W+ +MIQFKEK+ +  E   +
Sbjct: 64  AALYLACGIDLEYATIFVQSHVKAHTELTWLLNCITPLNWLTDMIQFKEKAIKQGENVGT 123

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
            GL  YPVLMAADILLY A  VPVGEDQ+QHLE+TR IA R N  F              
Sbjct: 124 -GLLDYPVLMAADILLYDADKVPVGEDQKQHLELTRDIAVRINHLF-------------- 168

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
            Q  +    + + +I    +R+ SL D   KMSKSD S+ SRIN+LD+PD+IAKKI++ K
Sbjct: 169 GQPKQPILKLPDPMIRKEGARVMSLTDGRNKMSKSDPSEMSRINILDSPDVIAKKIKRCK 228

Query: 248 TDGDVLPSEVSGL----ENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           TD       V GL      R E  NL+ +++ +     E    +     + QFK  L + 
Sbjct: 229 TD------LVKGLTFDDPERPECHNLLTLYSILSGKSQEVVAGECADLGWGQFKPMLTEV 282

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVG 352
            IE + PI +K   + +DK YL T+L +G  +A   A +T+  V   +G
Sbjct: 283 TIESLQPIQEKYTEIREDKDYLATVLRQGRLKAEAVANQTLDRVKNAMG 331


>gi|304316918|ref|YP_003852063.1| tryptophanyl-tRNA synthetase [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302778420|gb|ADL68979.1| tryptophanyl-tRNA synthetase [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 327

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 144/345 (41%), Positives = 203/345 (58%), Gaps = 28/345 (8%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQPTG +H+GNYLG +R  ++ Q   ++  ++ I DLHA+T     E LR +S     
Sbjct: 6   SGVQPTGDIHIGNYLGAMRQFVKLQN--DYSCLFCIVDLHALTVPQDPETLRKKSIELAG 63

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LA G+DP + IIF QS V  H +L+W+L C+   G ++ M QFK+KSK   +ET S+G
Sbjct: 64  LYLAIGLDPKKVIIFVQSHVPEHPELAWLLQCMTYFGELSRMTQFKDKSK--GKETVSVG 121

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LMAADILLY    VPVG DQ+QHLE+TR IA RFN  F                
Sbjct: 122 LFTYPDLMAADILLYDTNFVPVGNDQKQHLELTRDIAIRFNNRFGET------------- 168

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                F + E +I  + SRI SL +  KKMSKS  + +S+INLLD P  I KKI +A TD
Sbjct: 169 -----FVVPEPMILKTGSRIMSLTEPDKKMSKSSENQYSKINLLDEPSQIKKKIMRAVTD 223

Query: 250 GD-VLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
            + V+  +    EN+    NL+ ++++   I IEEA  +F G+ +   K  LAD ++E +
Sbjct: 224 SENVIRYDP---ENKPGLSNLLTLYSSFTDISIEEAEARFKGQGYGTLKKELADVIVERL 280

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
             I    ++L  D +Y++ IL EGA +A   A+ T++ V + +GL
Sbjct: 281 SEIQNNYKNL--DLNYINEILKEGAEKASSIAKVTIERVKDKMGL 323


>gi|306820715|ref|ZP_07454342.1| tryptophan--tRNA ligase [Eubacterium yurii subsp. margaretiae ATCC
           43715]
 gi|304551214|gb|EFM39178.1| tryptophan--tRNA ligase [Eubacterium yurii subsp. margaretiae ATCC
           43715]
          Length = 332

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 138/352 (39%), Positives = 211/352 (59%), Gaps = 24/352 (6%)

Query: 2   LSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLR 61
           + + N+  SGVQP+G L +GNYLG ++N ++ Q+  ++   Y I D HAIT   V ++LR
Sbjct: 1   MENKNIIFSGVQPSGELTIGNYLGALKNWVKLQD--DYKCYYCIVDEHAITVPQVPKDLR 58

Query: 62  YQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKEN 121
             +   +A ++A+G+D +++ +F QS V  HA L W+L+ +  MG ++ M Q+K+KS++ 
Sbjct: 59  KMTLDVLAKYIASGIDENKSCLFIQSHVAEHAQLMWVLNSITYMGELSRMTQYKDKSQK- 117

Query: 122 KEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVA 181
           K E  +  LF YPVLMAADILLY A  VPVGEDQRQHLEI R +A+RFN ++        
Sbjct: 118 KAENLNASLFTYPVLMAADILLYNANLVPVGEDQRQHLEIARDLAERFNNKYSET----- 172

Query: 182 QKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAK 241
                        F I +  +   ++RI SL+D SKKMSKSD +  S I++++  D+I  
Sbjct: 173 -------------FAIPDIYVSKESARIMSLQDPSKKMSKSDENPNSYISMVEEDDVINS 219

Query: 242 KIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALA 301
           KI+KA TD      +V+  + +L  KNLI I+        +E +K +  KN+ QFK  L+
Sbjct: 220 KIKKAVTDS---VGKVAYNDEQLALKNLINIYCAYSNKTPDEVVKDYESKNYGQFKADLS 276

Query: 302 DAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + VIE I PI ++ + L+ +K +L+ I  +GA  AR  A++ +K V   +G 
Sbjct: 277 EVVIEGIRPIRERYKELINNKDHLEKIYKKGAEEARYTARKMIKKVYRKIGF 328


>gi|110802893|ref|YP_697927.1| tryptophanyl-tRNA synthetase [Clostridium perfringens SM101]
 gi|110683394|gb|ABG86764.1| tryptophanyl-tRNA synthetase [Clostridium perfringens SM101]
          Length = 332

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 135/354 (38%), Positives = 212/354 (59%), Gaps = 26/354 (7%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYF-IADLHAITNNIVQEN 59
           M     +  SG++P+G L LGNYLG I+N  + QE  +    YF + DLHAIT   +  +
Sbjct: 1   MEDKKKIIFSGIKPSGDLTLGNYLGAIKNWTKLQEEYD---CYFCVVDLHAITVKQLPAD 57

Query: 60  LRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSK 119
           LR ++   +A ++A+G++P +N +F QS V  H++ SW+L+C + MG ++ M Q+K+KSK
Sbjct: 58  LRRRTLEVLAIYIASGINPEKNTLFIQSHVPAHSEASWLLTCNSYMGELSRMTQYKDKSK 117

Query: 120 ENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKE 179
           +  +   + GLF YPVLMAADILLY A  VPVG+DQ QHLE+ R I  RFN  + +    
Sbjct: 118 KMGDSIGA-GLFNYPVLMAADILLYNADLVPVGKDQMQHLELARDIGTRFNNSYSKT--- 173

Query: 180 VAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDII 239
                          F I EG +    ++I  L+D SKKMSKSD++    I ++D P++I
Sbjct: 174 ---------------FTIPEGYVPKEGAKIMDLQDPSKKMSKSDANPNGFILIMDEPNVI 218

Query: 240 AKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLA 299
            KKI +A TD   +   V+  + +   KNLI I   ++    EE +K + GK +++FK  
Sbjct: 219 RKKISRAVTDSIGV---VNYTDEQPGVKNLINILCAIKGYTPEEVVKMYDGKGYAEFKND 275

Query: 300 LADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           +A+A++EE+ P+ +K++ LL +K  L+ I  +GA +A   A +T++ + + +GL
Sbjct: 276 VAEAIVEELAPVQEKVKALLGNKKALEEIYKKGAEKANYAAMKTLRKMQKKIGL 329


>gi|157114308|ref|XP_001658036.1| tryptophanyl-tRNA synthetase [Aedes aegypti]
 gi|108877377|gb|EAT41602.1| tryptophanyl-tRNA synthetase [Aedes aegypti]
          Length = 375

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 142/346 (41%), Positives = 200/346 (57%), Gaps = 24/346 (6%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQPTG LH+GNYLG I+  +  Q     +  Y I DLH+IT     E LR  S    A
Sbjct: 36  SGVQPTGALHIGNYLGAIKRWVDLQNAGEDV-TYCIVDLHSITLPQDPEVLRQNSLQMAA 94

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           + LA G+DPS+  +F QS V  HA+LSWIL C+  M  + ++ Q+KEKS + KE    LG
Sbjct: 95  TLLACGIDPSKATLFLQSGVPQHAELSWILGCMTTMARLTHLPQYKEKSGKLKE--VPLG 152

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L++YPVL AADI+LY+ATHVPVGEDQ QHL++ + +A+ FN  F                
Sbjct: 153 LYIYPVLQAADIMLYKATHVPVGEDQIQHLQMAQSLARAFNNRFGTTFPSC--------- 203

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                 PII    D ++ R++SLRD +KKMSKSD    + I L D+P  I +K++K+ TD
Sbjct: 204 -----HPIIS---DDTSCRVKSLRDPTKKMSKSDPDPKACIMLTDSPKAIIEKLKKSVTD 255

Query: 250 GDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
                SEV+   E+R    NLI I + +     ++  +   G N  Q+K  +ADAV+E +
Sbjct: 256 ---FTSEVTFDPESRPGVANLITIHSLVSGSTPQQICEAAKGLNTGQYKQHVADAVVEHL 312

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
            PI   I+  + D  YL  ++ EG  RA+  A++T+  V + VG++
Sbjct: 313 NPIRDNIERYMADPDYLAGVIEEGCERAKAIAEKTLIEVKDKVGMN 358


>gi|24638226|sp|Q97LD6|SYW_CLOAB RecName: Full=Tryptophanyl-tRNA synthetase; AltName:
           Full=Tryptophan--tRNA ligase; Short=TrpRS
 gi|325508041|gb|ADZ19677.1| tryptophanyl-tRNA synthetase [Clostridium acetobutylicum EA 2018]
          Length = 335

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 134/353 (37%), Positives = 211/353 (59%), Gaps = 23/353 (6%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENL 60
           M  +  +  SG+QP+G L +GNY G I+N ++ Q+   +   Y I DLHAIT     ++L
Sbjct: 1   MGENKKVIFSGIQPSGELTIGNYFGAIKNWVKLQD--EYDCYYCIVDLHAITVKQEAKDL 58

Query: 61  RYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKE 120
           R ++   +A+++A+G+DP +N IF QS V  H    WIL+C++ +G ++ M QFK+KSK+
Sbjct: 59  RRRTLQLIATYIASGIDPEKNTIFIQSHVPAHVQAQWILNCMSYVGELSRMTQFKDKSKK 118

Query: 121 NKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEV 180
            ++     GL  YPVLMAADIL+Y+A  VPVG+DQ QH+E+TR +AQRFN+ +       
Sbjct: 119 YEDTGIGAGLLNYPVLMAADILIYQADLVPVGKDQTQHIELTRDLAQRFNSTYSET---- 174

Query: 181 AQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIA 240
                         F I EG I +  ++I SL++  KKMSKS  +  S I ++D P++I 
Sbjct: 175 --------------FKIPEGYIPTGGAKIMSLQEPLKKMSKSSDNPNSFILIMDPPEVIK 220

Query: 241 KKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLAL 300
           +KI +A TD   +   V   +++   KNL+ I +    + +++   ++ G+ +S+FK  +
Sbjct: 221 RKIARAVTDNVGV---VKYTDDQPGVKNLMNIMSCCTGMSVKDIEDKYEGQGYSKFKEDV 277

Query: 301 ADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           ADA+I+E+ PI  K+  LLKDK+YL  I  +GA +A   A +T+  +   VG 
Sbjct: 278 ADALIQELEPIQNKVNELLKDKAYLQDICKKGAQKASYIANKTVSKMMRKVGF 330


>gi|117927599|ref|YP_872150.1| tryptophanyl-tRNA synthetase [Acidothermus cellulolyticus 11B]
 gi|117648062|gb|ABK52164.1| tryptophanyl-tRNA synthetase [Acidothermus cellulolyticus 11B]
          Length = 340

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 142/347 (40%), Positives = 194/347 (55%), Gaps = 28/347 (8%)

Query: 9   VSGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SG+QPT    HLGNYLG +R+ +  Q+T  H   Y + DLHA+T   V E LR ++R+ 
Sbjct: 15  LSGIQPTADSFHLGNYLGALRHWVALQDT--HDAFYCVVDLHALTLEWVPEQLRARTRIA 72

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A  LA G+DPSR  +F QS V  H +L+WI  C+   G  + M QFK+K+  ++ E   
Sbjct: 73  AAQLLAIGLDPSRCTLFIQSHVPEHTELAWIFGCLTGYGEASRMTQFKDKA--SRSEHVG 130

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GLF YP+L AADI LY A  VPVGEDQRQHLE+TR + QRFN  F              
Sbjct: 131 VGLFTYPILQAADIALYHADLVPVGEDQRQHLELTRNLTQRFNARFGPT----------- 179

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F + E  I     +I  L+  + KMSKS   +   + LLD P  +AKKI+ A 
Sbjct: 180 -------FTVPEPYIVGETRKIADLQHPTAKMSKS-LPEAGTLYLLDEPRRLAKKIRSAV 231

Query: 248 TDGDVLPSEVSGLE-NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
           TD     +E+   E N+    NL+ IF+ +    I +    + GK +  FK  LAD V+E
Sbjct: 232 TDSG---TEIRADEVNKPGITNLLRIFSALTGRDIAQLEDDYAGKGYGTFKSDLADVVVE 288

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            +VPI ++++  L D   LD +L EGA+RAR  A ETM+ V + VG 
Sbjct: 289 FVVPIQERVRRYLDDPDTLDAVLTEGADRARAVAAETMETVRDRVGF 335


>gi|258512313|ref|YP_003185747.1| tryptophanyl-tRNA synthetase [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|257479039|gb|ACV59358.1| tryptophanyl-tRNA synthetase [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
          Length = 327

 Score =  244 bits (623), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 145/346 (41%), Positives = 200/346 (57%), Gaps = 27/346 (7%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SG+QP+G L +GNYLG IRN ++ Q+  + L  + + D+HAIT     E LR+ +R   
Sbjct: 5   LSGIQPSGTLTIGNYLGAIRNFVKLQDEADCL--FCVVDMHAITVPQDPEALRHNTRAVA 62

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA+G+DP +  +F QS V  HA+L WIL C    G +  M QFK+KS  ++ E  + 
Sbjct: 63  ALYLASGIDPEKATVFVQSHVPQHAELGWILQCFTYHGELERMTQFKDKS--SRHEVVTA 120

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GLF YPVLMAADILLY A  VPVGEDQ+QHLE+TR +A RFN  F               
Sbjct: 121 GLFTYPVLMAADILLYNAHLVPVGEDQKQHLELTRDVAGRFNRRF--------------- 165

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                 F + E  I     RI SL +  KKMSKSD S  + I++LD+PD I +KI +A T
Sbjct: 166 ---GDTFVVPEPYIPEIGGRIMSLENPEKKMSKSDESANAYISMLDDPDTIRRKIGRAVT 222

Query: 249 DGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
           D +    EV    E +    NL+ I+A    + +E+  ++FGG+ +  FK  LA+ VIE 
Sbjct: 223 DSE---REVRFDPERKPAVSNLMTIYALCADVSLEDVERRFGGQGYGPFKKELAEVVIER 279

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + PI  + Q ++   S LD +L +GA RAR  A  T++ V   VG 
Sbjct: 280 LAPIQARYQEVMA-SSELDDVLRKGAERARELAAATLRDVQRKVGF 324


>gi|15893914|ref|NP_347263.1| tryptophanyl-tRNA synthetase [Clostridium acetobutylicum ATCC 824]
 gi|15023498|gb|AAK78603.1|AE007578_1 Tryptophan-tRNA synthetase, trpS [Clostridium acetobutylicum ATCC
           824]
          Length = 343

 Score =  244 bits (623), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 134/353 (37%), Positives = 211/353 (59%), Gaps = 23/353 (6%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENL 60
           M  +  +  SG+QP+G L +GNY G I+N ++ Q+   +   Y I DLHAIT     ++L
Sbjct: 9   MGENKKVIFSGIQPSGELTIGNYFGAIKNWVKLQD--EYDCYYCIVDLHAITVKQEAKDL 66

Query: 61  RYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKE 120
           R ++   +A+++A+G+DP +N IF QS V  H    WIL+C++ +G ++ M QFK+KSK+
Sbjct: 67  RRRTLQLIATYIASGIDPEKNTIFIQSHVPAHVQAQWILNCMSYVGELSRMTQFKDKSKK 126

Query: 121 NKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEV 180
            ++     GL  YPVLMAADIL+Y+A  VPVG+DQ QH+E+TR +AQRFN+ +       
Sbjct: 127 YEDTGIGAGLLNYPVLMAADILIYQADLVPVGKDQTQHIELTRDLAQRFNSTYSET---- 182

Query: 181 AQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIA 240
                         F I EG I +  ++I SL++  KKMSKS  +  S I ++D P++I 
Sbjct: 183 --------------FKIPEGYIPTGGAKIMSLQEPLKKMSKSSDNPNSFILIMDPPEVIK 228

Query: 241 KKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLAL 300
           +KI +A TD   +   V   +++   KNL+ I +    + +++   ++ G+ +S+FK  +
Sbjct: 229 RKIARAVTDNVGV---VKYTDDQPGVKNLMNIMSCCTGMSVKDIEDKYEGQGYSKFKEDV 285

Query: 301 ADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           ADA+I+E+ PI  K+  LLKDK+YL  I  +GA +A   A +T+  +   VG 
Sbjct: 286 ADALIQELEPIQNKVNELLKDKAYLQDICKKGAQKASYIANKTVSKMMRKVGF 338


>gi|113460323|ref|YP_718384.1| tryptophanyl-tRNA synthetase [Haemophilus somnus 129PT]
 gi|112822366|gb|ABI24455.1| tryptophanyl-tRNA synthetase [Haemophilus somnus 129PT]
          Length = 333

 Score =  244 bits (623), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 138/347 (39%), Positives = 198/347 (57%), Gaps = 21/347 (6%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           + +SGVQP+G L +GNYLG +R  +  Q+   +  +Y I DLHAIT     + LR  +  
Sbjct: 5   VVLSGVQPSGELTIGNYLGALRQWVNMQD--EYECLYCIVDLHAITVRQDPDTLRKATLD 62

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
            +A +LA G+DP ++ IF QS +  H  L+WIL+C    G M+ M QFK+KS  + +   
Sbjct: 63  VLALYLACGIDPEKSTIFIQSHIPEHTQLAWILNCYTYFGEMSRMTQFKDKSARHADNI- 121

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           ++GLF YPVLMAADILLY+A  VPVGEDQRQHLEITR IAQRFN  +             
Sbjct: 122 NVGLFTYPVLMAADILLYQANQVPVGEDQRQHLEITRDIAQRFNALYGEH---------- 171

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F + E  I  + +R+ SL +  KKMSKSD +  + I LL++P  + KKI++A
Sbjct: 172 --------FIVPEAFIPKAGARVMSLLEPEKKMSKSDENRNNVIGLLEDPKAVVKKIKRA 223

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
            TD D  P     ++N+    NL++I + +    I +   +F GK +   K A+AD V  
Sbjct: 224 VTDSDEPPVVRYDVKNKAGVSNLLDILSGVTGKSIVQLEAEFEGKMYGHLKSAVADEVAT 283

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            +  + ++  H   ++  L+ I  EGA +AR RA+ET+  V   VG 
Sbjct: 284 MLTTLQERFYHFRNNEELLNKIAAEGAEKARKRAKETLDKVYRAVGF 330


>gi|260589555|ref|ZP_05855468.1| tryptophan--tRNA ligase [Blautia hansenii DSM 20583]
 gi|260540123|gb|EEX20692.1| tryptophan--tRNA ligase [Blautia hansenii DSM 20583]
          Length = 334

 Score =  244 bits (623), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 135/353 (38%), Positives = 207/353 (58%), Gaps = 24/353 (6%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENL 60
           M++   +  SG+Q TG L LGNYLG ++N +   +   +   Y + D+H+IT       L
Sbjct: 1   MINDKKVLFSGMQATGNLTLGNYLGALKNWVTLND--EYECFYSVVDMHSITVRQDPATL 58

Query: 61  RYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKE 120
           R ++R  +  ++AAG+DP +N I+ QS V  HA+L+WIL+C   MG +N M QFK+K+ +
Sbjct: 59  RKRARALLTLYIAAGLDPKKNCIYYQSHVSGHAELAWILNCFTYMGELNRMTQFKDKAAK 118

Query: 121 NKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEV 180
           + +   + GLF YPVLMAADILLY+A  VPVG DQ QHLE+TR IA RFN  +       
Sbjct: 119 HADNINA-GLFTYPVLMAADILLYQADVVPVGIDQMQHLELTRDIATRFNNIY------- 170

Query: 181 AQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIA 240
                         F I E  I    ++I SL++ SKKMSKSD +    I L+D+PD I 
Sbjct: 171 -----------GDVFTIPEAYIGKVGAKIMSLQEPSKKMSKSDENPNGSIYLMDDPDTIM 219

Query: 241 KKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLAL 300
           +K ++A TD +     ++  + +   KNLI+I+        +EA+K+F GK + + K+A+
Sbjct: 220 RKCKRAVTDSEAC---IAYRDEQPGIKNLIDIYCACLNKTSQEAVKEFEGKGYGELKMAV 276

Query: 301 ADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            +AV+  + P+  ++  L K+K+YLD+I+ E   +A+  A +T++ V   VG 
Sbjct: 277 GEAVVSVLKPLQDEVARLEKEKAYLDSIIKENGEKAQYFANKTLRKVQRKVGF 329


>gi|18309615|ref|NP_561549.1| tryptophanyl-tRNA synthetase [Clostridium perfringens str. 13]
 gi|20178125|sp|Q8XMQ5|SYW_CLOPE RecName: Full=Tryptophanyl-tRNA synthetase; AltName:
           Full=Tryptophan--tRNA ligase; Short=TrpRS
 gi|18144292|dbj|BAB80339.1| tryptophan-tRNA ligase [Clostridium perfringens str. 13]
          Length = 332

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 135/354 (38%), Positives = 211/354 (59%), Gaps = 26/354 (7%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYF-IADLHAITNNIVQEN 59
           M     +  SG++P+G L LGNYLG I+N  + QE  +    YF + DLHAIT   +  +
Sbjct: 1   MEDKKKIIFSGIKPSGDLTLGNYLGAIKNWTKLQEEYD---CYFCVVDLHAITVKQLPAD 57

Query: 60  LRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSK 119
           LR ++   +A ++A+G++P  N +F QS V  H++ SW+L+C + MG ++ M Q+K+KSK
Sbjct: 58  LRRRTLEVLAIYIASGINPEENTLFIQSHVPAHSEASWLLTCNSYMGELSRMTQYKDKSK 117

Query: 120 ENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKE 179
           +  +   + GLF YPVLMAADILLY A  VPVG+DQ QHLE+ R I  RFN  + +    
Sbjct: 118 KMGDSIGA-GLFNYPVLMAADILLYNADLVPVGKDQMQHLELARDIGTRFNNSYSKT--- 173

Query: 180 VAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDII 239
                          F I EG +    ++I  L+D SKKMSKSD++    I ++D P++I
Sbjct: 174 ---------------FTIPEGYVPKEGAKIMDLQDPSKKMSKSDANPNGFILIMDEPNVI 218

Query: 240 AKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLA 299
            KKI +A TD   +   V+  + +   KNLI I   ++    +E +K + GK +++FK  
Sbjct: 219 RKKISRAVTDSIGI---VNYTDEQPGVKNLINILCAIKGYTPDEVVKMYDGKGYAEFKND 275

Query: 300 LADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           +A+A++EE+ P+ +K++ LL DK  L+ I  +GA +A   A +T++ + + +GL
Sbjct: 276 VAEAIVEELAPVQEKVKALLGDKKALEEIYKKGAEKANYAAMKTLRKMQKKIGL 329


>gi|221133681|ref|ZP_03559986.1| tryptophanyl-tRNA synthetase [Glaciecola sp. HTCC2999]
          Length = 334

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 135/350 (38%), Positives = 202/350 (57%), Gaps = 21/350 (6%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  + +SG QP+G L +GNY G ++  +  Q T  H  +Y I DLHAIT     E L+  
Sbjct: 2   SKPIVLSGCQPSGQLTIGNYFGALKQWVAMQAT--HDCLYMIVDLHAITVRQDPEALKNA 59

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
               +A +LA G+DP ++ IF QS V  HA L+W+L+C  +MG +N M QFK+KS +N E
Sbjct: 60  CLDGLALYLACGIDPKQSTIFMQSHVPEHAQLAWVLNCYTQMGELNRMTQFKDKSAKN-E 118

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
              ++GL+ YPVL AADILLY+A  VPVGEDQ+QHLE+TR IA RFN  +   +      
Sbjct: 119 SNINVGLYSYPVLQAADILLYQANEVPVGEDQKQHLELTRDIATRFNNAYGDTLT----- 173

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
                        I    I  S +R+ SL+D +KKMSKSD +  + + LL++P  I+KKI
Sbjct: 174 -------------IPNPHIPKSGARVMSLQDPNKKMSKSDENPNNFVGLLEDPKKISKKI 220

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           ++A TD D   +    +EN+    NL+ + +      I++ + Q+  K +   K  +A A
Sbjct: 221 KRAVTDSDEAANIYYDIENKAGVSNLLSLLSCTTGTAIDQLVPQYTDKMYGHLKGDVATA 280

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           V++ + PI  +   + +D++YLD ++  GA +A  RA +T+  V + VG 
Sbjct: 281 VVDMLTPIQTRFHAIREDQTYLDEVMKIGAEKASERAAKTLADVYKAVGF 330


>gi|124023565|ref|YP_001017872.1| tryptophanyl-tRNA synthetase [Prochlorococcus marinus str. MIT
           9303]
 gi|123963851|gb|ABM78607.1| Tryptophanyl-tRNA synthetase [Prochlorococcus marinus str. MIT
           9303]
          Length = 337

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 146/349 (41%), Positives = 202/349 (57%), Gaps = 28/349 (8%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQPTG LHLGN+LG IRN +  Q +  H     + DLHAIT     E L  ++    
Sbjct: 7   LSGVQPTGALHLGNWLGAIRNWVDLQSS--HDTYVCVVDLHAITVPHDPERLAEETLSTA 64

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+DP    IF QS V  H++L W+L+CV  + W+  MIQFKEKS + + +  S+
Sbjct: 65  ALYLACGMDPDLCSIFVQSQVSAHSELCWLLNCVTPLNWLERMIQFKEKSVK-QGDNVSV 123

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIA-QRFNTEFERKIKEVAQKYAQE 187
           GL  YPVLMAADILLY A  VPVGEDQ+QHLE+ R IA QR N  F  + K V +     
Sbjct: 124 GLLDYPVLMAADILLYDADLVPVGEDQKQHLELARDIAQQRINARFGSEEKPVLK----- 178

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                    + + LI    +R+ SL D   KMSKSD ++ SRI LLD P++I KKI++AK
Sbjct: 179 ---------VPDPLIIKEGARVMSLSDGRSKMSKSDPNEGSRITLLDPPELITKKIKRAK 229

Query: 248 TDGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           TD  +      GL+    +R EA NL+ I+A +     + A ++     +  FK  LADA
Sbjct: 230 TDPQM------GLQFGNPDRPEADNLLGIYAILSGRGRDAAAQECAEMGWGTFKPLLADA 283

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVG 352
            +  + PI  + Q L+ D+  L  +L +G   A+  AQ T++ V++ +G
Sbjct: 284 TVSALEPIQHRYQQLMGDRIELIRVLDQGRTTAQETAQATLQRVHQALG 332


>gi|255659118|ref|ZP_05404527.1| tryptophan--tRNA ligase [Mitsuokella multacida DSM 20544]
 gi|260848563|gb|EEX68570.1| tryptophan--tRNA ligase [Mitsuokella multacida DSM 20544]
          Length = 334

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 135/357 (37%), Positives = 208/357 (58%), Gaps = 31/357 (8%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENL 60
           M ++  + +SG+QPTGV  LGNYLG +R+  + QE  N    YFIADLH++T +I  +  
Sbjct: 1   MENNKKIILSGIQPTGVFTLGNYLGAVRSWKQMQEDYN--CYYFIADLHSMTIHIDPQKR 58

Query: 61  RYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKE 120
           R Q+R   A  LA G+DP ++++F QS    HA++ WI+ C ++ G ++ M QFK+KS +
Sbjct: 59  RQQTREAFALLLACGIDPEKSLVFVQSHNKCHAEMGWIMDCCSQFGELSRMTQFKDKSAK 118

Query: 121 NKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEV 180
           + +   + GLF YP LMA DILLY+A +VPVG DQ QHLE TR +A RFN          
Sbjct: 119 HPDNI-NAGLFTYPALMAGDILLYQADYVPVGADQTQHLEFTRDVATRFN---------- 167

Query: 181 AQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIA 240
              Y +  +  +G+FP        + +R+ SL+D + KMSKSD++  + I++LD+   I 
Sbjct: 168 -HTYGEVFKLPEGYFP-------KAGARVMSLQDPTSKMSKSDTNPKATISILDDEKTIL 219

Query: 241 KKIQKAKTDGDVL----PSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQF 296
           KK + A TD +      P    G+       NL+ I++ +    +EE   +F GK +  F
Sbjct: 220 KKFKSAVTDSEACVRFDPEAKPGVS------NLMTIYSAITGKTMEEIEAEFAGKGYGDF 273

Query: 297 KLALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           K A+  +V +E+ PI +    L++D++YL+  + +GA RA   A +T+  V + VGL
Sbjct: 274 KAAVGQSVADELRPIRENFARLMEDRAYLEEEMRKGAERATYIANKTLTKVKKRVGL 330


>gi|33861155|ref|NP_892716.1| tryptophanyl-tRNA synthetase [Prochlorococcus marinus subsp.
           pastoris str. CCMP1986]
 gi|39932080|sp|Q7V286|SYW_PROMP RecName: Full=Tryptophanyl-tRNA synthetase; AltName:
           Full=Tryptophan--tRNA ligase; Short=TrpRS
 gi|33639887|emb|CAE19057.1| Tryptophanyl-tRNA synthetase [Prochlorococcus marinus subsp.
           pastoris str. CCMP1986]
          Length = 338

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 141/346 (40%), Positives = 201/346 (58%), Gaps = 19/346 (5%)

Query: 8   FVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
            +SGVQPTG LH+GN+LG I N +  QE   H     + DLHAIT     + L   +   
Sbjct: 7   ILSGVQPTGDLHIGNWLGAINNWVELQE--KHETFLCVVDLHAITTEYDTKQLSKNTLST 64

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A ++A G++P    IF QS +  H++L WIL+C+  + WM  MIQFKEKS + +    S
Sbjct: 65  AALYIACGINPKICSIFVQSQISAHSELCWILNCMTPINWMERMIQFKEKSIQ-QGNNVS 123

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GLF YP+LMAADILLY A +VPVGEDQ+QHLE+ + IAQ+           +  K+ +E
Sbjct: 124 IGLFDYPILMAADILLYDADYVPVGEDQKQHLELAKDIAQQ----------RINAKFGKE 173

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
           E   K   PII        S+I SL D SKKMSKSD ++ SRINLLD P+II KKI++AK
Sbjct: 174 ENILKIPQPIIM----KKGSKIMSLNDGSKKMSKSDINEGSRINLLDTPEIITKKIKRAK 229

Query: 248 TDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
           +D   +  E +  E R E++NL+ I++ +   ++ E         +  FK    + +IE 
Sbjct: 230 SDS-YMGMEFNNPE-RPESRNLLMIYSLLSGKEVSELENDLSQTGWGTFKKIFTEQIIES 287

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + PI ++ Q L+ D   L+ IL++G  +A   A +T+  V   +G 
Sbjct: 288 LKPIQERYQVLINDPHELNKILIQGKEKAEVVANKTLSRVKSELGF 333


>gi|253690238|ref|YP_003019428.1| tryptophanyl-tRNA synthetase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251756816|gb|ACT14892.1| tryptophanyl-tRNA synthetase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 334

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 137/350 (39%), Positives = 202/350 (57%), Gaps = 21/350 (6%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  +  SG QP+G L +GNY+G +R  +  Q+  ++  +Y I DLHAIT     + LR  
Sbjct: 2   SKPIVFSGAQPSGELTIGNYMGALRQWVNMQD--DYDCIYCIVDLHAITVRQDPQALRKA 59

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           +   +A +LA G+DP ++ IF QS V  H+ LSWIL+C A  G ++ M QFK+KS    E
Sbjct: 60  TLDTLALYLACGIDPKKSTIFVQSHVPEHSQLSWILNCYAYFGELSRMTQFKDKSAR-YE 118

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
           E  + GLF YPVLMAADILLY+   VPVGEDQ+QHLE++R + QRFN+ +          
Sbjct: 119 ENINAGLFDYPVLMAADILLYQTNQVPVGEDQKQHLELSRDVGQRFNSLY---------- 168

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
                      F + E  I  S +R+ SL + +KKMSKSD +  + I LL++P  + KKI
Sbjct: 169 --------GDIFKVPEPFIPKSGARVMSLLEPTKKMSKSDDNRNNVIGLLEDPKAVVKKI 220

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           ++A TD D  P     + N+    NL++I + +    I E  ++F G+ +   K A+ADA
Sbjct: 221 KRAVTDSDEPPVVRYDVANKAGVSNLLDILSGVTGKSIPELEQEFNGQMYGHLKGAVADA 280

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           V   +  + ++      D+++L  ++ EGA +A  RAQET+K V + VG 
Sbjct: 281 VSGMLSELQERYHRFRNDEAFLQQVMREGAEKASARAQETLKKVYDAVGF 330


>gi|50123007|ref|YP_052174.1| tryptophanyl-tRNA synthetase [Pectobacterium atrosepticum SCRI1043]
 gi|49613533|emb|CAG76984.1| tryptophanyl-tRNA synthetase [Pectobacterium atrosepticum SCRI1043]
          Length = 334

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 138/350 (39%), Positives = 201/350 (57%), Gaps = 21/350 (6%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  +  SG QP+G L +GNY+G +R  +  Q+  ++  +Y I DLHAIT     + LR  
Sbjct: 2   SKPIVFSGAQPSGELTIGNYMGALRQWVNMQD--DYDCIYCIVDLHAITVRQDPQALRKA 59

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           +   +A +LA G+DP ++ IF QS V  H+ LSWIL+C A  G ++ M QFK+KS    E
Sbjct: 60  TLDTLALYLACGIDPKKSTIFVQSHVPEHSQLSWILNCYAYFGELSRMTQFKDKSAR-YE 118

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
           E  + GLF YPVLMAADILLY+   VPVGEDQ+QHLE++R + QRFN+ +          
Sbjct: 119 ENINAGLFSYPVLMAADILLYQTNQVPVGEDQKQHLELSRDVGQRFNSLY---------- 168

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
                      F + E  I  S +R+ SL + +KKMSKSD +  + I LL++P  + KKI
Sbjct: 169 --------GDIFKVPEPFIPKSGARVMSLLEPTKKMSKSDDNRNNVIGLLEDPKAVVKKI 220

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           ++A TD D  P     + N+    NL++I + +    I E   +F G+ +   K A+ADA
Sbjct: 221 KRAMTDSDEPPVVRYDVANKAGVSNLLDILSGVTGKSIPELELEFNGQMYGHLKGAVADA 280

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           V   +  + ++      D+++L  I+ EGA +A  RAQET+K V + VG 
Sbjct: 281 VSGMLSELQERYHRFRNDEAFLQQIMREGAEKASARAQETLKKVYDAVGF 330


>gi|260913444|ref|ZP_05919922.1| tryptophan-tRNA ligase [Pasteurella dagmatis ATCC 43325]
 gi|260632384|gb|EEX50557.1| tryptophan-tRNA ligase [Pasteurella dagmatis ATCC 43325]
          Length = 332

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 138/347 (39%), Positives = 200/347 (57%), Gaps = 21/347 (6%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           + +SGVQP+G L +GNYLG +R  ++ Q+  ++  ++ I DLHAIT       LR  +  
Sbjct: 5   VVLSGVQPSGELTIGNYLGALRQWVKMQD--DYECLFCIVDLHAITVRQDPAALRKATLD 62

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
            +A +LA G+DP ++ IF QS V  H  L+WIL+C    G M  M QFK+KS  + E   
Sbjct: 63  VLALYLACGIDPEKSTIFIQSHVPEHTQLAWILNCYTYFGEMGRMTQFKDKSARHAENI- 121

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           ++GLF YPVLMAADILLY+A  VPVGEDQ+QHLEITR IA RFN  +             
Sbjct: 122 NVGLFTYPVLMAADILLYQANQVPVGEDQKQHLEITRDIANRFNALY------------- 168

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F + E  I  + +R+ SL +  KKMSKSD +  + I LL++P  +AKKI++A
Sbjct: 169 -----GDLFAVPEPFIPKAGARVMSLLEPEKKMSKSDENRNNVIGLLEDPKAVAKKIKRA 223

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
            TD D  P     ++N+    NL++I + +    I E   +F GK +   K A+AD V  
Sbjct: 224 VTDSDEPPVVRYDVKNKAGVSNLLDILSGVTGKSISELEAEFEGKMYGHLKGAVADEVSA 283

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            ++ + ++  H   ++  L+ I  EGA +AR RA++T+  V + VG 
Sbjct: 284 MLITLQERFHHFRNNEELLNKIAREGAEKARERAKKTLDAVYQAVGF 330


>gi|282898065|ref|ZP_06306060.1| Tryptophanyl-tRNA synthetase, class Ib [Raphidiopsis brookii D9]
 gi|281197209|gb|EFA72110.1| Tryptophanyl-tRNA synthetase, class Ib [Raphidiopsis brookii D9]
          Length = 335

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 141/350 (40%), Positives = 195/350 (55%), Gaps = 28/350 (8%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQPTG LHLGNYLG IRN +  Q+  ++   + + DLHAIT       L   +    
Sbjct: 7   LSGVQPTGNLHLGNYLGAIRNWVEMQDQYDNF--FCVVDLHAITVPHNPATLAADTYTIA 64

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+D   + IF QS +  H++L W+L+C+  + W+ +MIQFKEK+ +  E   + 
Sbjct: 65  ALYLACGIDLQHSHIFVQSHISAHSELCWLLNCITPLNWLQDMIQFKEKAVKQGENVGT- 123

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GL +YPVLMAADILLY+A  VPVGEDQ+QHLE+ R I  RFN  F           AQE 
Sbjct: 124 GLLIYPVLMAADILLYQADKVPVGEDQKQHLELARDIVNRFNYLF-----------AQEH 172

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
              K   P    LI    +R+ SL D +KKMSKSD S+ SRIN+LD PD IA KI++ KT
Sbjct: 173 PVLKLPAP----LIRKEGARVMSLADGTKKMSKSDPSELSRINVLDPPDQIANKIKRCKT 228

Query: 249 DGDVLPSEVSGL----ENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           D       V GL      R E  NL+ ++  +     E    +     + QFK  L +  
Sbjct: 229 D------PVRGLSFDDPARPECNNLLTLYMLLSGKTKEAVAGECADMGWGQFKPLLTETT 282

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
           I  + PI +K + +  +K YL+++L  G  +A   A +T+  V   +G +
Sbjct: 283 INALEPIQKKYKEVRTEKGYLESVLKTGKEKAHAIASQTLADVKGALGYT 332


>gi|326792065|ref|YP_004309886.1| tryptophanyl-tRNA synthetase [Clostridium lentocellum DSM 5427]
 gi|326542829|gb|ADZ84688.1| tryptophanyl-tRNA synthetase [Clostridium lentocellum DSM 5427]
          Length = 335

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 137/354 (38%), Positives = 207/354 (58%), Gaps = 25/354 (7%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENL 60
           M     +  SG+QP+G++ LGNYLG ++N    Q+  N L  Y I D+HAIT       L
Sbjct: 1   MSEQKKVIFSGMQPSGIITLGNYLGALKNWTNLQDEYNCL--YCIVDMHAITVRQDPAVL 58

Query: 61  RYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKE 120
           R  +R  +  ++AAG+DP +NII+ QS V  HA+L+WIL+C   MG ++ M QFK+KS++
Sbjct: 59  RKNARELMMLYIAAGLDPEKNIIYMQSHVSAHAELAWILNCFTYMGELSRMTQFKDKSQK 118

Query: 121 NKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEV 180
           + +   + GLF YP LMAADILLY+A  VPVG DQRQHLE+TR IA RFN  +       
Sbjct: 119 HSDNINA-GLFTYPALMAADILLYQADLVPVGIDQRQHLELTRDIAIRFNNLYGDT---- 173

Query: 181 AQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIA 240
                         F + E  I    ++I SL+D +KKMSKSD+   + I+++D+ D I 
Sbjct: 174 --------------FKVPEAYIPKVGAKIMSLQDPTKKMSKSDTDVNASISIIDDTDTII 219

Query: 241 KKIQKAKTDGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLA 299
           +K ++A TD +   +EV    EN+    NL+ I+  +    +E+   +F GK +  FK+ 
Sbjct: 220 RKFKRAVTDSE---TEVRFDEENKPGVSNLMTIYGAITGQTMEQVTNEFAGKGYGDFKVK 276

Query: 300 LADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + +AV EE+ P+  + + L  DK+Y+D ++ + A  A   A +T++ V + VG 
Sbjct: 277 VGEAVAEELKPLQNRFKELSSDKAYIDGVIKKNAETASYLATKTLRKVQKKVGF 330


>gi|282883339|ref|ZP_06291933.1| tryptophan--tRNA ligase [Peptoniphilus lacrimalis 315-B]
 gi|281296843|gb|EFA89345.1| tryptophan--tRNA ligase [Peptoniphilus lacrimalis 315-B]
          Length = 329

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 144/347 (41%), Positives = 214/347 (61%), Gaps = 31/347 (8%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G L +GNY+G +RN +  Q+  ++L +Y IADLHAIT   V ++LR  +   +A
Sbjct: 8   SGIQPSGQLTIGNYIGALRNFMGLQD--DYLCLYCIADLHAITVAQVPKDLRKNTLDLIA 65

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LA G+DP ++II+ QS V  H +L+W+L+ +  +G +  M QFK KS++ KE  A  G
Sbjct: 66  LYLACGLDPEKSIIYIQSHVPAHTELAWVLNTMTGLGQLQRMTQFKSKSQKVKEVQA--G 123

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L  YPVLMAADILLY+ ++VPVGEDQRQHLEITR IAQRFN            +Y++   
Sbjct: 124 LLNYPVLMAADILLYQTSYVPVGEDQRQHLEITRDIAQRFN-----------HRYSET-- 170

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                F + E L      RI SL+D + KMSKSD++    I ++++ +   KKI+KA TD
Sbjct: 171 -----FTVPEILPAKVGGRIMSLQDPTSKMSKSDANKDGFILIIEDENQTRKKIKKAVTD 225

Query: 250 --GDV-LPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
             G      E  GL      KNLI+I+A+   +K EE ++++  + +  FK  LA+ V++
Sbjct: 226 SLGTFRYCDEQKGL------KNLIDIYASFSNLKAEEIVEKYKDQGYGVFKDELAELVVD 279

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + PI Q+ + + +DKSYL+ +  EGA +A   A +T++ V + VG 
Sbjct: 280 SLRPIRQRFKDIREDKSYLEKVYKEGAEKASYLANKTLRKVYKKVGF 326


>gi|118443301|ref|YP_877438.1| tryptophanyl-tRNA synthetase [Clostridium novyi NT]
 gi|118133757|gb|ABK60801.1| tryptophanyl-tRNA synthetase [Clostridium novyi NT]
          Length = 334

 Score =  243 bits (621), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 133/347 (38%), Positives = 213/347 (61%), Gaps = 24/347 (6%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           +  SG+QP+G L LGNYLG ++N ++ Q+  +    Y I D+HAIT     ++LR ++  
Sbjct: 9   VIFSGIQPSGDLTLGNYLGALKNWVKLQDEYD--CYYCIVDMHAITVRQEPKDLRRRTLE 66

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
            ++ ++AAG+DP +N +F QS V  HA+ SWIL+C + MG ++ M Q+K+KS++      
Sbjct: 67  LLSIYIAAGIDPEKNTLFIQSHVPAHAECSWILNCNSYMGELSRMTQYKDKSQKYGNHIG 126

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
            +GLF YPVLMA+DILLY+A  VPVG+DQ+QHLE+TR +A+RFN  +             
Sbjct: 127 -VGLFTYPVLMASDILLYQADLVPVGKDQKQHLELTRDLAERFNNAYSPT---------- 175

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F + E  I  + ++I  L++ +KKMSKS  +  S I ++D P++I KKI +A
Sbjct: 176 --------FKVPEPYIPEAGAKIMDLQEPTKKMSKSSDNPNSFILIMDPPEVIRKKISRA 227

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
            TD   +   V   +++   KNLI I + +     EE  K + G+ ++QFK  +A+A++ 
Sbjct: 228 VTDSLGV---VKYSDDQPGVKNLITILSAITGKTPEEIEKDYEGQGYAQFKKDVAEAIVG 284

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           E+ PI +K++ L+ DKSYL++I  +GA +A   A +T++ + + VG 
Sbjct: 285 ELAPIQEKVKELVSDKSYLESIYKKGAEKANYIANKTLRKMQKKVGF 331


>gi|297201889|ref|ZP_06919286.1| tryptophanyl-tRNA synthetase [Streptomyces sviceus ATCC 29083]
 gi|197712738|gb|EDY56772.1| tryptophanyl-tRNA synthetase [Streptomyces sviceus ATCC 29083]
          Length = 337

 Score =  243 bits (621), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 145/354 (40%), Positives = 197/354 (55%), Gaps = 23/354 (6%)

Query: 1   MLSSDNLFVSGVQPT-GVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQEN 59
           M S     +SG+QPT G  HLGNYLG +R  +  QE+  H   Y + DLHAIT     + 
Sbjct: 1   MASDRPRVLSGIQPTAGSFHLGNYLGAVRQWVALQES--HDAFYMVVDLHAITVPQDPKE 58

Query: 60  LRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSK 119
           L   +RL  A  LAAG+DP R  +F QS V  HA L+W+++C+   G  + M QFK+KS 
Sbjct: 59  LTANTRLAAAQLLAAGLDPERCTLFVQSHVPEHAQLAWVMNCLTGFGEASRMTQFKDKSA 118

Query: 120 ENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKE 179
               ++AS+GLF YP+L  ADILLY+A  VPVGEDQRQH+E+TR +A RFN  F      
Sbjct: 119 RQGADSASVGLFTYPILQVADILLYQANEVPVGEDQRQHVELTRDLATRFNGRFGET--- 175

Query: 180 VAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDII 239
                          F I +  I    ++I  L+D S KMSKS S+    INLLD P   
Sbjct: 176 ---------------FTIPKPYILKETAKIYDLQDPSIKMSKSASTPKGLINLLDEPKAT 220

Query: 240 AKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLA 299
           AKK++ A TD D +      +EN+    NL+ I++T+    I E  +Q+ GK +   K  
Sbjct: 221 AKKVKSAVTDTDTVIR--YDVENKPGVSNLLTIYSTLTGTGIPELEQQYEGKLYGALKTD 278

Query: 300 LADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           LA+ V+E + P  ++ Q  L D   LD++L +GA +AR  A ET+    E VG 
Sbjct: 279 LAEVVVEFVTPFRERTQQYLDDPETLDSLLAKGAEKARAVAAETLSQTYEKVGF 332


>gi|86609660|ref|YP_478422.1| tryptophanyl-tRNA synthetase [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86558202|gb|ABD03159.1| tryptophanyl-tRNA synthetase [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 331

 Score =  243 bits (621), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 147/349 (42%), Positives = 203/349 (58%), Gaps = 31/349 (8%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SG+QP+G LHLGNYLG I+N +  QE  ++   + I D HAIT     + LR ++R   
Sbjct: 7   LSGIQPSGELHLGNYLGAIKNWVAEQE--HYENFFCIVDQHAITVPQDPKLLRERTRSLF 64

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+     ++F QS V  H +L+W+ + +  M W   MIQ+KEK ++  EET S+
Sbjct: 65  ALYLACGLSLEHCVLFVQSHVPAHTELAWLFNTITPMNWAERMIQYKEKKEKQGEET-SV 123

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GLF YP+L AADILLY+  +VPVGEDQRQH+E+ R IA+RFN  F     EV        
Sbjct: 124 GLFSYPILQAADILLYQPKYVPVGEDQRQHIELCRDIARRFNDRF----GEV-------- 171

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                 F I E LI    +R+ SL D ++KMSKSD SDFSRI+LLD+PD I KKIQK KT
Sbjct: 172 ------FLIPEALIRPEGARVMSLTDGTRKMSKSDPSDFSRIHLLDDPDTIRKKIQKCKT 225

Query: 249 DGDVLPSEVSGL----ENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           D       + G+      R EA NL+ I+        E    +     + QFK  LAD++
Sbjct: 226 D------PIRGIAFDDPARPEAHNLLTIYMLTSGKSKEVVAAECAEMGWGQFKPLLADSI 279

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           I  + PI Q+ + L  +  +L  ++ E A +AR  A++T+K V E +G 
Sbjct: 280 IAALEPIQQRYRELWSNPDHLLVLIRENAAKARAIAEQTLKTVREAMGF 328


>gi|261823284|ref|YP_003261390.1| tryptophanyl-tRNA synthetase [Pectobacterium wasabiae WPP163]
 gi|261607297|gb|ACX89783.1| tryptophanyl-tRNA synthetase [Pectobacterium wasabiae WPP163]
          Length = 334

 Score =  243 bits (621), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 136/350 (38%), Positives = 204/350 (58%), Gaps = 21/350 (6%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  +  SG QP+G L +GNY+G +R  +  Q+  ++  +Y I DLHAIT     + LR  
Sbjct: 2   SKPIVFSGAQPSGELTIGNYMGALRQWVSMQD--DYDCIYCIVDLHAITVRQDPQALRKA 59

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           +   +A +LA G+DP ++ IF QS V  H+ LSWIL+C A  G ++ M QFK+KS    E
Sbjct: 60  TLDTLALYLACGIDPKKSTIFVQSHVPEHSQLSWILNCYAYFGELSRMTQFKDKSAR-YE 118

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
           E  + GLF YPVLMAADILLY+   VPVGEDQ+QHLE++R + QRFN+ +          
Sbjct: 119 ENINAGLFDYPVLMAADILLYQTNQVPVGEDQKQHLELSRDVGQRFNSLY---------- 168

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
                      F + E  I  S +R+ SL + +KKMSKSD +  + I LL++P  + KKI
Sbjct: 169 --------GDIFKVPEPFIPKSGARVMSLLEPTKKMSKSDDNRNNVIGLLEDPKAVVKKI 220

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           ++A TD D  P     ++N+    NL++I + + +  I E  ++F G+ +   K A+A+A
Sbjct: 221 KRAMTDSDEPPVIRYDVKNKAGVSNLLDILSGVTRKPIPELEQEFNGQMYGHLKGAVAEA 280

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           V   +  + ++      D+++L  ++ EGA +A  RAQET+K V + VG 
Sbjct: 281 VSGMLSELQERYHRFRNDEAFLQQVMREGAEKASARAQETLKKVYDAVGF 330


>gi|325661058|ref|ZP_08149685.1| tryptophanyl-tRNA synthetase [Lachnospiraceae bacterium 4_1_37FAA]
 gi|331085215|ref|ZP_08334301.1| tryptophanyl-tRNA synthetase [Lachnospiraceae bacterium 9_1_43BFAA]
 gi|325472565|gb|EGC75776.1| tryptophanyl-tRNA synthetase [Lachnospiraceae bacterium 4_1_37FAA]
 gi|330407998|gb|EGG87488.1| tryptophanyl-tRNA synthetase [Lachnospiraceae bacterium 9_1_43BFAA]
          Length = 334

 Score =  243 bits (621), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 135/353 (38%), Positives = 207/353 (58%), Gaps = 24/353 (6%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENL 60
           M++   +  SG+Q TG L LGNYLG ++N +   +   +   Y + D+H+IT       L
Sbjct: 1   MINDKKVLFSGMQATGNLTLGNYLGALKNWVTLSD--EYECFYSVVDMHSITVRQDPATL 58

Query: 61  RYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKE 120
           R ++R  +  ++AAG+DP +N I+ QS V  HA+L+WIL+C   MG +N M QFK+KS +
Sbjct: 59  RKRARALLTLYIAAGLDPEKNCIYYQSHVSGHAELAWILNCYTYMGELNRMTQFKDKSAK 118

Query: 121 NKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEV 180
           + +   + GLF YPVLMAADILL++A  VPVG DQ QHLE+TR IAQRFN  +       
Sbjct: 119 HADNINA-GLFTYPVLMAADILLFQADVVPVGIDQMQHLELTRDIAQRFNGVY------- 170

Query: 181 AQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIA 240
                         F I E  +    ++I SL+D +KKMSKSD +  + I L+D+PD I 
Sbjct: 171 -----------GDVFTIPEPYVGKVGAKIMSLQDPAKKMSKSDENPNASIYLMDDPDTIM 219

Query: 241 KKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLAL 300
           +K ++A TD +   +++   E +   KNLI+I++       +E +K+F GK +  FK+A+
Sbjct: 220 RKCKRAVTDSE---AQILYREEQPGVKNLIDIYSACTGKTPDETVKEFDGKGYGDFKMAV 276

Query: 301 ADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            +AV+  + P+  +   L KDK+++D I+   A +A   A +T++ V   VG 
Sbjct: 277 GEAVVSVLKPLQDEYARLEKDKAFIDGIIKNNAEKANYFATKTLRKVQRKVGF 329


>gi|148284435|ref|YP_001248525.1| tryptophanyl-tRNA synthetase [Orientia tsutsugamushi str. Boryong]
 gi|148284991|ref|YP_001249081.1| tryptophanyl-tRNA synthetase [Orientia tsutsugamushi str. Boryong]
 gi|146739874|emb|CAM79828.1| tryptophanyl-tRNA synthetase [Orientia tsutsugamushi str. Boryong]
 gi|146740430|emb|CAM80919.1| tryptophanyl-tRNA synthetase [Orientia tsutsugamushi str. Boryong]
          Length = 335

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 137/347 (39%), Positives = 208/347 (59%), Gaps = 24/347 (6%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SG+Q TG  HLGNYLG I+  ++ Q       ++F+A+LH+IT +  QE+L+    +F 
Sbjct: 6   LSGIQVTGKQHLGNYLGSIQKWVQMQSKFQ--SIFFLANLHSITTS--QESLKLSESIFS 61

Query: 69  AS--FLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
           ++   LA G++P ++IIF QSDV  H++L+WIL+CV  +G +  M QFK+K+ +      
Sbjct: 62  SACMLLACGINPKQSIIFLQSDVKEHSELAWILNCVTPLGQLKRMTQFKDKTIKCSSNNI 121

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           +LGL  YPVLMAAD+LLY+A  VPVG DQ+QHLE+ R I +  + +F             
Sbjct: 122 NLGLLAYPVLMAADVLLYQADLVPVGADQKQHLELVRDIVKIIHHKFN------------ 169

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F + E  ID +A +I SL+D  KKMSKSD SDFSRINL D+ D+I +K+QKA
Sbjct: 170 ----DDTIFKLPELFIDHTAGKIMSLKDGRKKMSKSDISDFSRINLTDSQDVIFRKLQKA 225

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
           KT  D          +R E  NLI IFA +      + +K++     ++FK  LA  +I+
Sbjct: 226 KT--DCYTQITYDPTSRPEISNLINIFAALSNKTTNDIVKEYEYAELTKFKKDLAMLIID 283

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + PI ++  + + +  Y++ +L+ GAN+A+  A++T+  V +  GL
Sbjct: 284 CLNPILKEYNNYMNNLDYVNQVLITGANQAKIIAEKTITKVKQKFGL 330


>gi|168185561|ref|ZP_02620196.1| tryptophanyl-tRNA synthetase [Clostridium botulinum C str. Eklund]
 gi|169296317|gb|EDS78450.1| tryptophanyl-tRNA synthetase [Clostridium botulinum C str. Eklund]
          Length = 334

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 132/347 (38%), Positives = 211/347 (60%), Gaps = 24/347 (6%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           +  SG+QP+G L LGNYLG ++N ++ QE  +    Y I D+HAIT     ++LR ++  
Sbjct: 9   VIFSGIQPSGDLTLGNYLGALKNWVKLQEKYD--CYYCIVDMHAITVRQEPKDLRRRTLE 66

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
            ++ ++AAG+DP +N +F QS V  HA+ SWIL+C + MG ++ M Q+K+KS++      
Sbjct: 67  LLSIYIAAGIDPEKNTLFIQSHVPAHAECSWILNCNSYMGELSRMTQYKDKSQKYGNNIG 126

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
            +GLF YPVLMA+DILLY+A  VPVG DQ+QHLE+TR +A+RFN  +             
Sbjct: 127 -VGLFTYPVLMASDILLYQADLVPVGRDQKQHLELTRDLAERFNNSYSPT---------- 175

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F + E  I  + ++I  L++ +KKMSKS  +  S I ++D+P++I KKI +A
Sbjct: 176 --------FKVPESYIPEAGAKIMDLQEPNKKMSKSSDNPNSYILIMDSPEVIRKKISRA 227

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
            TD       V   +++   KNLI I + +     EE  K + G+ ++QFK  +A+A++ 
Sbjct: 228 ITDS---LGTVKYSDDQPGVKNLITILSAITGNSTEEIEKHYEGQGYAQFKKDVAEAIVG 284

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           E+ PI +K++ L+ +K YL++I  +GA +A   A +T++ + + VG 
Sbjct: 285 ELTPIQEKVKELVSNKEYLESIFKKGAEKANYIANKTLRKMQKKVGF 331


>gi|261367900|ref|ZP_05980783.1| tryptophan--tRNA ligase [Subdoligranulum variabile DSM 15176]
 gi|282570712|gb|EFB76247.1| tryptophan--tRNA ligase [Subdoligranulum variabile DSM 15176]
          Length = 336

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 138/345 (40%), Positives = 197/345 (57%), Gaps = 23/345 (6%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SG+QPTG   LGNY+G +RN    Q   + L  Y +ADLHA+T   V  +LR ++R   
Sbjct: 10  LSGIQPTGTPTLGNYIGAVRNWALLQPDYDCL--YMVADLHALTVRQVPADLRRRTRELA 67

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A  LA G+DP  +++F QS V  H +LSWIL+C  + G ++ M QFK+KS ++ +     
Sbjct: 68  ALLLAVGIDPENHVLFVQSHVPAHCELSWILACNTQFGELSRMTQFKDKSAKHPDNVNG- 126

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GLF YPVLMAADIL+Y A  VPVG+DQ QHLEI R IA RFN  +               
Sbjct: 127 GLFTYPVLMAADILIYNADLVPVGQDQTQHLEIARNIANRFNGVYGDT------------ 174

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                 F + EG + +S ++I SL + +KKMSKSD++  S I + D+ D I +K ++A T
Sbjct: 175 ------FILPEGYVPASGAKIMSLAEPTKKMSKSDTNVNSFILMTDDKDTIVRKFKRAVT 228

Query: 249 DGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
           D D +       EN+    NL+ I+ T     +EE   +F GK +  FK+A+A+   + +
Sbjct: 229 DSDGVVR--FDRENKPGVSNLMAIYGTFTGKTMEEIEAEFAGKGYGDFKMAVAEVTADAL 286

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            P+  +   +L DK+Y+D +L  GA RA   A  T+  V   VGL
Sbjct: 287 TPVQAEYNRILADKAYVDGVLKNGAERASRIANRTVSKVYRKVGL 331


>gi|237809351|ref|YP_002893791.1| tryptophanyl-tRNA synthetase [Tolumonas auensis DSM 9187]
 gi|237501612|gb|ACQ94205.1| tryptophanyl-tRNA synthetase [Tolumonas auensis DSM 9187]
          Length = 334

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 140/347 (40%), Positives = 197/347 (56%), Gaps = 21/347 (6%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           + +SG QP+G L +GNY+G +R  ++ Q+  + L  Y I DLHAIT       LR     
Sbjct: 5   IVLSGAQPSGQLTIGNYMGALRQWVQMQDDYDCL--YCIVDLHAITVRQDPLVLRKACLD 62

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A +LA G+DP+++ +F QS V  HA+L WIL+C  +MG ++ M QFK+KS +  E   
Sbjct: 63  TAALYLAVGIDPAKSTVFMQSHVPQHAELGWILNCYTQMGELSRMTQFKDKS-QRYENNV 121

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           S+GLF YPVLMAADILLY+A  VPVG+DQ+QHLE+TR IA RFN+ +             
Sbjct: 122 SVGLFDYPVLMAADILLYQANQVPVGQDQKQHLELTRDIAYRFNSIY------------- 168

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F   E  I    +++ SL+D  KKMSKSD +  + I LL++P  I KK++KA
Sbjct: 169 -----GNVFTTPEPFIPPQGAKVMSLQDPVKKMSKSDDNQNNVIGLLEDPKSITKKLKKA 223

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
            TD +  P     +EN+    NL+ +        I E    F GK +   K   A+AV+ 
Sbjct: 224 VTDSEDPPVVRFDIENKAGVSNLLSLMHGATGQSIAELEAHFEGKMYGHLKTEAAEAVVA 283

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + PI Q+ Q    D+S L  IL +GA +A+ RA ETM+ V + +G 
Sbjct: 284 LLEPIQQRYQEFRSDESALLAILQQGAEKAQVRADETMRRVFDAIGF 330


>gi|166365172|ref|YP_001657445.1| tryptophanyl-tRNA synthetase [Microcystis aeruginosa NIES-843]
 gi|166087545|dbj|BAG02253.1| tryptophanyl-tRNA synthetase [Microcystis aeruginosa NIES-843]
          Length = 336

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 141/349 (40%), Positives = 194/349 (55%), Gaps = 27/349 (7%)

Query: 8   FVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
            +SGVQPTG LHLGNYLG IRN +  Q+  ++   + + DLHAIT       L   +   
Sbjct: 6   ILSGVQPTGNLHLGNYLGAIRNWVEGQK--DYDNFFCVVDLHAITVPHNPATLAEDTLAI 63

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A +LA G+D     IF QS V  H +L+W+L+C+  + W+ +MIQFKEK+ +  E   +
Sbjct: 64  AALYLACGIDLEYATIFVQSHVKAHTELTWLLNCITPLNWLTDMIQFKEKAIKQGENVGT 123

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
            GL  YPVLMAADILLY A  VPVGEDQ+QHLE+TR IA R N  F              
Sbjct: 124 -GLLDYPVLMAADILLYDADKVPVGEDQKQHLELTRDIAVRINHLF-------------- 168

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
            Q  +    + + +I    +R+ SL D   KMSKSD S+ SRIN+LD+PD+IAKKI++ K
Sbjct: 169 GQPKQPILKLPDPMIRKEGARVMSLTDGRNKMSKSDPSEMSRINILDSPDVIAKKIKRCK 228

Query: 248 TDGDVLPSEVSGL----ENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           TD       V GL      R E  NL+ +++ +     E    +     + QFK  L + 
Sbjct: 229 TD------LVKGLTFDDPERPECHNLLTLYSILSGKSKEVVGGECADLGWGQFKPMLTEV 282

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVG 352
            IE + PI +K   + +DK YL T+L +G  +A   A +T+  V   +G
Sbjct: 283 TIESLKPIREKYAQIREDKDYLATVLRQGRLKAEAVANQTLDRVKNAMG 331


>gi|331268706|ref|YP_004395198.1| tryptophan--tRNA ligase [Clostridium botulinum BKT015925]
 gi|329125256|gb|AEB75201.1| tryptophan--tRNA ligase [Clostridium botulinum BKT015925]
          Length = 334

 Score =  243 bits (620), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 130/347 (37%), Positives = 214/347 (61%), Gaps = 24/347 (6%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           +  SG+QP+G L LGNYLG ++N ++ Q+   +   Y I D+HAIT     ++LR ++  
Sbjct: 9   VIFSGIQPSGDLTLGNYLGALKNWVKLQD--QYECYYCIVDMHAITVKQQPKDLRRRTLE 66

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
            ++ ++AAG+DP +N IF QS V  HA+ +WIL+C + MG ++ M Q+K+KS++      
Sbjct: 67  LLSIYVAAGIDPEKNTIFIQSHVPAHAEATWILNCNSYMGELSRMTQYKDKSQKYGNNIG 126

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
            +GLF YPVLMAADILLY+   VPVG+DQ+QHLE+TR IA+RFN  +             
Sbjct: 127 -VGLFTYPVLMAADILLYQTDLVPVGKDQKQHLELTRDIAERFNGAYSPT---------- 175

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F + E  I  + ++I  L++ SKKMSKS  +  S I ++D P++I KKI +A
Sbjct: 176 --------FKVPEPYIPEAGAKIMDLQEPSKKMSKSSDNPNSFILIMDPPEVIRKKISRA 227

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
            TD   +   V   + +   KNL+ I + ++    E+  K++ G+ +++FK  +A+A++E
Sbjct: 228 VTDSLGV---VKYSDEQPGVKNLMTILSVIKGKSFEDIEKEYEGQGYAKFKKDVAEAIVE 284

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           E+ PI +K++ L+ +K YL++I ++GA +A   A +T++ + + +G 
Sbjct: 285 ELTPIQEKVKELVSNKEYLESIYIKGAEKANYIATKTLRKMQKKIGF 331


>gi|117618550|ref|YP_857674.1| tryptophanyl-tRNA synthetase [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117559957|gb|ABK36905.1| tryptophanyl-tRNA synthetase [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 334

 Score =  243 bits (620), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 136/347 (39%), Positives = 199/347 (57%), Gaps = 21/347 (6%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           + +SG QP+G L +GNY+G +R  +  Q+  + L  Y I DLHAIT       LR     
Sbjct: 5   IVLSGAQPSGQLTIGNYMGALRQWVNMQDDFDCL--YCIVDLHAITTRQDPAALRKACLD 62

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A +LA G+DP+++ +F QS V  HA+L WIL+C  +MG ++ M QFK+KS    E   
Sbjct: 63  AAALYLAVGIDPAKSTVFIQSHVPQHAELGWILNCYTQMGELSRMTQFKDKSARF-ENNV 121

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           ++GLF YPVLMAADILLY+A  VPVG DQ+QHLE+TR I+ RFN  +             
Sbjct: 122 NVGLFGYPVLMAADILLYQANQVPVGNDQKQHLELTRDISTRFNNLYGE----------- 170

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F + E  I +  +R+ SL+D +KKMSKSD ++ + I LL++P  I KKI++A
Sbjct: 171 -------VFTLPEPFIPTEGARVMSLQDPTKKMSKSDDNEANFIGLLEDPKQIVKKIKRA 223

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
            TD D         EN+    NL+ + + +    I E  + F GK +   K   A+AV+ 
Sbjct: 224 VTDSDEPAVVRFDPENKPGVSNLLTLMSGVTGRSIPELEQHFEGKMYGHLKTETAEAVVA 283

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + PI  +   L +D+++L  IL  GA +AR RA++T+  V +++G 
Sbjct: 284 LLEPIQARFHELRQDEAHLQAILAAGAQKARERAEKTLASVYDVIGF 330


>gi|156384119|ref|XP_001633179.1| predicted protein [Nematostella vectensis]
 gi|156220245|gb|EDO41116.1| predicted protein [Nematostella vectensis]
          Length = 365

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 149/348 (42%), Positives = 200/348 (57%), Gaps = 28/348 (8%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQE-NLRYQSRLFV 68
           SG+QPTG +HLGN+LG I++ +  Q       +Y I DLH+IT  + QE ++  QS L +
Sbjct: 41  SGIQPTGAMHLGNFLGAIQSWVSMQHESEARVIYSITDLHSIT--VPQEPSVLKQSVLNM 98

Query: 69  A-SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
           A S LA+GV+P R I+F+QS V  HA+L+W+LSC+A  G ++ M Q+K K+ + K  T  
Sbjct: 99  ATSLLASGVNPDRCILFQQSQVSQHAELAWVLSCLAPTGNLSRMHQWKSKTNQTKARTC- 157

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           LGL+ YPVLMAADILLYRATHVP+GEDQ QHLE+TR +A+ +N  +              
Sbjct: 158 LGLYAYPVLMAADILLYRATHVPIGEDQLQHLELTRELARIYNQTY-------------- 203

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                G F +    I  S  R+ SLRD +KKMSKSD    SRI L D  D IA KI++A 
Sbjct: 204 -----GNFFMQPHAILGSTQRVMSLRDPTKKMSKSDPVPSSRIELTDTADQIAAKIRRAV 258

Query: 248 TDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQ--FKLALADAVI 305
           TD +  P        R    NLI ++A +     E    ++     S+  FK  L D VI
Sbjct: 259 TDSE--PYICYDPGTRPGLSNLIRVYAALSNESPEAISVRYQDTEHSKARFKQQLTDLVI 316

Query: 306 EEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
             + PI + IQ L KD   +  +L  GA +AR  A+ET+  V   VGL
Sbjct: 317 HTLQPIRENIQSLSKDPGLVSNVLETGAEKARLLAEETLVQVRRAVGL 364


>gi|87124055|ref|ZP_01079905.1| t-RNA synthetase, class Ib:Tryptophanyl-tRNA synthetase
           [Synechococcus sp. RS9917]
 gi|86168624|gb|EAQ69881.1| t-RNA synthetase, class Ib:Tryptophanyl-tRNA synthetase
           [Synechococcus sp. RS9917]
          Length = 337

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 142/349 (40%), Positives = 203/349 (58%), Gaps = 28/349 (8%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQPTG LHLGN+LG IRN +  Q   +H   + + DLHAIT       L   +    
Sbjct: 7   LSGVQPTGALHLGNWLGAIRNWVDLQH--DHDTFFCVVDLHAITVPHDPTRLADDTLNTA 64

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+DP+ + +F QS V  HA+L W+L+CV  + W+  MIQFKEK+ + + +  S+
Sbjct: 65  ALYLACGIDPAVSTVFVQSHVAAHAELCWLLNCVTPLNWLERMIQFKEKAVK-QGDNVSV 123

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIA-QRFNTEFERKIKEVAQKYAQE 187
           GL  YPVLMAADILLY A  VPVGEDQ+QHLE+ R IA QR N  F  +   V +     
Sbjct: 124 GLLDYPVLMAADILLYDADLVPVGEDQKQHLELARDIAQQRINARFGSEESPVLK----- 178

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                    + + LI    +R+ SL D   KMSKSD ++ SRINLLD P++I KKI++AK
Sbjct: 179 ---------VPQPLILRDGARVMSLTDGRNKMSKSDPNEGSRINLLDPPELITKKIKRAK 229

Query: 248 TDGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           TD  +      GLE     R E  NL+ ++A +  +  + A  +     + +FK  LA+A
Sbjct: 230 TDPQM------GLEFGNPERPETDNLLGLYAILSGLGRDAAGAECAAMGWGRFKPLLAEA 283

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVG 352
            +  + PI  + + LL D++ L+ +L +G  RA+  A  T++ V + +G
Sbjct: 284 TVAALEPIQARHRELLDDRAELEQVLQQGRERAQTVATSTVERVRQQLG 332


>gi|332708593|ref|ZP_08428567.1| tryptophanyl-tRNA synthetase [Lyngbya majuscula 3L]
 gi|332352690|gb|EGJ32256.1| tryptophanyl-tRNA synthetase [Lyngbya majuscula 3L]
          Length = 336

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 139/349 (39%), Positives = 200/349 (57%), Gaps = 27/349 (7%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQPTG LHLGNYLG IRN +  Q   ++L  + + DLHAIT       L   +    
Sbjct: 7   LSGVQPTGNLHLGNYLGAIRNWVEGQSQYDNL--FCVVDLHAITVPHNPATLAEDTLSIA 64

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+D   + IF QS +  H++L+W+L+C+  + W+  MIQFKEK+ + + E  S 
Sbjct: 65  ALYLACGIDLECSTIFVQSHIPAHSELAWLLNCITPLNWLERMIQFKEKAVK-QGENVST 123

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GL  YPVLMAADILLY A  VPVGEDQ+QH+E+TR IA R N +F  + K V +      
Sbjct: 124 GLLDYPVLMAADILLYDADQVPVGEDQKQHIELTRNIAIRVNDKFGSQEKLVLK------ 177

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                   + E +I  + +R+ SL D  +KMSKSD S+ SRIN+LD+P+ I KKI++ KT
Sbjct: 178 --------LPEPMIRKTGARVMSLTDGRRKMSKSDPSELSRINVLDSPEEIQKKIKRCKT 229

Query: 249 DGDVLPSEVSGL----ENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           D       + GL      R E +NL+ ++  +     EE   +     + +FK  L +  
Sbjct: 230 D------PIKGLWFDDPERPECENLLTLYTLLSGKTKEEVATECRDMGWGKFKPLLTEVT 283

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           IE + PI QK   +  ++ YL+++L EG  +A   A +T+  V   +G 
Sbjct: 284 IEALKPIQQKYHDVRSEQGYLESVLREGRQKAEAIANQTLSRVKTALGF 332


>gi|170718585|ref|YP_001783399.1| tryptophanyl-tRNA synthetase [Haemophilus somnus 2336]
 gi|168826714|gb|ACA32085.1| tryptophanyl-tRNA synthetase [Haemophilus somnus 2336]
          Length = 333

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 137/347 (39%), Positives = 198/347 (57%), Gaps = 21/347 (6%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           + +SGVQP+G L +GNYLG +R  +  Q+   +  +Y I DLHAIT     + LR  +  
Sbjct: 5   VVLSGVQPSGELTIGNYLGALRQWVNMQD--EYECLYCIVDLHAITVRQDPDTLRKATLD 62

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
            +A +LA G+DP ++ IF QS +  H  L+WIL+C    G M+ M QFK+KS  + +   
Sbjct: 63  VLALYLACGIDPEKSTIFIQSHIPEHTQLAWILNCYTYFGEMSRMTQFKDKSARHADNI- 121

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           ++GLF YPVLMAADILLY+A  VPVGEDQRQHLEITR IAQRFN  +             
Sbjct: 122 NVGLFTYPVLMAADILLYQANQVPVGEDQRQHLEITRDIAQRFNALYGEH---------- 171

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F + E  I  + +R+ SL +  KKMSKSD +  + I LL++P  + KKI++A
Sbjct: 172 --------FIVPEAFIPKAGARVMSLLEPEKKMSKSDENRNNVIGLLEDPKAVVKKIKRA 223

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
            TD D  P     ++N+    NL++I + +    I +   +F GK +   K A+AD V  
Sbjct: 224 VTDSDEPPVVRYDVKNKAGVSNLLDILSGVTGKSIVQLEAEFEGKMYGHLKSAVADEVAT 283

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            +  + ++  H   ++  L+ I  EGA +AR RA+ET+  V   +G 
Sbjct: 284 MLTTLQERFYHFRNNEELLNKIAAEGAEKARKRAKETLDKVYRAMGF 330


>gi|225568209|ref|ZP_03777234.1| hypothetical protein CLOHYLEM_04283 [Clostridium hylemonae DSM
           15053]
 gi|225162928|gb|EEG75547.1| hypothetical protein CLOHYLEM_04283 [Clostridium hylemonae DSM
           15053]
          Length = 349

 Score =  243 bits (619), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 131/353 (37%), Positives = 208/353 (58%), Gaps = 24/353 (6%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENL 60
           M+    +  SG+Q TG L LGNYLG ++N +   +   +   Y + D+H+IT       L
Sbjct: 16  MIKDRKVLFSGMQATGSLTLGNYLGALKNWVTLSD--EYECFYSVVDMHSITVRQDPATL 73

Query: 61  RYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKE 120
           R ++R  +  ++AAG+DP +N I+ QS V  HA+L+WIL+C   MG +N M QFK+KS +
Sbjct: 74  RKRARALLTLYIAAGLDPEKNCIYYQSHVSGHAELTWILNCFTYMGELNRMTQFKDKSAK 133

Query: 121 NKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEV 180
           + +   + GLF YPVLMAADILLY+A  VPVG DQ QHLE+TR IA+RFN  +       
Sbjct: 134 HADNINA-GLFTYPVLMAADILLYQADVVPVGIDQMQHLELTRDIAERFNNIY------- 185

Query: 181 AQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIA 240
                         F + E  I    ++I SL+D +KKMSKSD +  + I L+D+PD + 
Sbjct: 186 -----------GDVFTVPEPYIGKVGAKIMSLQDPAKKMSKSDENPNASIYLMDDPDTVM 234

Query: 241 KKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLAL 300
           +K ++A TD +   + +   + +   KNL++I++       +E + +F GK +  FK+A+
Sbjct: 235 RKCKRAVTDSE---AHILYRDEQPGVKNLVDIYSACTGKTPDEVVAEFDGKGYGDFKMAV 291

Query: 301 ADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            +AV+  + P+  ++  L KDK+Y+D+++   A +A+  A +T++ V + VG 
Sbjct: 292 GEAVVSVLKPLQDEVARLEKDKAYIDSVIKTNAEKAQYFANKTLRKVQKKVGF 344


>gi|218288803|ref|ZP_03493066.1| tryptophanyl-tRNA synthetase [Alicyclobacillus acidocaldarius LAA1]
 gi|218241161|gb|EED08337.1| tryptophanyl-tRNA synthetase [Alicyclobacillus acidocaldarius LAA1]
          Length = 327

 Score =  243 bits (619), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 145/346 (41%), Positives = 200/346 (57%), Gaps = 27/346 (7%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SG+QP+G L +GNYLG IRN ++ Q+  + L  + + D+HAIT     E LR+ +R   
Sbjct: 5   LSGIQPSGTLTIGNYLGAIRNFVKLQDEADCL--FCVVDMHAITVPQDPEALRHNTRSVA 62

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA+G+DP ++ +F QS V  HA+L WIL C    G +  M QFK+KS  ++ E  + 
Sbjct: 63  ALYLASGIDPGKSTVFVQSHVPQHAELGWILQCFTYHGELERMTQFKDKS--SRHEVVTA 120

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GLF YPVLMAADILLY A  VPVGEDQ+QHLE+TR +A RFN  F               
Sbjct: 121 GLFTYPVLMAADILLYNAHLVPVGEDQKQHLELTRDVAGRFNRRF--------------- 165

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                 F + E  I     RI SL +  KKMSKSD S  + I++LD+PD I +KI +A T
Sbjct: 166 ---GDTFVVPEPYIPEIGGRIMSLENPEKKMSKSDESANAYISMLDDPDTIRRKIGRAVT 222

Query: 249 DGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
           D +    EV    E +    NL+ I+A    + +E+  ++F G+ +  FK  LA+ VIE 
Sbjct: 223 DSE---REVRFDPERKPAVSNLMTIYALCADVSLEDVERRFEGQGYGPFKKELAEVVIER 279

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + PI  + Q L+   S LD +L +GA RAR  A  T++ V   VG 
Sbjct: 280 LAPIQARYQELMA-SSELDDVLRKGAERAREIAAATLQEVQRKVGF 324


>gi|124025365|ref|YP_001014481.1| tryptophanyl-tRNA synthetase [Prochlorococcus marinus str. NATL1A]
 gi|123960433|gb|ABM75216.1| Tryptophanyl-tRNA synthetase [Prochlorococcus marinus str. NATL1A]
          Length = 337

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 146/350 (41%), Positives = 207/350 (59%), Gaps = 28/350 (8%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQPTG +H+GN+LG IRN +  QE  N+     + DLHAIT     ++L   S    
Sbjct: 7   LSGVQPTGDVHIGNWLGAIRNWVELQE--NYETFVCVVDLHAITTPHDPKSLHQNSLSTA 64

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A ++A G++P +  IF QS +  H++L WIL+C+  + WM  MIQFKEKS + + +  S+
Sbjct: 65  ALYIACGMNPDKCSIFIQSQISAHSELCWILNCLTPLNWMERMIQFKEKSIK-QGDNVSI 123

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIA-QRFNTEFERKIKEVAQKYAQE 187
           GL  YPVLMAADILLY A  VPVGEDQ+QHLE+ R IA QR N++F            QE
Sbjct: 124 GLLDYPVLMAADILLYDADLVPVGEDQKQHLELARDIASQRVNSKFG----------TQE 173

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
               K   P    LI    S++ SL D +KKMSKSD ++ SRI LLD+PD+I KKI++AK
Sbjct: 174 NPILKVPNP----LILKECSKVMSLTDGTKKMSKSDPNENSRITLLDSPDVITKKIKRAK 229

Query: 248 TDGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           TD ++      GLE    +R EA NL+ I++ +  +  E+A +      + +FK    +A
Sbjct: 230 TDSEL------GLEFGNPSRPEADNLLTIYSIISGLGREKAAEYCAEMGWGKFKPEFTEA 283

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           +I  + PI +K + L+ D   L  IL +G   A   ++ T+K V + +G 
Sbjct: 284 MINVLKPIQEKYKELMNDPEELKRILNKGKLTAEEVSKLTLKRVKDALGF 333


>gi|77736111|ref|NP_001029754.1| tryptophanyl-tRNA synthetase, mitochondrial precursor [Bos taurus]
 gi|134038855|sp|Q3T099|SYWM_BOVIN RecName: Full=Tryptophanyl-tRNA synthetase, mitochondrial; AltName:
           Full=(Mt)TrpRS; AltName: Full=Tryptophan--tRNA ligase;
           Short=TrpRS; Flags: Precursor
 gi|74268052|gb|AAI02488.1| Tryptophanyl tRNA synthetase 2, mitochondrial [Bos taurus]
 gi|296489467|gb|DAA31580.1| tryptophanyl-tRNA synthetase, mitochondrial precursor [Bos taurus]
          Length = 360

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 134/345 (38%), Positives = 210/345 (60%), Gaps = 25/345 (7%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QPTG+ HLGNYLG I + +R Q+  + + +Y I DLH+IT       LR       A
Sbjct: 39  SGIQPTGIPHLGNYLGAIESWVRLQDEHDSV-LYSIVDLHSITVPQDPTILRQSILDMTA 97

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           + LA G++P ++I+F+QS V  H  LSWIL+C+ R+  + ++ Q+K K+ + K    ++G
Sbjct: 98  ALLACGINPEKSILFQQSQVSEHTQLSWILTCMVRLPRLQHLHQWKAKTAKEKH-NGTVG 156

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L  YPVL AADILLY++THVPVGEDQ QH+E+ + +AQ FN           +KY +   
Sbjct: 157 LLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQSFN-----------KKYGE--- 202

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
               FFP+ + ++ +S  +++SLRD S KMSKSD    + + + D+P+ I +K +KA TD
Sbjct: 203 ----FFPVPKSIL-TSMKKVKSLRDPSAKMSKSDPDKLATVRITDSPEEIVQKFRKAMTD 257

Query: 250 GDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
                SEV+    +R    NL+ I A +  + +EE +++  G + +++KL +ADAVIE+ 
Sbjct: 258 ---FTSEVTYEPASRGGVSNLVAIHAAVAGLPVEEVVRRSAGMDTARYKLVVADAVIEKF 314

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            PI  +I+ L  +K +L+ +L  G+ RA+  A    + V ++VG 
Sbjct: 315 APIKSEIEKLKMNKDHLEKVLQVGSARAKELAYPVCQEVKKLVGF 359


>gi|300868836|ref|ZP_07113443.1| tryptophanyl-tRNA synthetase [Oscillatoria sp. PCC 6506]
 gi|300333187|emb|CBN58635.1| tryptophanyl-tRNA synthetase [Oscillatoria sp. PCC 6506]
          Length = 337

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 141/350 (40%), Positives = 200/350 (57%), Gaps = 27/350 (7%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQPTG LHLGNYLG IRN +  Q    +   + + DLHAIT       L   +    
Sbjct: 8   LSGVQPTGNLHLGNYLGAIRNWVEGQS--QYENFFCVVDLHAITAPHNPATLASDTYAIA 65

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+D   + IF QS V  H +L+W+L+C+  + W+ +MIQFKEK+ + + E  + 
Sbjct: 66  ALYLACGIDLQHSTIFVQSHVPAHTELAWLLNCITPINWLEDMIQFKEKAVK-QGENVNA 124

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GL  YPVLMAADILLY A  VPVGEDQ+QHLE+TR IA R N +F      V +      
Sbjct: 125 GLLNYPVLMAADILLYNADKVPVGEDQKQHLELTRDIAVRLNHQFGTPENPVLK------ 178

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                   + + LI    +R+ SL D ++KMSKSD S+ SRINLLD+PD IAKKI++ KT
Sbjct: 179 --------LPDPLIRKEGARVMSLTDGTRKMSKSDPSEQSRINLLDSPDAIAKKIKRCKT 230

Query: 249 DGDVLPSEVSGL----ENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           D       V GL     +R EA+NL+ ++  +     E+   +     + +FK  L +  
Sbjct: 231 DA------VRGLTFDSSDRPEARNLLTLYLLLSGKTKEDVTAECQDMGWGEFKPLLTETT 284

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
           I  + PI  K + ++ D+ YL+++L +G  +A   A +T+  V +  G S
Sbjct: 285 INALKPIQDKYKDIMDDRGYLESVLRQGKEQASAIANQTLTKVKKAFGYS 334


>gi|156554192|ref|XP_001600112.1| PREDICTED: similar to tryptophanyl-tRNA synthetase [Nasonia
           vitripennis]
          Length = 386

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 132/332 (39%), Positives = 199/332 (59%), Gaps = 25/332 (7%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QPTG++H+GNY G I+N I+ Q+    + ++ I D+HAIT       LR       A
Sbjct: 48  SGIQPTGIVHIGNYFGAIQNWIKLQDDGEDV-IWSIVDMHAITLPHDPNELRQNILKLTA 106

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           + LA G+DP ++I+F+QS V  HA+LSWI +C+A M  + +  Q+KEKS++ K+    LG
Sbjct: 107 TLLACGIDPDKSILFQQSTVPMHAELSWIFACLATMPKLAHQPQYKEKSEKLKD--IPLG 164

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L++YP+L  ADILLY+ATHVPVGEDQ QH+++   +AQ+FN+ +                
Sbjct: 165 LYIYPILQTADILLYKATHVPVGEDQLQHIQLAEHLAQKFNSTYGET------------- 211

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                FP+   +++    RI+SLRD ++KMSKS S   SRI+L D PD++  K++KA TD
Sbjct: 212 -----FPMPIAIVNKDTGRIKSLRDPTQKMSKSCSDVKSRIDLTDEPDVLLNKVKKAITD 266

Query: 250 GDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
                SE++   E R    NL+ I + +     EE  K+  G +  ++KL LAD +IE +
Sbjct: 267 ---FTSEITYEPEVRPGVANLLNIHSMITGKTPEEICKEAEGLDTGKYKLMLADVIIENL 323

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRA 340
            PI ++I+  + +  YL  +L EGA +A   A
Sbjct: 324 NPIRKRIEQYMNEPQYLKEVLQEGARKAELTA 355


>gi|187370725|gb|ACD02425.1| mitochondrial tryptophanyl tRNA synthetase 2 [Sus scrofa]
          Length = 360

 Score =  242 bits (618), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 134/345 (38%), Positives = 210/345 (60%), Gaps = 25/345 (7%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QPTG+ HLGNYLG I + ++ Q+    + +Y IADLH+IT       LR       A
Sbjct: 39  SGIQPTGIPHLGNYLGAIESWVKLQDEHGSV-LYSIADLHSITVPQDPAVLRQSILDMTA 97

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
             LA G++P ++I+F+QS V  H  LSWIL+C+ R+  + ++ Q+K K+ + K++  ++G
Sbjct: 98  VLLACGINPEKSILFQQSQVSEHTQLSWILTCLIRLPRLQHLHQWKAKTDKEKQD-GTMG 156

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L  YPVL AADILLY++THVPVGEDQ QH+E+ + +AQRFN           +KY +   
Sbjct: 157 LLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQRFN-----------KKYGE--- 202

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
               FFP+ + ++ +S  +++SLRD S KMSKSD    + + + D+P+ I +K +KA TD
Sbjct: 203 ----FFPVPKSIL-TSMKKVKSLRDPSAKMSKSDPDKLAAVRITDSPEEIVQKFRKAVTD 257

Query: 250 GDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
                SEV+     R    NL+ I A +  + +EE +++  G N + +KL +A+AVIE  
Sbjct: 258 ---FTSEVTYDPARRGGVSNLVAIHAAVTGLPVEEVVRRSAGINTAGYKLVVAEAVIERF 314

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            PI  +I+ L ++K +L+ +L  G+ +A+  A    + V ++VG 
Sbjct: 315 APIKSEIEKLKRNKDHLEKVLQVGSAKAKELAYPVCQEVKKLVGF 359


>gi|184201442|ref|YP_001855649.1| tryptophanyl-tRNA synthetase [Kocuria rhizophila DC2201]
 gi|183581672|dbj|BAG30143.1| tryptophanyl-tRNA synthetase [Kocuria rhizophila DC2201]
          Length = 342

 Score =  242 bits (618), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 134/352 (38%), Positives = 200/352 (56%), Gaps = 35/352 (9%)

Query: 9   VSGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           VSGVQP+   LHLGNY+G +RN +  Q+  + +  +F+ADLH+IT       +  ++R+ 
Sbjct: 15  VSGVQPSADSLHLGNYVGALRNWVDMQDENDCV--FFVADLHSITTGQDPATMSERTRVT 72

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A ++AAG+DP R+ +  QS V  H  L+W+L+C+   G    M QFK+KS +   E  +
Sbjct: 73  AAQYIAAGIDPERSTLLIQSQVPEHTQLAWVLNCITGYGEAARMTQFKDKSVKQGAENTT 132

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GLF YPVLMAADIL+Y+A  VPVGEDQRQHLE+TR +AQRFN+ F              
Sbjct: 133 VGLFTYPVLMAADILVYQANQVPVGEDQRQHLELTRTLAQRFNSRF-------------- 178

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F + +  I  ++++I  L++ + KMSKS  SD   + LLD   + AKKI+ A 
Sbjct: 179 ----GATFEVPDAKILENSAKIYDLQNPTAKMSKSAPSDAGLVRLLDPAKVNAKKIRSAV 234

Query: 248 TDGDVLPSEVSGLENRLE------AKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALA 301
           TD         G E R +        NL+ I++++    +E  ++Q+ GK +   K+ LA
Sbjct: 235 TD--------DGTEVRFDRQAKPGVSNLLTIYSSLSGAPVETLVEQYEGKMYGHLKVDLA 286

Query: 302 DAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + V + + PI ++ Q LL D + LD +L  GA + R  A  T+  V E +G 
Sbjct: 287 EVVTQTLDPIQKRAQELLDDPAELDRLLARGAQKGREIAARTVAEVYERMGF 338


>gi|114045767|ref|YP_736317.1| tryptophanyl-tRNA synthetase [Shewanella sp. MR-7]
 gi|113887209|gb|ABI41260.1| tryptophanyl-tRNA synthetase [Shewanella sp. MR-7]
          Length = 332

 Score =  242 bits (618), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 133/347 (38%), Positives = 200/347 (57%), Gaps = 21/347 (6%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           + +SG QP+G L +GNY+G +R  +  Q++  H  +Y + DLHAIT     + LR     
Sbjct: 5   IVLSGAQPSGELTIGNYMGALRQWVAMQDS--HDCLYCVVDLHAITVRQDPQALREACLD 62

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
            +A +LA GVDP ++ +F QS V  H  L W L+C  +MG ++ M QFK+KS+++     
Sbjct: 63  TLALYLACGVDPKKSTVFIQSQVPQHTQLGWALNCYTQMGELSRMTQFKDKSQKHANNI- 121

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           ++GLF YPVLMAADILLY+A  +PVG+DQ+QHLE+TR IA RFN  +             
Sbjct: 122 NVGLFGYPVLMAADILLYQANEIPVGQDQKQHLELTRDIATRFNNAYGET---------- 171

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F I E  I    +++ SL+D  KKMSKSD +  + I LL++P  + KK++KA
Sbjct: 172 --------FTIPEPFIPEHGAKVMSLQDPLKKMSKSDDNRNNVIGLLEDPKAVMKKLKKA 223

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
            TD D  P     +EN+    NL+ + + +    I     +F GK +   K A  +AV+ 
Sbjct: 224 MTDSDEPPVVRFDMENKPGVSNLLSLMSGITGQSIASLEAEFEGKMYGHLKGAAGEAVVG 283

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + P+ ++ + L  D++YLD ++  GA  A+ RA+ T+K V E +GL
Sbjct: 284 MLEPLQERYRALRADRAYLDQVMKAGAENAQARAEVTLKKVYEKIGL 330


>gi|113972017|ref|YP_735810.1| tryptophanyl-tRNA synthetase [Shewanella sp. MR-4]
 gi|113886701|gb|ABI40753.1| tryptophanyl-tRNA synthetase [Shewanella sp. MR-4]
          Length = 332

 Score =  242 bits (618), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 133/347 (38%), Positives = 200/347 (57%), Gaps = 21/347 (6%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           + +SG QP+G L +GNY+G +R  +  Q++  H  +Y + DLHAIT     + LR     
Sbjct: 5   IVLSGAQPSGELTIGNYMGALRQWVAMQDS--HDCLYCVVDLHAITVRQDPQALREACLD 62

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
            +A +LA GVDP ++ +F QS V  H  L W L+C  +MG ++ M QFK+KS+++     
Sbjct: 63  TLALYLACGVDPKKSTVFIQSQVPQHTQLGWALNCYTQMGELSRMTQFKDKSQKHANNI- 121

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           ++GLF YPVLMAADILLY+A  +PVG+DQ+QHLE+TR IA RFN  +             
Sbjct: 122 NVGLFGYPVLMAADILLYQANEIPVGQDQKQHLELTRDIATRFNNAYGET---------- 171

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F I E  I    +++ SL+D  KKMSKSD +  + I LL++P  + KK++KA
Sbjct: 172 --------FTIPEPFIPEHGAKVMSLQDPLKKMSKSDDNRNNVIGLLEDPKAVMKKLKKA 223

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
            TD D  P     +EN+    NL+ + + +    I     +F GK +   K A  +AV+ 
Sbjct: 224 MTDSDEPPVVRFDMENKPGVSNLLSLMSGITGQSITSLEAEFEGKMYGHLKGAAGEAVVG 283

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + P+ ++ + L  D++YLD ++  GA  A+ RA+ T+K V E +GL
Sbjct: 284 MLEPLQERYRALRADRAYLDQVMKAGAENAQARAEVTLKKVYEKIGL 330


>gi|158321148|ref|YP_001513655.1| tryptophanyl-tRNA synthetase [Alkaliphilus oremlandii OhILAs]
 gi|158141347|gb|ABW19659.1| tryptophanyl-tRNA synthetase [Alkaliphilus oremlandii OhILAs]
          Length = 331

 Score =  242 bits (617), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 139/352 (39%), Positives = 207/352 (58%), Gaps = 24/352 (6%)

Query: 2   LSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLR 61
           +S+  +  SG QPTG L +GNY+G ++N    +E   H  +Y I D H++T     +  +
Sbjct: 1   MSNKKIVFSGAQPTGSLTMGNYIGAVKNWKELEE--EHHCIYSIVDSHSLTVRQDPKAFK 58

Query: 62  YQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKEN 121
                F+  +LA G++P +NII+ QS V  HA+L+WIL C   +G +  M QFK+KS+++
Sbjct: 59  ETCISFLVQYLACGLNPEKNIIYFQSHVPQHAELNWILGCNTYVGELGRMTQFKDKSEKH 118

Query: 122 KEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVA 181
           K+   + GLF YPVLMAADILLYR+  VPVG+DQ+QHLEITR IA RFN  +        
Sbjct: 119 KDNINA-GLFTYPVLMAADILLYRSNLVPVGDDQKQHLEITRDIAMRFNNLYGE------ 171

Query: 182 QKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAK 241
                        FPI E       +RI SL++ SKKMSKSD +    I L+D+ D I K
Sbjct: 172 ------------VFPIPEIHTPKIGARIMSLQEPSKKMSKSDDNVNGTIYLMDSEDTILK 219

Query: 242 KIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALA 301
           K+++A TD     + V+  E +   KNLI I++++  + IEE ++++ GK +  FK+  A
Sbjct: 220 KMKRAVTDS---ANHVAYNEEQPGVKNLITIYSSLTGLSIEEIVERYEGKGYGAFKVDTA 276

Query: 302 DAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + VIE + P  ++    + +  Y++TI   GA +A   A+ETMK V + +GL
Sbjct: 277 EVVIEFLKPFKRRYDEYINNLDYVETIYKNGAKKAYELAEETMKVVRDRIGL 328


>gi|127511155|ref|YP_001092352.1| tryptophanyl-tRNA synthetase [Shewanella loihica PV-4]
 gi|126636450|gb|ABO22093.1| tryptophanyl-tRNA synthetase [Shewanella loihica PV-4]
          Length = 332

 Score =  242 bits (617), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 132/347 (38%), Positives = 202/347 (58%), Gaps = 21/347 (6%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           + +SG QP+G L +GNY+G +R  +  Q++  H  +Y + DLHAIT     + LR     
Sbjct: 5   IVLSGAQPSGELTIGNYMGALRQWVAMQDS--HDCLYCVVDLHAITVRQDPQKLRDACLD 62

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
            +A +LA GVDP ++ +F QS V  H  L W L+C  +MG ++ M QFK+KS+++     
Sbjct: 63  TLALYLACGVDPKKSTVFIQSQVPQHTQLGWALNCYTQMGELSRMTQFKDKSQKHANNI- 121

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           ++GLF YPVLMAADILLY+A  +PVG+DQ+QHLE+TR IA RFN  +             
Sbjct: 122 NVGLFGYPVLMAADILLYQANEIPVGQDQKQHLELTRDIATRFNNAYGET---------- 171

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F I E  I    +++ SL+D  KKMSKSD +  + I LL++P  + KK++KA
Sbjct: 172 --------FTIPEPFIPELGAKVMSLQDPLKKMSKSDDNRNNVIGLLEDPKAVMKKLKKA 223

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
            TD D  P     +EN+    NL+ + + +    I     +F GK +   K+A  +AV+ 
Sbjct: 224 MTDSDEPPVVRFDVENKPGVSNLLSLMSGVTGQSIASLEAEFEGKMYGHLKVAAGEAVVG 283

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + P+ ++ +    D+S+L+ ++ EGA +A+ RA+ T+K V E +GL
Sbjct: 284 MLEPLQERFKEYRADQSFLNQVMHEGAEKAQARAEVTLKKVYEKIGL 330


>gi|311896456|dbj|BAJ28864.1| putative tryptophanyl-tRNA synthetase [Kitasatospora setae KM-6054]
          Length = 345

 Score =  242 bits (617), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 137/346 (39%), Positives = 190/346 (54%), Gaps = 23/346 (6%)

Query: 9   VSGVQPT-GVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SG+QPT G  HLGNYLG +R  +  QE  +    Y + DLHAIT       LR  +R+ 
Sbjct: 17  LSGIQPTSGSFHLGNYLGAVRQWVDLQEAND--AFYMVVDLHAITVEQDPAVLRQNTRIS 74

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A  L AG+DP R  +F QS V  HA L+W+++C+   G    M QFK+KS +   +  +
Sbjct: 75  AAQLLGAGLDPERCTLFVQSQVPEHAQLAWVMNCLTGFGEAARMTQFKDKSAKQGSDRTT 134

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GLF YPVLM AD+LLY+A  VPVGEDQRQHLE+TR +A RFNT           +Y Q 
Sbjct: 135 VGLFTYPVLMVADVLLYQADAVPVGEDQRQHLELTRDLADRFNT-----------RYGQT 183

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F + E  I  + ++I+ L+D + KMSKS ++D   +NLLD     AKK + A 
Sbjct: 184 -------FTVPEPYILKATAKIQDLQDPAAKMSKSAATDKGLVNLLDPAKTSAKKFKSAV 236

Query: 248 TDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
           TD D + S     +  +   NL+ I + +    ++E +  F GK +   K  LAD   E 
Sbjct: 237 TDTDTVVSYDEAAKPGV--SNLLRIHSALSGRSVDELVAHFEGKMYGALKTELADLFTEW 294

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + P   + Q  L D + LD +L  GA +AR  A ET+  V + VG 
Sbjct: 295 VTPFQARTQQYLDDPAELDRVLALGAEKARAVAAETLAEVYDRVGF 340


>gi|282898917|ref|ZP_06306901.1| Tryptophanyl-tRNA synthetase, class Ib [Cylindrospermopsis
           raciborskii CS-505]
 gi|281196228|gb|EFA71141.1| Tryptophanyl-tRNA synthetase, class Ib [Cylindrospermopsis
           raciborskii CS-505]
          Length = 346

 Score =  242 bits (617), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 141/350 (40%), Positives = 195/350 (55%), Gaps = 28/350 (8%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQPTG LHLGNYLG IRN +  Q+  ++   + + DLHAIT       L   +    
Sbjct: 18  LSGVQPTGNLHLGNYLGAIRNWVEMQDQYDNF--FCVVDLHAITVPHNPATLAADTYTIA 75

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+D   + IF QS V  H++L W+L+C+  + W+ +MIQFKEK+ +  E   + 
Sbjct: 76  ALYLACGIDLQHSHIFVQSHVPAHSELCWLLNCITPLNWLQDMIQFKEKAVKQGENVGT- 134

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GL +YPVLMAADILLY+A  VPVGEDQ+QHLE+ R I  RFN  F           AQE 
Sbjct: 135 GLLIYPVLMAADILLYQADKVPVGEDQKQHLELARDIVNRFNFLF-----------AQEN 183

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
              K   P    LI    +R+ SL D +KKMSKSD S+ SRIN+LD PD IA KI++ KT
Sbjct: 184 PVLKLPAP----LIRKEGARVMSLADGTKKMSKSDPSELSRINVLDPPDQIANKIKRCKT 239

Query: 249 DGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           D       V GL      R E  NL+ ++  +     E    +     + +FK  L +  
Sbjct: 240 D------PVRGLSFDDLARPECNNLLTLYMLLSGKTKEAVAGECADMGWGKFKPLLTETT 293

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
           I  + PI  K + +  +K YL+++L  G  +A+  A +T+  V   +G +
Sbjct: 294 INALEPIQNKYKEIRTEKGYLESVLKAGREKAQAIASQTLADVKRALGYT 343


>gi|21362962|sp|Q9CYK1|SYWM_MOUSE RecName: Full=Tryptophanyl-tRNA synthetase, mitochondrial; AltName:
           Full=(Mt)TrpRS; AltName: Full=Tryptophan--tRNA ligase;
           Short=TrpRS; Flags: Precursor
 gi|12856927|dbj|BAB30833.1| unnamed protein product [Mus musculus]
          Length = 360

 Score =  242 bits (617), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 135/354 (38%), Positives = 218/354 (61%), Gaps = 30/354 (8%)

Query: 3   SSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRY 62
           S + +F SG+QPTG+LHLGNYLG I + +  QE  + + +Y I DLH+IT  + Q+    
Sbjct: 33  SGERVF-SGIQPTGILHLGNYLGAIESWVNLQEEYDTV-IYSIVDLHSIT--VPQDPTVL 88

Query: 63  QSRLF--VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKE 120
           Q  +    A  LA G++P ++I+F+QS V  H  LSWIL+C+ R+  + ++ Q+K K+  
Sbjct: 89  QQSILDMTAVLLACGINPEKSILFQQSKVSEHTQLSWILTCMVRLPRLQHLHQWKAKAA- 147

Query: 121 NKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEV 180
           N++   ++GL  YPVL AADIL Y++THVPVGEDQ QH+E+ + +A+ FN          
Sbjct: 148 NRKHDGTVGLLTYPVLQAADILCYKSTHVPVGEDQVQHMELVQDLARSFN---------- 197

Query: 181 AQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIA 240
            QKY +       FFP+ + ++ +S  +++SLRD S KMSKSD    + + + D+P+ I 
Sbjct: 198 -QKYGE-------FFPLPKSIL-TSMKKVKSLRDPSSKMSKSDPDKLATVRITDSPEEIV 248

Query: 241 KKIQKAKTDGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLA 299
           +K +KA TD     SEV+   ++R    N++ I A +  + +EE ++   G + +++KL 
Sbjct: 249 QKFRKAVTD---FTSEVTYEPDSRAGVSNMVAIHAAVSGLSVEEVVRSSAGLDTARYKLL 305

Query: 300 LADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           +ADAVIE+  PI ++I+ L  DK +L  +L+ G+ +A+  A    + V ++VG+
Sbjct: 306 VADAVIEKFAPIRKEIEKLKMDKDHLRKVLLVGSAKAKELASPVFEEVKKLVGI 359


>gi|117922318|ref|YP_871510.1| tryptophanyl-tRNA synthetase [Shewanella sp. ANA-3]
 gi|117614650|gb|ABK50104.1| tryptophanyl-tRNA synthetase [Shewanella sp. ANA-3]
          Length = 332

 Score =  242 bits (617), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 133/347 (38%), Positives = 200/347 (57%), Gaps = 21/347 (6%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           + +SG QP+G L +GNY+G +R  +  Q++  H  +Y + DLHAIT     + LR     
Sbjct: 5   IVLSGAQPSGELTIGNYMGALRQWVAMQDS--HDCLYCVVDLHAITVRQDPQALREACLD 62

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
            +A +LA GVDP ++ +F QS V  H  L W L+C  +MG ++ M QFK+KS+++     
Sbjct: 63  TLALYLACGVDPKKSTVFIQSQVPQHTQLGWALNCYTQMGELSRMTQFKDKSQKHANNI- 121

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           ++GLF YPVLMAADILLY+A  +PVG+DQ+QHLE+TR IA RFN  +             
Sbjct: 122 NVGLFGYPVLMAADILLYQANEIPVGQDQKQHLELTRDIATRFNNAYGET---------- 171

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F I E  I    +++ SL+D  KKMSKSD +  + I LL++P  + KK++KA
Sbjct: 172 --------FTIPEPFIPEHGAKVMSLQDPLKKMSKSDDNRNNVIGLLEDPKAVMKKLKKA 223

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
            TD D  P     +EN+    NL+ + + +    I     +F GK +   K A  +AV+ 
Sbjct: 224 MTDSDEPPVVRFDMENKPGVSNLLSLMSGITGQSIASLEAEFEGKMYGHLKGAAGEAVVG 283

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + P+ ++ + L  D++YLD ++  GA  A+ RA+ T+K V E +GL
Sbjct: 284 MLEPLQERYRALRADRAYLDQVMRAGAENAQARAEVTLKKVYEKIGL 330


>gi|262201712|ref|YP_003272920.1| tryptophanyl-tRNA synthetase [Gordonia bronchialis DSM 43247]
 gi|262085059|gb|ACY21027.1| tryptophanyl-tRNA synthetase [Gordonia bronchialis DSM 43247]
          Length = 347

 Score =  242 bits (617), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 137/346 (39%), Positives = 194/346 (56%), Gaps = 23/346 (6%)

Query: 9   VSGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SG+QPT    HLGNYLG +R  +  QE  +    YFI D+HAIT       LR ++R+ 
Sbjct: 18  LSGIQPTSDSFHLGNYLGAVRQWVELQEDFDTF--YFIPDMHAITVPHDPAQLRERTRVS 75

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
           VA  LA GVDPSR  I+ QS V   A L+W+LSC+   G    M QFK+KS +   + A 
Sbjct: 76  VAQLLAVGVDPSRATIYVQSHVPEIAQLTWVLSCITGFGEAGRMTQFKDKSAKQGVDAAG 135

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GLF YP+LMAADIL ++   VPVGEDQRQHLE+TR +AQRFN  F +            
Sbjct: 136 VGLFTYPILMAADILAFQVDRVPVGEDQRQHLELTRDLAQRFNKRFGKA----------- 184

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F + E  I    ++I  L++ + KMSKS  +D   INLLD+P   AKKI+ A 
Sbjct: 185 -------FRVPEAFIVKEFAKIYDLQNPTAKMSKSADTDKGLINLLDDPKRSAKKIRSAV 237

Query: 248 TDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
           TD       +   E +    NL+ I + +  + I++ + ++ GK + + K+  A+ + E 
Sbjct: 238 TDTGT--EILFDRETKPGVSNLLTIQSALSGVGIDDLVAKYAGKGYGELKVETAEVLTEF 295

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + P+  ++   L D ++LD IL +GA RAR  A  T+  V + VG 
Sbjct: 296 VTPLRGRVAAYLDDPAHLDEILAQGAARAREVASATLADVYDKVGF 341


>gi|333026652|ref|ZP_08454716.1| putative tryptophanyl-tRNA synthetase [Streptomyces sp. Tu6071]
 gi|332746504|gb|EGJ76945.1| putative tryptophanyl-tRNA synthetase [Streptomyces sp. Tu6071]
          Length = 330

 Score =  242 bits (617), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 132/348 (37%), Positives = 195/348 (56%), Gaps = 25/348 (7%)

Query: 8   FVSGVQPT-GVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
            +SG+QP+ G  HLGNYLG +R  +  QE+  H   Y + D+HAIT     + LR  +RL
Sbjct: 1   MLSGIQPSAGSFHLGNYLGAVRQWVALQES--HDAFYMVVDMHAITVPQDPDTLRANTRL 58

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A  LAAG+DP R+ +F QS V  HA+L+WI++C+   G  + M QFK+K+ +   E  
Sbjct: 59  SAAQLLAAGIDPERSALFVQSHVREHAELAWIMNCLTGFGEASRMTQFKDKAAKQGAEGT 118

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           ++GLF YPVL  ADILLY+A  VPVGEDQRQH+E+TR +A+RFN  +             
Sbjct: 119 TVGLFTYPVLQVADILLYQAHQVPVGEDQRQHVELTRDLAERFNARYGET---------- 168

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F + E  I    ++I  L++ S KMSKS +S    +NL+D P   AKKI+ A
Sbjct: 169 --------FVVPEAYILKETAKIYDLQEPSAKMSKSAASPKGLVNLMDEPKATAKKIKSA 220

Query: 247 KTDGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVI 305
            TD +   +E+    EN+    NL+ I++ +  + ++   +++ GK +   K  LA+ V+
Sbjct: 221 VTDTE---TEIRFDRENKPGVSNLLGIYSNLTGVTVQALEEKYAGKGYGALKTDLAEVVV 277

Query: 306 EEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + + P   +    L D + LD IL  GA +AR  A  T+    + VG 
Sbjct: 278 DFVTPFRDRTLEYLDDPATLDKILASGAEKAREVAAPTLAAAYDKVGF 325


>gi|291398150|ref|XP_002715737.1| PREDICTED: mitochondrial tryptophanyl-tRNA synthetase 2
           [Oryctolagus cuniculus]
          Length = 360

 Score =  242 bits (617), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 134/345 (38%), Positives = 207/345 (60%), Gaps = 25/345 (7%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QPTG+ HLGNYLG I N +R Q+    + +Y I DLH+IT       LR       A
Sbjct: 39  SGIQPTGIPHLGNYLGAIENWVRLQDEDGSV-LYSIVDLHSITVPQDPTILRQSILDMTA 97

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           + LA G++P ++I+F+QS V  H  LSWIL+C+ R+  + ++ Q+K K+ + K +  ++G
Sbjct: 98  ALLACGINPDKSILFQQSQVSEHTQLSWILTCMVRLPRLQHLHQWKAKAGKQKHD-GTMG 156

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L  YPVL AAD+LLY++THVPVGEDQ QH+E+ + +AQ FN           +KY +   
Sbjct: 157 LLTYPVLQAADVLLYKSTHVPVGEDQVQHMELVQDLAQGFN-----------KKYGE--- 202

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
               FFP+   ++ +S  +++SLRD S KMSKSD    + + + D+P+ I +K +KA TD
Sbjct: 203 ----FFPVPTSIL-TSMKKVKSLRDPSAKMSKSDPDKLATVRITDSPEEIVQKFRKAVTD 257

Query: 250 GDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
                SEV+    +R    NL+ I A +  + +EE ++   G + + +KL +ADAVIE+ 
Sbjct: 258 ---FTSEVTYDPASRGGVSNLVAIHAAVTGLSVEEVVRLSKGLDTAHYKLVVADAVIEKF 314

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            PI  +I+ L  DK +L+ +L  G+ +A+  A    + V ++VG 
Sbjct: 315 APIKSEIEKLKMDKGHLEKVLRVGSEKAKELAYPVFQEVKKLVGF 359


>gi|31543952|ref|NP_081738.2| tryptophanyl-tRNA synthetase, mitochondrial precursor [Mus
           musculus]
 gi|26335283|dbj|BAC31342.1| unnamed protein product [Mus musculus]
 gi|26335443|dbj|BAC31422.1| unnamed protein product [Mus musculus]
 gi|59808072|gb|AAH89583.1| Tryptophanyl tRNA synthetase 2 (mitochondrial) [Mus musculus]
          Length = 360

 Score =  241 bits (616), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 135/354 (38%), Positives = 218/354 (61%), Gaps = 30/354 (8%)

Query: 3   SSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRY 62
           S + +F SG+QPTG+LHLGNYLG I + +  QE  + + +Y I DLH+IT  + Q+    
Sbjct: 33  SGERVF-SGIQPTGILHLGNYLGAIESWVNLQEEYDTV-IYSIVDLHSIT--VPQDPTVL 88

Query: 63  QSRLF--VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKE 120
           Q  +    A  LA G++P ++I+F+QS V  H  LSWIL+C+ R+  + ++ Q+K K+ +
Sbjct: 89  QQSILDMTAVLLACGINPEKSILFQQSKVSEHTQLSWILTCMVRLPRLQHLHQWKAKAAK 148

Query: 121 NKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEV 180
            K +  ++GL  YPVL AADIL Y++THVPVGEDQ QH+E+ + +A+ FN          
Sbjct: 149 QKHD-GTVGLLTYPVLQAADILCYKSTHVPVGEDQVQHMELVQDLARSFN---------- 197

Query: 181 AQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIA 240
            QKY +       FFP+ + ++ +S  +++SLRD S KMSKSD    + + + D+P+ I 
Sbjct: 198 -QKYGE-------FFPLPKSIL-TSMKKVKSLRDPSSKMSKSDPDKLATVRITDSPEEIV 248

Query: 241 KKIQKAKTDGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLA 299
           +K +KA TD     SEV+   ++R    N++ I A +  + +EE ++   G + +++KL 
Sbjct: 249 QKFRKAVTD---FTSEVTYEPDSRAGVSNMVAIHAAVSGLSVEEVVRSSAGLDTARYKLL 305

Query: 300 LADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           +ADAVIE+  PI ++I+ L  DK +L  +L+ G+ +A+  A    + V ++VG+
Sbjct: 306 VADAVIEKFAPIRKEIEKLKMDKDHLRKVLLVGSAKAKELASPVFEEVKKLVGI 359


>gi|330828676|ref|YP_004391628.1| Tryptophanyl-tRNA synthetase [Aeromonas veronii B565]
 gi|328803812|gb|AEB49011.1| Tryptophanyl-tRNA synthetase [Aeromonas veronii B565]
          Length = 334

 Score =  241 bits (616), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 138/347 (39%), Positives = 197/347 (56%), Gaps = 21/347 (6%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           + +SG QP+G L +GNY+G +R  +  Q+  + L  Y I DLHAIT       LR     
Sbjct: 5   IVLSGAQPSGQLTIGNYMGALRQWVNMQDEFDCL--YCIVDLHAITTRQDPAALRKACLD 62

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A +LA G+DP ++ +F QS V  HA+L WIL+C  +MG ++ M QFK+KS    E   
Sbjct: 63  AAALYLAVGIDPKKSTVFIQSHVPQHAELGWILNCYTQMGELSRMTQFKDKSARF-ENNV 121

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           ++GLF YPVLMAADILLY+A  VPVG DQ+QHLE+TR I  RFN  +             
Sbjct: 122 NVGLFGYPVLMAADILLYQANQVPVGNDQKQHLELTRDICTRFNNLY------------- 168

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F + E  I +  +R+ SL+D +KKMSKSD ++ + I LL++P  I KKI++A
Sbjct: 169 -----GDVFTMPEPFIPTEGARVMSLQDPTKKMSKSDDNEANFIGLLEDPKQIVKKIKRA 223

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
            TD D         EN+    NL+ + + +    I E    F GK +   K   A+AV+ 
Sbjct: 224 VTDSDEPAVVRFDPENKPGVSNLLTLMSGVTGRSIPELELHFEGKMYGHLKTETAEAVVA 283

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + PI  +   L +D+++L  IL EGA +AR RA++T+  V ++VG 
Sbjct: 284 LLEPIQARFHELRQDEAHLIAILAEGAQKARERAEKTLTSVYDVVGF 330


>gi|269929097|ref|YP_003321418.1| tryptophanyl-tRNA synthetase [Sphaerobacter thermophilus DSM 20745]
 gi|269788454|gb|ACZ40596.1| tryptophanyl-tRNA synthetase [Sphaerobacter thermophilus DSM 20745]
          Length = 348

 Score =  241 bits (616), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 144/351 (41%), Positives = 204/351 (58%), Gaps = 36/351 (10%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QPTG +H+GNYLG IRN +R+Q+  +++  + I DLHA+T      +LR ++    +
Sbjct: 24  SGIQPTGGIHIGNYLGAIRNWVRQQDDYDNV--FCIVDLHAMTIPYDPADLRARNLELAS 81

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
             LAAG+DP+R+I+F QSDV  H +L+WIL  +A  G +  M QFKEKSK +  E    G
Sbjct: 82  VLLAAGIDPARSILFIQSDVREHTELAWILGTLATYGELRRMTQFKEKSKGS--ERVGAG 139

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           +  YPVL AADILLY A  VPVGEDQ+QH+E+TR +A RFN  F                
Sbjct: 140 ILFYPVLQAADILLYDAALVPVGEDQKQHIELTRDVAIRFNNTFGET------------- 186

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                F + +  I  + +RI SL+D +KKMSKSD    SRI L D+PD+I +KI++A TD
Sbjct: 187 -----FVVPDADIKEAGARIMSLQDPTKKMSKSDPDPNSRIELRDSPDVIRRKIRRAVTD 241

Query: 250 GDVLPSEVSGLENRLEAK------NLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
                   SG E R + +      NL+ I+     I I E  +++ GK +  FK  LA+ 
Sbjct: 242 --------SGTEIRFDEEGKPAISNLLTIYHLFSDIPIPELEERYVGKGYGTFKQDLAEV 293

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
           ++E + P+ Q++  L    + +  IL EGA RAR  A   M+ V ++ GL 
Sbjct: 294 IVEHLAPLQQRLDELSAQPAEVVRILHEGAARAREIAAAKMERVRDVTGLG 344


>gi|24371892|ref|NP_715934.1| tryptophanyl-tRNA synthetase [Shewanella oneidensis MR-1]
 gi|39932203|sp|Q8EK12|SYW_SHEON RecName: Full=Tryptophanyl-tRNA synthetase; AltName:
           Full=Tryptophan--tRNA ligase; Short=TrpRS
 gi|24345718|gb|AAN53379.1|AE015477_9 tryptophanyl-tRNA synthetase [Shewanella oneidensis MR-1]
          Length = 332

 Score =  241 bits (616), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 133/347 (38%), Positives = 200/347 (57%), Gaps = 21/347 (6%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           + +SG QP+G L +GNY+G +R  +  Q++  H  +Y + DLHAIT     + LR     
Sbjct: 5   IVLSGAQPSGELTIGNYMGALRQWVAMQDS--HDCLYCVVDLHAITVRQDPQALREACLD 62

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
            +A +LA GVDP ++ +F QS V  H  L W L+C  +MG ++ M QFK+KS+++     
Sbjct: 63  TLALYLACGVDPKKSTVFIQSQVPQHTQLGWALNCYTQMGELSRMTQFKDKSQKHANNI- 121

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           ++GLF YPVLMAADILLY+A  +PVG+DQ+QHLE+TR IA RFN  +             
Sbjct: 122 NVGLFGYPVLMAADILLYQANEIPVGQDQKQHLELTRDIATRFNNAYGET---------- 171

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F I E  I    +++ SL+D  KKMSKSD +  + I LL++P  + KK++KA
Sbjct: 172 --------FTIPEPFIPEHGAKVMSLQDPLKKMSKSDDNRNNVIGLLEDPKAVMKKLKKA 223

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
            TD D  P     +EN+    NL+ + + +    I     +F GK +   K A  +AV+ 
Sbjct: 224 MTDSDEPPVVRFDIENKPGVSNLLSLMSGITGQSIASLEAEFEGKMYGHLKGAAGEAVVG 283

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + P+ ++ + L  D++YLD ++  GA  A+ RA+ T+K V E +GL
Sbjct: 284 MLEPLQERYRALRADRAYLDQVMRAGAENAQARAEVTLKKVYEKIGL 330


>gi|302519518|ref|ZP_07271860.1| tryptophanyl-tRNA synthetase [Streptomyces sp. SPB78]
 gi|302428413|gb|EFL00229.1| tryptophanyl-tRNA synthetase [Streptomyces sp. SPB78]
          Length = 337

 Score =  241 bits (616), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 134/355 (37%), Positives = 197/355 (55%), Gaps = 25/355 (7%)

Query: 1   MLSSDNLFVSGVQPT-GVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQEN 59
           M S  +  +SG+QP+ G  HLGNYLG +R  +  QE+  H   Y + D+HAIT     + 
Sbjct: 1   MASERSRVLSGIQPSAGSFHLGNYLGAVRQWVALQES--HDAFYMVVDMHAITVPQDPDT 58

Query: 60  LRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSK 119
           LR  +RL  A  LAAG+DP R+ +F QS V  HA+L+WI++C+   G  + M QFK+K+ 
Sbjct: 59  LRANTRLSAAQLLAAGIDPERSALFVQSHVREHAELAWIMNCLTGFGEASRMTQFKDKAA 118

Query: 120 ENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKE 179
           +   E  ++GLF YPVL  ADILLY+A  VPVGEDQRQH+E+TR +A+RFN  +      
Sbjct: 119 KQGAEGTTVGLFTYPVLQVADILLYQAHQVPVGEDQRQHVELTRDLAERFNARYGET--- 175

Query: 180 VAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDII 239
                          F + E  I    ++I  L++ S KMSKS +S    +NL+D P   
Sbjct: 176 ---------------FVVPEAYILKETAKIYDLQEPSAKMSKSAASPKGLVNLMDEPKAT 220

Query: 240 AKKIQKAKTDGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKL 298
           AKKI+ A TD +   +E+    EN+    NL+ I++ +  + ++   +++ GK +   K 
Sbjct: 221 AKKIKSAVTDTE---TEIRFDRENKPGVSNLLGIYSNLTGVTVQALEEKYAGKGYGALKT 277

Query: 299 ALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            LA+ V++ + P   +    L D + LD IL  GA +AR  A  T+      VG 
Sbjct: 278 DLAEVVVDFVTPFRDRTLEYLDDPATLDKILASGAEKAREVAAPTLAAAYYKVGF 332


>gi|312140775|ref|YP_004008111.1| tryptophan-tRNA synthetase trps [Rhodococcus equi 103S]
 gi|325675585|ref|ZP_08155269.1| tryptophan--tRNA ligase [Rhodococcus equi ATCC 33707]
 gi|311890114|emb|CBH49432.1| tryptophan-tRNA synthetase TrpS [Rhodococcus equi 103S]
 gi|325553556|gb|EGD23234.1| tryptophan--tRNA ligase [Rhodococcus equi ATCC 33707]
          Length = 347

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 139/347 (40%), Positives = 195/347 (56%), Gaps = 25/347 (7%)

Query: 9   VSGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SG+QPT    HLGN+LG ++  +  Q+  +    YFI DLHAIT     + LR ++   
Sbjct: 19  LSGIQPTADSFHLGNFLGALQQWVPLQDDFD--AFYFIPDLHAITVPQDPKELRQRTLRA 76

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
           VA  LA G+DP R+ +F QS V  HA+L+W+L+C+   G  + M QFK+KS     + AS
Sbjct: 77  VAQLLALGIDPERSTLFVQSQVPEHAELAWVLNCITGFGEASRMTQFKDKSARQGSDHAS 136

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GLF YPVLMAADILLYR   VPVGEDQRQHLE+ R +A RFNT F +            
Sbjct: 137 VGLFTYPVLMAADILLYRPQRVPVGEDQRQHLELARDLAGRFNTRFGKT----------- 185

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F I E  I    ++I  L+D + KMSKS  +    +NLLD+P + AKKI+ A 
Sbjct: 186 -------FVIPEPQIIKGTAKIYDLQDPTSKMSKSGPTPAGLVNLLDDPKVSAKKIKSAV 238

Query: 248 TDGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
           TD +    E+    +N+    NL+ I + +    I++ +  + GK +   K   A+ + E
Sbjct: 239 TDNE---REIRFDPQNKPGVSNLLTIQSALSGKSIDDLVAGYEGKGYGDLKADTAEVLGE 295

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + P+  K+   L D++ LD IL  GA+RAR  A  T+  V E VG 
Sbjct: 296 FVTPLRAKVDGYLSDRAELDRILASGADRAREVAARTLGQVYEKVGF 342


>gi|237786125|ref|YP_002906830.1| Tryptophanyl-tRNA synthetase [Corynebacterium kroppenstedtii DSM
           44385]
 gi|237759037|gb|ACR18287.1| Tryptophanyl-tRNA synthetase [Corynebacterium kroppenstedtii DSM
           44385]
          Length = 348

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 137/349 (39%), Positives = 200/349 (57%), Gaps = 27/349 (7%)

Query: 9   VSGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           VSG+QPT    HLGNYLG +R  I+ Q+  N+   YFI DLHAIT +   + LR ++   
Sbjct: 18  VSGLQPTSDSYHLGNYLGAVRQFIKLQD--NYDAFYFIPDLHAITVDQDPQQLRKRTLSG 75

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
           VA  LA G+DP R+ +F QS V  HA L WI++C+   G  + M QFK+KS +   E  S
Sbjct: 76  VAQLLALGIDPDRSTLFVQSHVPEHAQLGWIMTCLTGFGEASRMTQFKDKSSKQGTERTS 135

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
            GLF YP+LMAADILLY+   VPVGEDQRQH+E+TR +AQRFN+ F              
Sbjct: 136 AGLFAYPMLMAADILLYKPELVPVGEDQRQHMELTRNLAQRFNSRFGET----------- 184

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F + +G I   A++I  L++ + KMSKS S+    +NLLD+P + AK+I+ A 
Sbjct: 185 -------FVVPDGFIPEGAAKIYDLQEPTSKMSKSGSNPKGIVNLLDDPKVSAKRIRSAV 237

Query: 248 TDGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQF--GGKNFSQFKLALADAV 304
           TD D   +E+    EN+    NL+ I   +     ++   Q+   G  + + K   A+A+
Sbjct: 238 TDND---AEIRYDRENKPGVSNLLVIQGALTDKDPKDLAAQYQESGVGYGELKKDTAEAL 294

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
                P+  + +  + D++ L+ IL +GA RAR  A +T++ V++ +G 
Sbjct: 295 EAFTTPLKARYEEFMSDRAQLEKILADGAERARYEAHKTLRKVHKKIGF 343


>gi|291165847|gb|EFE27894.1| tryptophan--tRNA ligase [Filifactor alocis ATCC 35896]
          Length = 331

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 141/344 (40%), Positives = 209/344 (60%), Gaps = 24/344 (6%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQP+G + LGNYLG + N    Q+   +  ++ I D+HAIT     + LR  + L +A
Sbjct: 8   SGVQPSGRITLGNYLGALSNWTTLQD--EYECIFSIVDMHAITVPQNPKELRENALLLLA 65

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LA G+DP ++ IF QS V  HA+LSW+LS +  MG +N M Q+KEKS++N  +  + G
Sbjct: 66  QYLAIGIDPQKSTIFIQSHVPEHAELSWVLSTMTYMGELNRMTQYKEKSQKN-SDNLNAG 124

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YPVLMAADILLY    VPVG DQ+QHLE+ R +A RFN  +                
Sbjct: 125 LFTYPVLMAADILLYCTDLVPVGADQKQHLELARDLANRFNHRYSDT------------- 171

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                FP+ EG     A+R+ SL++ +KKMSKSD+++   I+LLD  D+I KKI++A TD
Sbjct: 172 -----FPVPEGFFPKVAARVMSLQEPNKKMSKSDANENGFISLLDEHDVIIKKIKRAVTD 226

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
              +   V   + +   KNL+EI++ M    IE  + ++GGK +  FK   A+ V E + 
Sbjct: 227 SVGI---VQYNDEQAGIKNLLEIYSKMTGESIESIVAKYGGKGYGDFKQDTAEIVAEGLR 283

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           P+ +K + LL DK+YL+++  EGA +A   A++T++ V++ +G 
Sbjct: 284 PVREKTKELLSDKAYLESVYREGAEKAEAIARKTLRKVHKKIGF 327


>gi|253681433|ref|ZP_04862230.1| tryptophan--tRNA ligase [Clostridium botulinum D str. 1873]
 gi|253561145|gb|EES90597.1| tryptophan--tRNA ligase [Clostridium botulinum D str. 1873]
          Length = 334

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 130/347 (37%), Positives = 212/347 (61%), Gaps = 24/347 (6%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           +  SG+QP+G L LGNYLG ++N ++ Q+  +    Y I D+HAIT     ++LR ++  
Sbjct: 9   VIFSGIQPSGDLTLGNYLGALKNWVKLQDEYD--CYYCIVDMHAITVKQQPKDLRRRTLE 66

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
            ++ ++AAG+DP +N IF QS V  HA+ +WIL+C + MG ++ M Q+K+KS++      
Sbjct: 67  LLSIYVAAGIDPEKNTIFIQSHVPAHAEAAWILNCNSYMGELSRMTQYKDKSQKYGNNIG 126

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
            +GLF YPVLMAADILLY+   VPVG+DQ+QHLE+TR IA+RFN  +             
Sbjct: 127 -VGLFTYPVLMAADILLYQTDLVPVGKDQKQHLELTRDIAERFNGAYSPT---------- 175

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F + E  I  + ++I  L++ +KKMSKS  +  S I ++D P++I KKI +A
Sbjct: 176 --------FKVPEPYIPEAGAKIMDLQEPTKKMSKSSDNPNSFILIMDPPEVIRKKISRA 227

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
            TD   +   V   + +   KNL+ I + ++   +EE  + + G+ ++QFK  +A+A++E
Sbjct: 228 VTDSLGV---VKYSDEQPGVKNLMTILSVIKGKSVEEIEEDYKGQGYAQFKKDVAEAIVE 284

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           E+ PI +K++ L+ +K YL++I  +GA +A   A +T++ + +  G 
Sbjct: 285 ELTPIQEKVKELVSNKEYLESIYKKGAEKANYVATKTLRKMQKKTGF 331


>gi|292489888|ref|YP_003532778.1| tryptophanyl-tRNA synthetase [Erwinia amylovora CFBP1430]
 gi|292900926|ref|YP_003540295.1| tryptophanyl-tRNA synthetase [Erwinia amylovora ATCC 49946]
 gi|291200774|emb|CBJ47908.1| tryptophanyl-tRNA synthetase [Erwinia amylovora ATCC 49946]
 gi|291555325|emb|CBA23667.1| Tryptophanyl-tRNA synthetase [Erwinia amylovora CFBP1430]
          Length = 334

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 133/350 (38%), Positives = 203/350 (58%), Gaps = 21/350 (6%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  +  SG QP+G L +GNY+G +R  ++ Q+  ++  +Y I DLHAIT       LR  
Sbjct: 2   SKPIVFSGAQPSGELTIGNYMGALRQWVQMQD--DYHCIYCIVDLHAITVRQDPVALRKA 59

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           +   +A +LA G+DP ++ IF QS V  H  L WIL+C    G ++ M QFK+KS    E
Sbjct: 60  TLDTLALYLACGIDPQKSTIFVQSHVPEHTQLGWILNCYTYFGELSRMTQFKDKST-RYE 118

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
           E  + GLF YPVLMAADILLY+ T VPVGEDQ+QHLE++R +A RFN  +          
Sbjct: 119 ENINAGLFDYPVLMAADILLYQTTQVPVGEDQKQHLELSRDVASRFNALY---------- 168

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
                      F + E  I  S +R+ SL + +KKMSKSD +  + I LL++P  + KKI
Sbjct: 169 --------GDIFKVPEPFIPKSGARVMSLLEPTKKMSKSDDNRNNVIGLLEDPKSVVKKI 220

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           ++A TDGD  P     ++ +    NL++I + +    +    +QF G+ +   K A+A+A
Sbjct: 221 KRAMTDGDEPPVVRYDVKEKPGVSNLLDILSGVTGTPVSGLEQQFAGQMYGHLKGAVAEA 280

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           V   ++ + ++      D+++L+ ++ EGA++AR +AQET+K V + +G 
Sbjct: 281 VSGMLLELQERYHRYRNDEAFLEQVMREGADKARAQAQETLKKVYQAIGF 330


>gi|259910034|ref|YP_002650390.1| tryptophanyl-tRNA synthetase [Erwinia pyrifoliae Ep1/96]
 gi|224965656|emb|CAX57188.1| Tryptophanyl-tRNA synthetase [Erwinia pyrifoliae Ep1/96]
 gi|283480132|emb|CAY76048.1| trpS [Erwinia pyrifoliae DSM 12163]
 gi|310765636|gb|ADP10586.1| tryptophanyl-tRNA synthetase [Erwinia sp. Ejp617]
          Length = 334

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 135/350 (38%), Positives = 202/350 (57%), Gaps = 21/350 (6%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  +  SG QP+G L +GNY+G +R  ++ Q+  ++  +Y I DLHAIT       LR  
Sbjct: 2   SKPIVFSGAQPSGELTIGNYMGALRQWVQMQD--DYHCIYCIVDLHAITVRQDPVALRKA 59

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           +   +A +LA G+DP ++ IF QS V  HA L WIL+C    G ++ M QFK+KS    E
Sbjct: 60  TLDTLALYLACGIDPQKSTIFVQSHVPEHAQLGWILNCYTYFGELSRMTQFKDKSARY-E 118

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
           E  + GLF YPVLMAADILLY+ T VPVGEDQ+QHLE++R +A RFN  +          
Sbjct: 119 ENINAGLFDYPVLMAADILLYQTTQVPVGEDQKQHLELSRDVASRFNALYGE-------- 170

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
                      F + E  I  S +R+ SL + +KKMSKSD +  + I LL++P  + KKI
Sbjct: 171 ----------IFKVPEPFIPKSGARVMSLLEPTKKMSKSDDNRNNVIGLLEDPKSVVKKI 220

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           ++A TDGD  P     ++ +    NL++I + +    I    +QF G+ +   K A+A+A
Sbjct: 221 KRAMTDGDEPPVVRYDVKEKPGIANLLDILSGVTGTPIAALEQQFAGQMYGHLKGAVAEA 280

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           V   +  + ++      D+++L+ ++ EGA +AR +AQET+K V + +G 
Sbjct: 281 VSGMLSELQERYHRYRNDEAFLEQVMREGAQKARAQAQETLKKVYQAIGF 330


>gi|281347493|gb|EFB23077.1| hypothetical protein PANDA_018220 [Ailuropoda melanoleuca]
          Length = 346

 Score =  241 bits (614), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 137/347 (39%), Positives = 208/347 (59%), Gaps = 29/347 (8%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF-- 67
           SG+QPTG+ HLGNYLG I   +R QE  + L +Y I DLH+IT  + Q+    Q  +   
Sbjct: 25  SGIQPTGIPHLGNYLGAIEAWVRLQEE-HGLVLYSIVDLHSIT--VAQDPALLQQSILDM 81

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A  LA G++P ++I+F+QS V  H  LSWIL+C+ R+  + ++ Q+K K    K    +
Sbjct: 82  TAVLLACGINPEKSILFQQSQVPEHTQLSWILTCMVRLPRLQHLHQWKAKIATQKH-GGT 140

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GL  YPVL AADILLYR+THVPVGEDQ QH+E+ + +A+ FN           +KY + 
Sbjct: 141 VGLLTYPVLQAADILLYRSTHVPVGEDQVQHMELVQDLAREFN-----------KKYGE- 188

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                 FFP+   ++ +S  +++SLRD S KMSKSD    + + + D+P+ I +K +KA 
Sbjct: 189 ------FFPVPRSIL-TSMKKVKSLRDPSAKMSKSDPDKLATVRITDSPEEIVQKFRKAM 241

Query: 248 TDGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
           TD     SEV+     R    NL+ I A +  + +EEAL+   G + +++KL +ADAVI+
Sbjct: 242 TD---FTSEVTYEPARRAGVSNLVAIHAAVAGLPVEEALRLGAGMDTARYKLLVADAVIQ 298

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
              PI ++I+ L  D+S+L+ +L  G+ +A+  A    + V ++VG 
Sbjct: 299 RFAPIKREIEKLKMDRSHLEKVLQVGSAKAKELAHPVCQEVKKLVGF 345


>gi|295838560|ref|ZP_06825493.1| tryptophan-tRNA ligase [Streptomyces sp. SPB74]
 gi|197697815|gb|EDY44748.1| tryptophan-tRNA ligase [Streptomyces sp. SPB74]
          Length = 337

 Score =  241 bits (614), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 134/355 (37%), Positives = 195/355 (54%), Gaps = 25/355 (7%)

Query: 1   MLSSDNLFVSGVQPT-GVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQEN 59
           M S     +SG+QP+ G  HLGNYLG +R  +  QET  H   Y + DLHAIT       
Sbjct: 1   MASERTRVLSGIQPSAGSFHLGNYLGAVRQWVALQET--HDAFYMVVDLHAITVPQDPAT 58

Query: 60  LRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSK 119
           LR  +RL  A  LAAG+DP R+ +F QS +  HA+L+W+++C+   G  + M QFK+KS 
Sbjct: 59  LRANTRLSAAQLLAAGIDPERSALFVQSHMREHAELAWVMNCLTGFGEASRMTQFKDKSA 118

Query: 120 ENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKE 179
           +   E  ++GLF YPVL  ADILLY+A  VPVGEDQRQH+E+TR +A+RFN  +      
Sbjct: 119 KQGAEGTTVGLFTYPVLQVADILLYQAHQVPVGEDQRQHVELTRDLAERFNARYGET--- 175

Query: 180 VAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDII 239
                          F + E  I    ++I  L++ + KMSKS +S    +NL+D P   
Sbjct: 176 ---------------FVVPEAYIVKETAKIYDLQEPTAKMSKSAASPKGLVNLMDEPKAT 220

Query: 240 AKKIQKAKTDGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKL 298
           AKKI+ A TD +   +E+     ++    NL+ I++ +  + + E  +++ GK +   K 
Sbjct: 221 AKKIRSAVTDTE---TEIRFDRAHKPGVSNLLGIYSNLTGVTVPELEEKYAGKGYGALKT 277

Query: 299 ALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            LAD V++ + P   +    L D + LD IL  GA +AR  A  T+    + VG 
Sbjct: 278 DLADVVVDFVTPFRDRTLAYLDDPATLDKILASGAEKAREIAAPTLAAAYDKVGF 332


>gi|188535313|ref|YP_001909110.1| tryptophanyl-tRNA synthetase [Erwinia tasmaniensis Et1/99]
 gi|188030355|emb|CAO98246.1| Tryptophanyl-tRNA synthetase [Erwinia tasmaniensis Et1/99]
          Length = 334

 Score =  241 bits (614), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 136/350 (38%), Positives = 201/350 (57%), Gaps = 21/350 (6%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  +  SG QP+G L +GNY+G +R  +R Q+  + +  Y I DLHAIT       LR  
Sbjct: 2   SKPIVFSGAQPSGELTIGNYMGALRQWVRMQDDFHCI--YCIVDLHAITVRQDPVALRKA 59

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           +   +A +LA G+DP ++ IF QS V  H  LSWIL+C    G ++ M QFK+KS    E
Sbjct: 60  TLDTLALYLACGIDPQKSTIFVQSHVPEHTQLSWILNCYTYFGELSRMTQFKDKSARY-E 118

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
           E  + GLF YPVLMAADILLY+ T VPVGEDQ+QHLE++R +A RFN  +          
Sbjct: 119 ENINAGLFDYPVLMAADILLYQTTQVPVGEDQKQHLELSRDVASRFNALY---------- 168

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
                      F I E  I  S +R+ SL + +KKMSKSD +  + I LL++P  + KKI
Sbjct: 169 --------GDIFKIPEPFIPKSGARVMSLLEPTKKMSKSDDNRNNVIGLLEDPKSVVKKI 220

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           ++A TDGD  P     ++ +    NL++I + +    I    +QF G+ +   K A+A+A
Sbjct: 221 KRAMTDGDEPPIVRYDIKEKPGVSNLLDILSGVSGTPIAALEQQFAGQMYGHLKGAVAEA 280

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           V   +  + ++      D+++L+ ++ +GA +AR +AQET+K V + +G 
Sbjct: 281 VSGMLSELQERYHRYRNDEAFLEQVMRDGAEKARAQAQETLKKVYQAIGF 330


>gi|301785780|ref|XP_002928305.1| PREDICTED: tryptophanyl-tRNA synthetase, mitochondrial-like
           [Ailuropoda melanoleuca]
          Length = 360

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 137/347 (39%), Positives = 208/347 (59%), Gaps = 29/347 (8%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF-- 67
           SG+QPTG+ HLGNYLG I   +R QE  + L +Y I DLH+IT  + Q+    Q  +   
Sbjct: 39  SGIQPTGIPHLGNYLGAIEAWVRLQEE-HGLVLYSIVDLHSIT--VAQDPALLQQSILDM 95

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A  LA G++P ++I+F+QS V  H  LSWIL+C+ R+  + ++ Q+K K    K    +
Sbjct: 96  TAVLLACGINPEKSILFQQSQVPEHTQLSWILTCMVRLPRLQHLHQWKAKIATQKH-GGT 154

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GL  YPVL AADILLYR+THVPVGEDQ QH+E+ + +A+ FN           +KY + 
Sbjct: 155 VGLLTYPVLQAADILLYRSTHVPVGEDQVQHMELVQDLAREFN-----------KKYGE- 202

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                 FFP+   ++ +S  +++SLRD S KMSKSD    + + + D+P+ I +K +KA 
Sbjct: 203 ------FFPVPRSIL-TSMKKVKSLRDPSAKMSKSDPDKLATVRITDSPEEIVQKFRKAM 255

Query: 248 TDGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
           TD     SEV+     R    NL+ I A +  + +EEAL+   G + +++KL +ADAVI+
Sbjct: 256 TD---FTSEVTYEPARRAGVSNLVAIHAAVAGLPVEEALRLGAGMDTARYKLLVADAVIQ 312

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
              PI ++I+ L  D+S+L+ +L  G+ +A+  A    + V ++VG 
Sbjct: 313 RFAPIKREIEKLKMDRSHLEKVLQVGSAKAKELAHPVCQEVKKLVGF 359


>gi|219871946|ref|YP_002476321.1| tryptophanyl-tRNA synthetase [Haemophilus parasuis SH0165]
 gi|219692150|gb|ACL33373.1| tryptophanyl-tRNA synthetase [Haemophilus parasuis SH0165]
          Length = 342

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 136/329 (41%), Positives = 197/329 (59%), Gaps = 11/329 (3%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  +  SGVQP+G L LGNYLG +RN ++ Q+   +  ++ I D HAIT     E LR  
Sbjct: 2   SKPIVFSGVQPSGELSLGNYLGALRNWVKMQD--EYECLFCIVDSHAITVRQDPEALRKA 59

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           +   +A +LA G+DP+++ IF QS V  H+ L+WIL+C    G M  M QFK+KS  + E
Sbjct: 60  TLDTLAIYLACGIDPAKSTIFIQSHVPEHSQLAWILNCYTYFGEMGRMTQFKDKSARH-E 118

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
           +  ++GLF YPVLMAADILLY+A  VPVG+DQ+QHLEITR IA RFN  + +K       
Sbjct: 119 DNVNVGLFTYPVLMAADILLYQANQVPVGDDQKQHLEITRDIANRFNALYGKK------- 171

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
              E    +  F + E  I  + +RI SL + +KKMSKSD +  + I LL++P  +AKKI
Sbjct: 172 -DAEGNVLEPIFAVPEVFIAKTGARIMSLLEPTKKMSKSDDNRNNVIGLLEDPKSVAKKI 230

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           ++A TDGD  P     ++N+    NL++I A++    I E   +F GK +   K A+AD 
Sbjct: 231 KRAMTDGDEPPVVRYDVQNKPGVSNLLDILASVTGKTIPELETEFEGKMYGHLKTAVADE 290

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEG 332
           V   +  + ++  H   +++ L++I  EG
Sbjct: 291 VSAMLSQLQERYHHFRNNEALLESIYREG 319


>gi|229821438|ref|YP_002882964.1| tryptophanyl-tRNA synthetase [Beutenbergia cavernae DSM 12333]
 gi|229567351|gb|ACQ81202.1| tryptophanyl-tRNA synthetase [Beutenbergia cavernae DSM 12333]
          Length = 344

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 143/351 (40%), Positives = 199/351 (56%), Gaps = 35/351 (9%)

Query: 10  SGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           SG+QPT   LHLGNYLG +   +  Q+T  H  +Y + DLHA+T       LR ++R   
Sbjct: 14  SGMQPTADSLHLGNYLGALTQWVALQDT--HDAIYCVVDLHALTVAPDPAVLRERTRRTA 71

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LAAGVDP+R+++F QS V  HA+L+W+L C+   G    M QFK+KS +   E  ++
Sbjct: 72  AQYLAAGVDPARSVLFVQSHVAEHAELAWVLGCLTGYGEAARMTQFKDKSAKQGAEGTTV 131

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GLF YPVLMAADILLYR   VPVGEDQRQHLE++R +AQR N+ +               
Sbjct: 132 GLFTYPVLMAADILLYRTNVVPVGEDQRQHLELSRDLAQRMNSRY--------------- 176

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                  P+ E  I    ++I  L D + KMSKS+ S    I LLD+P +IAK+I+ A T
Sbjct: 177 ---GPLVPVPEAHIVREVAKIYDLADPTSKMSKSNGSVNGIIELLDDPKVIAKRIRSAVT 233

Query: 249 DGDVLPSEVSGLENRL--EAK----NLIEIFATMRQIKIEEALKQFGGKNFSQFKLALAD 302
           D        +G E R   EAK    NL+ I + +    + E   +F G+ +   K+ +AD
Sbjct: 234 D--------TGTEVRFDPEAKPGVSNLLTIHSALSGTPVAELEDRFAGRGYGHLKVEVAD 285

Query: 303 AVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            V+E + P+ + ++  L     LD +L EGA RAR  A+ T+  V + VGL
Sbjct: 286 VVVEALTPLREAVEGWLAQPEKLDDVLAEGAERARAIARGTLGDVYDAVGL 336


>gi|317049881|ref|YP_004117529.1| tryptophanyl-tRNA synthetase [Pantoea sp. At-9b]
 gi|316951498|gb|ADU70973.1| tryptophanyl-tRNA synthetase [Pantoea sp. At-9b]
          Length = 334

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 138/350 (39%), Positives = 202/350 (57%), Gaps = 21/350 (6%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  +  SG QP+G L +GNY+G +R  ++ Q+  + +  Y I DLHAIT       LR  
Sbjct: 2   SKPIVFSGAQPSGELTIGNYMGALRQWVQMQDDFHCI--YCIVDLHAITVRQDPVALRKA 59

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           +   +A +LA G+DP+++ IF QS V  HA LSWIL+C A  G ++ M QFK+KS    E
Sbjct: 60  TLDTLALYLACGIDPNKSTIFVQSHVPEHAQLSWILNCYAYFGELSRMTQFKDKSAR-YE 118

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
           E  + GLF YPVLMAADILLY+   VPVGEDQ+QHLE++R IAQRFN  +          
Sbjct: 119 ENINAGLFDYPVLMAADILLYQTNQVPVGEDQKQHLELSRDIAQRFNALY---------- 168

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
                      F + E  I  S +R+ SL + +KKMSKSD +  + I LL++P  + KKI
Sbjct: 169 --------GDIFKVPEPFIPKSGARVMSLLEPTKKMSKSDDNRNNVIGLLEDPKSVVKKI 220

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           ++A TD +  P     ++ +    NL++I + +    + E  ++F GK +   K A+ADA
Sbjct: 221 KRAVTDSEEPPVVRYDIKEKAGVSNLLDILSGVTGKTVTELEQEFEGKMYGHLKGAVADA 280

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           V   +  + ++      D+ +L+ ++ +GA +AR  AQET+K V E VG 
Sbjct: 281 VSGMLTELQERYNRYRNDEDFLNQVMRDGAAKARAHAQETLKKVYEAVGF 330


>gi|330814795|ref|XP_003291416.1| hypothetical protein DICPUDRAFT_156014 [Dictyostelium purpureum]
 gi|325078409|gb|EGC32062.1| hypothetical protein DICPUDRAFT_156014 [Dictyostelium purpureum]
          Length = 383

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 137/357 (38%), Positives = 208/357 (58%), Gaps = 31/357 (8%)

Query: 10  SGVQPT-GVLHLGNYLGMIRNVIRRQE--------TCNHLGMYFIADLHAIT--NNIVQE 58
           SG+QPT   LHLGNYLG + N ++ Q+        +  H  ++ I DLH++T    +  +
Sbjct: 47  SGMQPTSAALHLGNYLGAMDNWLKIQDLIAKHNEVSPGHKLIFSIVDLHSLTATKTLSPK 106

Query: 59  NLRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKS 118
            L   +     ++LA+G+DP + I+F QS V  H++L+WI +C+A    ++ M+QFKEKS
Sbjct: 107 ELHSNTLSVAINYLASGIDPQKVILFNQSMVAAHSELTWIFNCIASFSKLSTMVQFKEKS 166

Query: 119 KENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIK 178
           K N  ++ S GL  YPVLMAADILLYRATHVPVG+DQ QH+E TR I   F+        
Sbjct: 167 KSN-SQSISNGLLSYPVLMAADILLYRATHVPVGDDQTQHIEFTREIVNSFH-------- 217

Query: 179 EVAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDI 238
                      Y K +FP+   +   ++ RI SL+D   KMSKSD SD SRI+L D  ++
Sbjct: 218 ---------HTYKKKYFPLPTIISSETSKRIMSLQDGRVKMSKSDPSDLSRISLTDTDEM 268

Query: 239 IAKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKL 298
           I  KI+K+KTD  +  S    ++NR +  NL+ I +    + I +  K+F  K  S FK 
Sbjct: 269 IQMKIKKSKTDSIIGISY--DIQNRPDISNLLSIASVTSGVSIADLEKEFKDKQNSHFKD 326

Query: 299 ALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLSH 355
            ++ ++I ++ PI +KI +   ++  +  IL+EG+++A   A   +K + +I+GL H
Sbjct: 327 FVSQSIISKVKPIREKINYYQANEKIVRDILLEGSDKANQIAINNLKQIKDIIGLYH 383


>gi|307132890|ref|YP_003884906.1| tryptophan-tRNA ligase [Dickeya dadantii 3937]
 gi|306530419|gb|ADN00350.1| tryptophan-tRNA ligase [Dickeya dadantii 3937]
          Length = 334

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 137/350 (39%), Positives = 199/350 (56%), Gaps = 21/350 (6%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  +  SG QP+G L +GNY+G +R  +  Q+  + +  Y I D HAIT     + LR  
Sbjct: 2   SKPIVFSGAQPSGELTIGNYMGALRQWVNMQDDFDCI--YCIVDQHAITVRQDPQQLRKA 59

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           +   +A +LA G+DP ++ IF QS V  HA L W+L+C    G ++ M QFK+KS    E
Sbjct: 60  TLDTLALYLACGIDPQKSTIFVQSHVPEHAQLGWLLNCYTYFGELSRMTQFKDKSAR-YE 118

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
           E  + GLF YPVLMAADILLY+   VPVGEDQ+QHLE++R IAQRFNT +          
Sbjct: 119 ENINAGLFDYPVLMAADILLYQTNQVPVGEDQKQHLELSRDIAQRFNTIYGE-------- 170

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
                      F I E  I  S +R+ SL + ++KMSKSD +  + I LL++P  + KKI
Sbjct: 171 ----------IFRIPEPFIPKSGARVMSLLEPTRKMSKSDDNRNNVIGLLEDPKSVVKKI 220

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           ++A TD D  P     L+N+    NL++I + +    I E  K F G+ +   K A+ADA
Sbjct: 221 KRAVTDSDEPPVVRYDLQNKAGVSNLLDILSGVTGKSIPELEKAFDGQMYGHLKGAVADA 280

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           V   +  +  +      D+++L  ++ +GA +A  RAQET++ V ++VG 
Sbjct: 281 VSGMLSELQARYHRFRDDEAFLQQVMRDGAQKASARAQETLRKVYDVVGF 330


>gi|256397068|ref|YP_003118632.1| tryptophanyl-tRNA synthetase [Catenulispora acidiphila DSM 44928]
 gi|256363294|gb|ACU76791.1| tryptophanyl-tRNA synthetase [Catenulispora acidiphila DSM 44928]
          Length = 346

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 136/346 (39%), Positives = 193/346 (55%), Gaps = 25/346 (7%)

Query: 10  SGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           SG+QPT    H+GNYLG IR  +  QET  H  +Y + DLHAIT     + LR ++R+  
Sbjct: 18  SGIQPTADSFHVGNYLGAIRQWVPLQET--HDTVYCVVDLHAITVEQDPKLLRQRTRVAA 75

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A  +AAG+DP R+ +F QS V  HA L+W+L+C+   G    M QFK+KS +      ++
Sbjct: 76  AQLMAAGIDPGRSTLFVQSHVPEHAQLAWVLTCMTGFGEAGRMTQFKDKSGKQGSANTNV 135

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GLF YP+LMAAD+LLY A  VPVGEDQRQHLE+TR +AQRFN  +               
Sbjct: 136 GLFTYPMLMAADVLLYNADEVPVGEDQRQHLELTRDLAQRFNGRY--------------- 180

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                +F + +  I  +  +I  L++   KMSKS SS    I LLD+P + AKKI+ A T
Sbjct: 181 ---GAYFTVPDPYIIKATGKITDLQEPGAKMSKSASSPAGIIELLDDPKVSAKKIRSAVT 237

Query: 249 DGDVLPSEVSGLE-NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
           D +    E+   E N+    NL+ I++ +    I E    + GK +   K  LA+  ++ 
Sbjct: 238 DTE---REIRYDEQNKAGISNLLSIYSALDGRTIAELETAYEGKGYGDLKKDLAEVFVDF 294

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + P  ++ Q +L +   LD +L EGA +AR  A  T+  V + VG 
Sbjct: 295 VTPFRERTQAILAEPDKLDAVLAEGAAKARAIATRTLAEVYDRVGF 340


>gi|328865159|gb|EGG13545.1| tryptophanyl-tRNA synthetase [Dictyostelium fasciculatum]
          Length = 411

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 145/374 (38%), Positives = 203/374 (54%), Gaps = 53/374 (14%)

Query: 10  SGVQPT-GVLHLGNYLGMIRNVIRRQ------------------ETCNHLGMYFIADLHA 50
           SG+QPT G LH+GNY G + N I  Q                  E  +   ++ I DLH+
Sbjct: 59  SGMQPTNGGLHIGNYSGAMLNWIELQNSIARNEAKIAKDGGGAGEDSSSSLLFSIVDLHS 118

Query: 51  ITNNIVQE-NLRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMN 109
           +TN  VQ  +LR  +      ++A G+DP + ++F QS V  H +LSWILSC   +G + 
Sbjct: 119 LTNKAVQPASLRKNTVDVAIEYVACGIDPDKVVLFNQSQVPAHCELSWILSCHTALGRLE 178

Query: 110 NMIQFKEKSKENKEET--ASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQ 167
           NMIQFKEKSK+N +    ++ GL  YP+LMAADILLYRATHVPVGEDQ QH+E+TR IA 
Sbjct: 179 NMIQFKEKSKKNTDSAVQSTYGLLAYPILMAADILLYRATHVPVGEDQTQHVELTRKIAH 238

Query: 168 RFNTEFERKIKEVAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDF 227
            FN                   Y   +FP+ + +  S + RI SL++A+ KMSKSD S+ 
Sbjct: 239 AFNA-----------------HYKTDYFPLPQIVSTSESKRIMSLQNAASKMSKSDVSEN 281

Query: 228 SRINLLDNPDIIAKKIQKAKTDGDVLPSEVSGLE----NRLEAKNLIEIFATM----RQI 279
           SRINL D+ + IAKKI KA TD  +      G+      R    NL+ I + M    + +
Sbjct: 282 SRINLTDSNETIAKKISKAATDSTI------GITYDTVTRPNIANLLAIASAMMPSTQPL 335

Query: 280 KIEEALKQFGGKNFSQFKLALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCR 339
              +   QF     S+FK  L   +   + PI +KI++   +  Y+  IL +G++RAR  
Sbjct: 336 SPADIASQFTNAKHSEFKSFLTQTITNHLAPIREKIEYHQANPKYIKEILQKGSHRARSI 395

Query: 340 AQETMKYVNEIVGL 353
           A   +  +  I+GL
Sbjct: 396 ANRNLTDIKNIIGL 409


>gi|119717779|ref|YP_924744.1| tryptophanyl-tRNA synthetase [Nocardioides sp. JS614]
 gi|119538440|gb|ABL83057.1| tryptophanyl-tRNA synthetase [Nocardioides sp. JS614]
          Length = 352

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 136/352 (38%), Positives = 198/352 (56%), Gaps = 35/352 (9%)

Query: 9   VSGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SG+QPT    H GNYLG +R  +  QE  ++   +FIADLHAIT     + LR ++   
Sbjct: 24  LSGIQPTADSFHFGNYLGALRQWVDLQE--DYQPFFFIADLHAITVEQDPKVLRERTLRA 81

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A  +A G+DP R+ IF QS V  HA L W+L C+   G    M QFK+KS +  E  AS
Sbjct: 82  AAQLIAMGIDPDRSAIFVQSQVPEHAQLGWVLQCLTGFGEARRMTQFKDKSAKGGEGAAS 141

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GLF YP+L AADILLYR  +VPVGEDQRQHLE+TR +AQRFN+ +++            
Sbjct: 142 VGLFTYPILQAADILLYRPHYVPVGEDQRQHLELTRDLAQRFNSRYKKT----------- 190

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F + E  I  + ++I  L+D + KMSKS SS    + +LD+P + AKKI+ A 
Sbjct: 191 -------FRLPEPYILKATAKITDLQDPTSKMSKSASSPSGIVEMLDDPRVSAKKIRSAV 243

Query: 248 TDGDVLPSEVSGLENRLEAK------NLIEIFATMRQIKIEEALKQFGGKNFSQFKLALA 301
           TD        SG E R + +      NL+ IF+ +    + +  +++ G+ +   K  LA
Sbjct: 244 TD--------SGSEIRFDPETKPGVSNLLTIFSALTGRAVSDLEEEYEGRGYGDLKKELA 295

Query: 302 DAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + V++ + P  ++   LL D++YL  +L  GA +A   A  T++ V + VG 
Sbjct: 296 ETVVDFVTPFRERTLELLDDQAYLTDVLRRGAEQAGAVAATTLRDVYQRVGF 347


>gi|108798183|ref|YP_638380.1| tryptophanyl-tRNA synthetase [Mycobacterium sp. MCS]
 gi|119867279|ref|YP_937231.1| tryptophanyl-tRNA synthetase [Mycobacterium sp. KMS]
 gi|108768602|gb|ABG07324.1| tryptophanyl-tRNA synthetase [Mycobacterium sp. MCS]
 gi|119693368|gb|ABL90441.1| tryptophanyl-tRNA synthetase [Mycobacterium sp. KMS]
          Length = 344

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 134/346 (38%), Positives = 195/346 (56%), Gaps = 25/346 (7%)

Query: 10  SGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           SGVQPT   LHLGN LG + +    Q+  ++   + + DLHAIT     E LRY++ +  
Sbjct: 17  SGVQPTSDSLHLGNALGAVTHWTALQD--DYDAYFCVVDLHAITVPQDPETLRYRTLVTA 74

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+DP+R+ +F QS V  H +L+W+L C    G  + M QFK+KS++   +  ++
Sbjct: 75  AQYLALGIDPARSTVFVQSHVPAHTELAWVLGCFTGFGQASRMTQFKDKSQKQGADATTV 134

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GLF YPVLMAAD+LLY    VPVGEDQRQHLE+ R +AQRFN  F               
Sbjct: 135 GLFTYPVLMAADVLLYDTDLVPVGEDQRQHLELARDVAQRFNARFPDT------------ 182

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                 F I E +I  + ++I  L+D + KMSKS  +D   I LLD+P   AKKI+ A T
Sbjct: 183 ------FVIPEPMIPKATAKIYDLQDPTAKMSKSAGTDAGLITLLDDPKKTAKKIRSAVT 236

Query: 249 DGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
           D +    E+    E +    NL+ I A +    ++  ++ + G+ +   K   ADAV+E 
Sbjct: 237 DSE---REIRFDREQKAGVSNLLTIQAAVTGTDVDVLVEAYQGRGYGDLKKDTADAVVEF 293

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + PI  ++  LL D + L+ +L  GA RAR    +T++ V + +GL
Sbjct: 294 VTPIKTRVDELLADPAELEGVLATGAERARDVTAKTLQRVYDRLGL 339


>gi|312174072|emb|CBX82325.1| Tryptophanyl-tRNA synthetase [Erwinia amylovora ATCC BAA-2158]
          Length = 334

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 133/350 (38%), Positives = 202/350 (57%), Gaps = 21/350 (6%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  +  SG QP+G L +GNY+G +R  ++ Q+  ++  +Y I DLHAIT       LR  
Sbjct: 2   SKPIVFSGAQPSGELTIGNYMGALRQWVQMQD--DYHCIYCIVDLHAITVRQDPVALRKA 59

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           +   +A +LA G+DP ++ IF QS V  H  L WIL+C    G ++ M QFK+KS    E
Sbjct: 60  TLDTLALYLACGIDPQKSTIFVQSHVPEHTQLGWILNCYTYFGELSRMTQFKDKSTRY-E 118

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
           E  + GLF YPVLMAADILLY+ T VPVGEDQ+QHLE++R +A RFN  +          
Sbjct: 119 ENINAGLFDYPVLMAADILLYQTTQVPVGEDQKQHLELSRDVASRFNALY---------- 168

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
                      F + E  I  S +R+ SL + +KKMSKSD +  + I LL++P  + KKI
Sbjct: 169 --------GDIFKVPEPFIPKSGARVMSLLEPTKKMSKSDDNRNNVIGLLEDPKSVVKKI 220

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           ++A TDGD  P     ++ +    NL++I + +    +    +QF G+ +   K A+A+A
Sbjct: 221 KRAMTDGDEPPVVRYDVKEKPGVSNLLDILSGVTGTPVSGLEQQFAGQMYGHLKGAVAEA 280

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           V   ++ + ++      D+++L+ ++ EGA +AR +AQET+K V + +G 
Sbjct: 281 VSGMLLELQERYHRYRNDEAFLEQVMREGAEKARAQAQETLKKVYQAIGF 330


>gi|262273417|ref|ZP_06051231.1| tryptophanyl-tRNA synthetase [Grimontia hollisae CIP 101886]
 gi|262222395|gb|EEY73706.1| tryptophanyl-tRNA synthetase [Grimontia hollisae CIP 101886]
          Length = 338

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 137/351 (39%), Positives = 199/351 (56%), Gaps = 21/351 (5%)

Query: 3   SSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRY 62
           ++  + +SGVQP+G L +GNY+G +R   + Q+  ++   Y I DLHAIT     E LR 
Sbjct: 5   TTKPIVLSGVQPSGELSIGNYIGALRQWEQMQD--DYDCQYCIVDLHAITVRQQAEKLRE 62

Query: 63  QSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENK 122
            +   +A  LA GV P ++ +F QS V  HA L W+L+C A+MG +N M QFK+KS+ + 
Sbjct: 63  ATLDSLALCLAVGVSPEKSNLFIQSHVPEHAQLGWVLNCYAQMGELNRMTQFKDKSQRHA 122

Query: 123 EETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQ 182
           E   + GLF YPVLMAADILLY+A  VPVG DQ+QHLE+ R IA RFN  +         
Sbjct: 123 ENINA-GLFGYPVLMAADILLYQANQVPVGNDQKQHLELARDIAIRFNNLYGE------- 174

Query: 183 KYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKK 242
                       F + E  I    +R+ SL+D +KKMSKSD +  + I LL++P  IAKK
Sbjct: 175 -----------VFTVPEPYIPQVGARVMSLQDPTKKMSKSDDNRNNVIGLLEDPKSIAKK 223

Query: 243 IQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALAD 302
           I++A TD D  P  +  +EN+    NL+ + +        E   ++  K +   K   AD
Sbjct: 224 IKRAVTDSDEPPRVLFDIENKPGVANLMGLMSVATGKSFAEIEAEYADKMYGHLKTDTAD 283

Query: 303 AVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           AV+  + P+  + +    D++YLD ++  GA +A  RA  T+K V ++VG 
Sbjct: 284 AVVAMLEPVQARYKEYRADRTYLDQVMKTGAEKASARAAYTLKKVYDVVGF 334


>gi|34556747|ref|NP_906562.1| tryptophanyl-tRNA synthetase [Wolinella succinogenes DSM 1740]
 gi|39932013|sp|Q7MAE0|SYW_WOLSU RecName: Full=Tryptophanyl-tRNA synthetase; AltName:
           Full=Tryptophan--tRNA ligase; Short=TrpRS
 gi|34482461|emb|CAE09462.1| TRYPTOPHANYL-TRNA SYNTHETASE [Wolinella succinogenes]
          Length = 328

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 146/348 (41%), Positives = 204/348 (58%), Gaps = 32/348 (9%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QPTG +HLGNYLG ++N +  Q+  +++  + I + HAIT       LR ++    A
Sbjct: 8   SGIQPTGNIHLGNYLGAVKNWVDSQDEFDNI--FCIVNSHAITIKQDPALLRAKTYELAA 65

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
             LA G+D  ++ +F QS+V  HA L+WIL C   MG M+ M QFK+KS++N +   ++G
Sbjct: 66  VLLACGIDMKKSKLFIQSEVDEHAALAWILDCNIPMGDMSRMTQFKDKSQKNPKNI-NIG 124

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LMAADILLY+   VPVGEDQ+QHLE+TR +A+RFN ++                
Sbjct: 125 LFNYPALMAADILLYQTDFVPVGEDQKQHLELTRDVAERFNRDYGET------------- 171

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                F I E +I    +RI  L D +KKMSKS+      I LLD PD I KK +KA TD
Sbjct: 172 -----FKIPEPMIPKMGARIMGLDDPTKKMSKSEGKPNHGIALLDTPDEILKKFKKATTD 226

Query: 250 GDVL----PSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVI 305
            + L    P ++ G+ N L    + +IF    Q  IE    +F GK +  FK+A+A+AVI
Sbjct: 227 SENLVRFNPEQI-GIFNLL---TIYQIFTGYSQEVIE---AEFEGKGYGIFKVAVAEAVI 279

Query: 306 EEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           E + PI ++   L K++ YL+ +L  GA+  R  AQ+T K V E VGL
Sbjct: 280 EGLKPIQERYAKLTKEQGYLEEVLSHGASEVRKIAQKTYKEVKERVGL 327


>gi|315635243|ref|ZP_07890520.1| tryptophan--tRNA ligase [Aggregatibacter segnis ATCC 33393]
 gi|315475989|gb|EFU66744.1| tryptophan--tRNA ligase [Aggregatibacter segnis ATCC 33393]
          Length = 334

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 138/350 (39%), Positives = 200/350 (57%), Gaps = 21/350 (6%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  +  SGVQP+G L +GNYLG +R  ++ Q+  ++  ++ I D HAIT       LR  
Sbjct: 2   SKPIVFSGVQPSGELTIGNYLGALRQWVKMQD--DYECLFCIVDQHAITVRQDPAALRKA 59

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           +   +A +LA G+DP+++ IF QS V  HA L+W+L+C    G M+ M QFK+KS    E
Sbjct: 60  TLDVLALYLACGIDPAKSTIFIQSHVPEHAQLAWVLNCYTYFGEMSRMTQFKDKSARYAE 119

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
              ++GLF YPVLMAADILLY+A  VPVGEDQ+QHLEITR IAQRFN  +          
Sbjct: 120 NI-NVGLFTYPVLMAADILLYQANQVPVGEDQKQHLEITRDIAQRFNALY---------- 168

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
                      F + E  I  + +R+ SL +  KKMSKSD +  + I LL++P  +AKKI
Sbjct: 169 --------GPHFAVPEVFIPKAGARVMSLLEPEKKMSKSDENRNNVIGLLEDPKAVAKKI 220

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           ++A TD D  P     ++N+    NL++I + +    I E   +F GK +   K A+AD 
Sbjct: 221 KRAVTDSDEPPVIRYDVKNKAGVSNLLDILSGVSGKTIAELELEFEGKMYGHLKGAVADE 280

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           V   +  + ++  H   ++  L  I  +GA +A+ RAQET+  V + +G 
Sbjct: 281 VSAMLTTLQERYHHFRNNEELLLQIAKDGAEKAKARAQETLAKVYDAIGF 330


>gi|318058751|ref|ZP_07977474.1| tryptophanyl-tRNA synthetase [Streptomyces sp. SA3_actG]
          Length = 330

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 131/348 (37%), Positives = 195/348 (56%), Gaps = 25/348 (7%)

Query: 8   FVSGVQPT-GVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
            +SG+QP+ G  HLGNYLG +R  +  QE+  H   Y + D+HAIT     + LR  +RL
Sbjct: 1   MLSGIQPSAGSFHLGNYLGAVRQWVALQES--HDAFYTVVDMHAITVPQDPDTLRANTRL 58

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A  LAAG+DP R+ +F QS V  HA+L+WI++C+   G  + M QFK+K+ +   E  
Sbjct: 59  SAAQLLAAGIDPERSALFVQSHVREHAELAWIMNCLTGFGEASRMTQFKDKAAKQGAEGT 118

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           ++GLF YPVL  ADILLY+A  VPVGEDQRQH+E+TR +A+RFN  +             
Sbjct: 119 TVGLFTYPVLQVADILLYQAHQVPVGEDQRQHVELTRDLAERFNARYGET---------- 168

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F + E  I    ++I  L++ S KMSKS +S    +NL+D P   A+KI+ A
Sbjct: 169 --------FVVPEAYILKETAKIYDLQEPSAKMSKSAASPKGLVNLMDEPKATARKIKSA 220

Query: 247 KTDGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVI 305
            TD +   +E+    EN+    NL+ I++ +  + ++   +++ GK +   K  LA+ V+
Sbjct: 221 VTDTE---TEIRFDRENKPGVSNLLGIYSNLTGVTVQALEEKYAGKGYGALKTDLAEVVV 277

Query: 306 EEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + + P   +    L D + LD IL  GA +AR  A  T+    + VG 
Sbjct: 278 DFVTPFRDRTLEYLDDPATLDKILASGAEKAREVAAPTLAAAYDKVGF 325


>gi|33240513|ref|NP_875455.1| tryptophanyl-tRNA synthetase [Prochlorococcus marinus subsp.
           marinus str. CCMP1375]
 gi|39932091|sp|Q7VBM9|SYW_PROMA RecName: Full=Tryptophanyl-tRNA synthetase; AltName:
           Full=Tryptophan--tRNA ligase; Short=TrpRS
 gi|33238041|gb|AAQ00108.1| Tryptophanyl-tRNA synthetase [Prochlorococcus marinus subsp.
           marinus str. CCMP1375]
          Length = 339

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 150/351 (42%), Positives = 207/351 (58%), Gaps = 30/351 (8%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYF-IADLHAITNNIVQENLRYQSRLF 67
           +SGVQPTG +H+GN+LG IRN +  Q   N    Y  + DLHAIT     + L+  +   
Sbjct: 7   LSGVQPTGAIHIGNWLGAIRNWVSLQ---NEYDTYVCVVDLHAITVPHDPQQLKENTLRT 63

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A ++A G+DP +  IF QS +  H++L W+L+CV  + WM  MIQFKEK+ + + +  S
Sbjct: 64  AALYVACGMDPKKCSIFVQSHISAHSELCWLLNCVTPLNWMERMIQFKEKAIK-QGDNVS 122

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIA-QRFNTEFERKIKEVAQKYAQ 186
           +GL  YPVLMAADILLY A  VPVGEDQ+QHLE+ R IA QR N+ F ++          
Sbjct: 123 IGLLDYPVLMAADILLYDADLVPVGEDQKQHLELARDIAQQRVNSRFNKE---------- 172

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
               SK    I + LI     +I SL D + KMSKSD ++ SRI LLD+P+II KKI++A
Sbjct: 173 ----SKSILKIPKPLIMKEGGKIMSLIDGNMKMSKSDPNENSRIALLDSPEIIKKKIKRA 228

Query: 247 KTDGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALAD 302
           KTD  +      GLE     R EA NL+ I++ +     E   K+F    + +FK  L D
Sbjct: 229 KTDSFL------GLEFDNNQRPEANNLLGIYSMVSNQNREAVQKEFSNIGWGKFKPILTD 282

Query: 303 AVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           A+IE + PI QK   L+KDK+ L+ IL +G  +A   + +T+K V   +G 
Sbjct: 283 AIIESLNPIQQKYYSLIKDKTELNNILNKGYIKANTISNQTLKRVRNALGF 333


>gi|310826436|ref|YP_003958793.1| hypothetical protein ELI_0816 [Eubacterium limosum KIST612]
 gi|308738170|gb|ADO35830.1| hypothetical protein ELI_0816 [Eubacterium limosum KIST612]
          Length = 334

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 133/352 (37%), Positives = 206/352 (58%), Gaps = 25/352 (7%)

Query: 3   SSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRY 62
           S   +  SG+QP+G   +GNY G ++N +  QE  + L  Y + DLHAIT   V  +LR 
Sbjct: 4   SEKKIVYSGIQPSGTFTIGNYFGAMKNWVPMQEAYDCL--YCVVDLHAITVPQVPADLRR 61

Query: 63  QSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENK 122
           ++   +A  +A G+DP ++I++ QS V  H +L+WIL+C + MG ++ M Q+K+KSK+ +
Sbjct: 62  RTYESLAILMAVGIDPDKSILYVQSHVPAHTELTWILNCFSYMGELSRMTQYKDKSKK-Q 120

Query: 123 EETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQ 182
                +GLF YPVLMAADILLY++  VPVG DQ+QH+E+ R IA RFN +F         
Sbjct: 121 GNNIRVGLFDYPVLMAADILLYQSDLVPVGNDQKQHVELARDIASRFNQQFSPT------ 174

Query: 183 KYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKK 242
                       F + E     + +RI SL++  +KMSKSD +    ++LLD+PD + +K
Sbjct: 175 ------------FKLPEPYFGETGARIMSLQEPGRKMSKSDENINGFVSLLDDPDTVIRK 222

Query: 243 IQKAKTDGDVLPSEV-SGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALA 301
            ++A TD D   +EV    EN+    NL+EI+       +E   ++F GK +  FKLA+ 
Sbjct: 223 FKRAVTDSD---TEVRHDRENKPGVSNLMEIYNCTTGRSLEAIQREFEGKGYGDFKLAVG 279

Query: 302 DAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           ++V E + PI ++ + LL DK YL++++ + A RA   A +T+  V +  G 
Sbjct: 280 ESVAETLRPIQEEYKRLLADKGYLESVMKQNAERAAKIAYKTLMKVRKKTGF 331


>gi|284929248|ref|YP_003421770.1| tryptophanyl-tRNA synthetase [cyanobacterium UCYN-A]
 gi|284809692|gb|ADB95389.1| tryptophanyl-tRNA synthetase [cyanobacterium UCYN-A]
          Length = 336

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 151/348 (43%), Positives = 206/348 (59%), Gaps = 27/348 (7%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQPTG LHLGNYLG I N +  Q+   +   + + DLHAIT     + L   +    
Sbjct: 7   LSGVQPTGNLHLGNYLGAISNWVDLQQ--KYENFFCVVDLHAITIPHDPKTLIEDTYSIA 64

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G++   + IF QS V  H++L W+L+C+  + W+  MIQFKEK+ + + E  S+
Sbjct: 65  ALYLACGINLKDSTIFVQSHVSAHSELVWLLNCITPLNWLERMIQFKEKALK-QGENVSV 123

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GL  YP+LMAADILLY A++VPVGEDQ+QHLE+TR IA RFN++F      V        
Sbjct: 124 GLLNYPILMAADILLYNASYVPVGEDQKQHLELTRDIAARFNSKFSTLENPV-------- 175

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                 F I E LI  S +R+ SL D   KMSKSDSSD SRINLLD PD+I KKI++ KT
Sbjct: 176 ------FKIPEPLIRDSGARVMSLSDGRSKMSKSDSSDLSRINLLDPPDLIHKKIKRCKT 229

Query: 249 DGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           D         GLE    +R E  NL+ ++  +     ++ L++     + QFK  LAD  
Sbjct: 230 DS------AKGLEFDNNDRPECNNLLNLYTLLSGKTKQDVLQECRDMGWGQFKPLLADTT 283

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVG 352
           IE + PI +K   ++ DK YLD++L EG ++A   A ET+  V   +G
Sbjct: 284 IEALTPIQEKYHSIITDKYYLDSVLKEGKDKAETIANETLSKVKHSLG 331


>gi|72381874|ref|YP_291229.1| tryptophanyl-tRNA synthetase [Prochlorococcus marinus str. NATL2A]
 gi|72001724|gb|AAZ57526.1| tryptophanyl-tRNA synthetase [Prochlorococcus marinus str. NATL2A]
          Length = 337

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 145/351 (41%), Positives = 209/351 (59%), Gaps = 30/351 (8%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQPTG +H+GN+LG IRN +  QE  N+     + DLHAIT     ++L YQ+ L  
Sbjct: 7   LSGVQPTGDVHIGNWLGAIRNWVELQE--NYETFVCVVDLHAITTPHDPKSL-YQNSLST 63

Query: 69  AS-FLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
           A+ ++A G++P +  IF QS +  H++L WIL+C+  + WM  MIQFKEKS + + +  S
Sbjct: 64  AALYIACGMNPDKCSIFIQSQISAHSELCWILNCLTPLNWMERMIQFKEKSIK-QGDNVS 122

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIA-QRFNTEFERKIKEVAQKYAQ 186
           +GL  YPVLMAADILLY A  VPVGEDQ+QHLE+ R IA QR N++F  K   + +    
Sbjct: 123 IGLLDYPVLMAADILLYDADLVPVGEDQKQHLELARDIASQRVNSKFGTKENPILK---- 178

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                     +   LI    S++ SL D +KKMSKSD ++ SRI LLD+PDII KKI+++
Sbjct: 179 ----------VPNPLILKECSKVMSLTDGTKKMSKSDPNENSRITLLDSPDIITKKIKRS 228

Query: 247 KTDGDVLPSEVSGLEN----RLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALAD 302
           KTD ++      GLE     R EA NL+ I++ +  +  E+A +      + +FK    +
Sbjct: 229 KTDSEL------GLEFGNPLRPEADNLLTIYSIISGLGREKAAEYCAEMGWGKFKPEFTE 282

Query: 303 AVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           A+I  + PI +K + L+ D   L  IL +G   A   ++ T+  V E +G 
Sbjct: 283 AMINVLKPIQEKYKELMNDPEELKRILNKGKLTAEEVSKLTLNRVKEALGF 333


>gi|260907097|ref|ZP_05915419.1| tryptophanyl-tRNA synthetase [Brevibacterium linens BL2]
          Length = 332

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 140/355 (39%), Positives = 201/355 (56%), Gaps = 27/355 (7%)

Query: 1   MLSSDNLFVSGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQEN 59
           M SS    VSG+Q T   LHLGNY+G ++  +  QE+  H   YFIA++HAIT      +
Sbjct: 2   MTSSQPRTVSGIQATSDSLHLGNYIGALQQFVAHQES--HDAFYFIANMHAITVEQDPTD 59

Query: 60  LRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSK 119
           LR ++    A F+AAG+DP ++ IF QS V  H  LSW+L C   MG  + M QFK+KS 
Sbjct: 60  LRERTLRTAAQFIAAGIDPEKSTIFVQSQVPAHPQLSWVLECTTSMGEASRMTQFKDKSA 119

Query: 120 ENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKE 179
             K++  SLGL  YP LMAADILLY    VPVGEDQRQHLE+TR +A+RFN  F      
Sbjct: 120 --KQDHVSLGLLTYPALMAADILLYNPQMVPVGEDQRQHLELTRNLAERFNYRFGET--- 174

Query: 180 VAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDII 239
                          F + E  I  + ++I  L++ S KMSKS  S   RI+LLD    +
Sbjct: 175 ---------------FVVPEAQILKATAKIYDLQNPSAKMSKSLPSPLGRIDLLDEAKSL 219

Query: 240 AKKIQKAKTDGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKL 298
            KKI+ A TD      E++   E +    NL+ I++++    +++ + ++ GK +   K+
Sbjct: 220 TKKIKSAVTDDG---KEIAYDPEAKPGVSNLLTIYSSLTSRSVDDIVAEYEGKMYGHLKV 276

Query: 299 ALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            LA+  +E + PI ++   LL+D++ L TIL  GA +A   A+ T++ V + VG 
Sbjct: 277 DLAEVAVEALAPIRERTNELLQDRAQLQTILDAGAEKANEIAEVTLRDVYDKVGF 331


>gi|161486836|ref|NP_782981.2| tryptophanyl-tRNA synthetase [Clostridium tetani E88]
          Length = 333

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 133/344 (38%), Positives = 201/344 (58%), Gaps = 24/344 (6%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G L +GNY G ++N ++ Q+  N    Y I DLHAIT   V + LR ++   +A
Sbjct: 10  SGIQPSGNLTIGNYFGALKNWVKLQDEYNCF--YCIVDLHAITVRQVPQELRKRTLEVLA 67

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            ++A+G+DP +N +F QS V  H + +W+L+C   +G +N M QFK+KS +N  E+ S G
Sbjct: 68  VYIASGLDPEKNTLFIQSHVPAHTEAAWLLNCFTYLGELNRMTQFKDKS-QNAGESISAG 126

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L  YPVLMAADILLY A  VPVG DQ+QHLE+TR IA RFN  +                
Sbjct: 127 LLNYPVLMAADILLYNADLVPVGNDQKQHLELTRDIATRFNNLYSPT------------- 173

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                F + E  I  + +RI  L++  KKMSKS  +    I ++D P+II  KI +A TD
Sbjct: 174 -----FKVPEPYIGKTGARIMDLQEPKKKMSKSAENKNGYILIMDPPNIIQNKINRAVTD 228

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            + +   V   + +   KNL+ I +T     +E   K++ G  +S+FK  +A+A+I E+ 
Sbjct: 229 NEGI---VRYSDEQPGVKNLMNILSTATGKNVESIEKEYAGLGYSKFKKDVAEAIIAEVE 285

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           P+ ++++  L+DKSYL+ +  EGA +A   A +T+  +   +G 
Sbjct: 286 PLQKEVKRYLEDKSYLEKVYKEGAQKASYVANKTLSKMKRKIGF 329


>gi|323705457|ref|ZP_08117032.1| tryptophanyl-tRNA synthetase [Thermoanaerobacterium xylanolyticum
           LX-11]
 gi|323535359|gb|EGB25135.1| tryptophanyl-tRNA synthetase [Thermoanaerobacterium xylanolyticum
           LX-11]
          Length = 327

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 139/345 (40%), Positives = 202/345 (58%), Gaps = 28/345 (8%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQPTG +H+GNYLG ++  ++ Q+  ++  ++ I DLHA+T     E LR +S     
Sbjct: 6   SGVQPTGDIHIGNYLGAMKQFVKLQD--DYSCLFCIVDLHALTVPQDPETLRKKSIELAG 63

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LA G+DP + IIF QS V  H++L+W+L C+   G +N M QFKEKSK   +E+ S+G
Sbjct: 64  LYLAIGLDPKKVIIFVQSHVKEHSELAWLLQCMTYFGELNRMTQFKEKSK--GKESVSVG 121

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LMAADILLY    VPVG DQ+QHLE+TR IA RFN  F                
Sbjct: 122 LFTYPDLMAADILLYDTNFVPVGNDQKQHLELTRDIAIRFNNRFGDT------------- 168

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                F I E +I  + SRI SL +  KKMSKS  + +S+INLLD P ++ KKI KA TD
Sbjct: 169 -----FVIPEPMILKTGSRIMSLTEPDKKMSKSSENQYSKINLLDEPSLVKKKIMKAVTD 223

Query: 250 GD-VLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
            + V+  +    EN+    NL+ +++    I IE+   +F G+ +   K  L D ++E +
Sbjct: 224 SENVIRYDP---ENKPGLSNLLTLYSAFTDISIEDVEARFKGQGYGTLKKELVDVIVERL 280

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
             I    ++L  D ++++ +L +GA +A   A+ T+  V + +GL
Sbjct: 281 QEIQSNYRNL--DSNFINEVLKDGAEKASEIAKATVNKVKDKMGL 323


>gi|283798728|ref|ZP_06347881.1| tryptophan--tRNA ligase [Clostridium sp. M62/1]
 gi|291073409|gb|EFE10773.1| tryptophan--tRNA ligase [Clostridium sp. M62/1]
 gi|295090821|emb|CBK76928.1| tryptophanyl-tRNA synthetase [Clostridium cf. saccharolyticum K10]
          Length = 378

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 134/353 (37%), Positives = 204/353 (57%), Gaps = 24/353 (6%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENL 60
           ML       SG+Q TG L LGNYLG ++N +   +   +   + + D+H+IT       L
Sbjct: 45  MLDGKKTLFSGMQATGNLTLGNYLGALKNWVTISD--EYQTFFSVVDMHSITVRQDPAEL 102

Query: 61  RYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKE 120
           R ++R  +  ++AAG+DP +N I+ QS V  HA+L+WIL+C   MG +N M QFK+K+ +
Sbjct: 103 RKRARNLLTLYIAAGLDPEKNCIYYQSHVSGHAELAWILNCFTYMGELNRMTQFKDKAAK 162

Query: 121 NKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEV 180
           + +   + GLF YPVLMAADILLY+A  VPVG DQ QHLE+TR IA RFN  +       
Sbjct: 163 HADNINA-GLFTYPVLMAADILLYQADVVPVGIDQMQHLELTRDIAIRFNNIY------- 214

Query: 181 AQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIA 240
                         F + E  I  + ++I SL+D +KKMSKSD +    I L+D+PD I 
Sbjct: 215 -----------GDVFTVPEAYIGKAGAKIMSLQDPAKKMSKSDENPNGSIYLMDDPDTII 263

Query: 241 KKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLAL 300
           +K ++A TD +     V   + +   KNLI+I+        EE  ++F GK +  FK+A+
Sbjct: 264 RKFKRAVTDSEAC---VRYCDEQPGIKNLIDIYRACTGKTPEEVEREFDGKGYGDFKMAV 320

Query: 301 ADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            +AV+  + P+ +K   L KDK+Y+D+++   A +A+  + +T++ V + VG 
Sbjct: 321 GEAVVGVLRPLQEKYAELSKDKAYIDSVIKTNAEKAQYFSSKTLRKVQKKVGF 373


>gi|29829960|ref|NP_824594.1| tryptophanyl-tRNA synthetase [Streptomyces avermitilis MA-4680]
 gi|39932355|sp|Q82HU1|SYW1_STRAW RecName: Full=Tryptophanyl-tRNA synthetase 1; AltName:
           Full=Tryptophan--tRNA ligase 1; Short=TrpRS 1
 gi|29607070|dbj|BAC71129.1| putative tryptophanyl-tRNA synthetase [Streptomyces avermitilis
           MA-4680]
          Length = 337

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 143/354 (40%), Positives = 199/354 (56%), Gaps = 23/354 (6%)

Query: 1   MLSSDNLFVSGVQPT-GVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQEN 59
           M S     +SG+QPT G  HLGNYLG +R  +  QE+  H   Y + DLHAIT      +
Sbjct: 1   MASDRPRVLSGIQPTAGSFHLGNYLGAVRQWVALQES--HDAFYMVVDLHAITVPQDPAD 58

Query: 60  LRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSK 119
           LR  +RL  A  LAAG+DP R  +F QS V  HA L+WI++C+   G  + M QFK+KS 
Sbjct: 59  LRANTRLAAAQLLAAGLDPERCTLFVQSHVPEHAQLAWIMNCLTGFGEASRMTQFKDKSA 118

Query: 120 ENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKE 179
           +   + AS+GLF YPVL  ADILLY+A  VPVGEDQRQH+E+TR +A+RFN  F      
Sbjct: 119 KQGADRASVGLFTYPVLQVADILLYQANEVPVGEDQRQHIELTRDLAERFNGRFGET--- 175

Query: 180 VAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDII 239
                          F + +  I    ++I  L+D S KMSKS S+    INLLD P   
Sbjct: 176 ---------------FTVPKPYILKETAKIFDLQDPSIKMSKSASTPKGLINLLDEPKAT 220

Query: 240 AKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLA 299
           AKK++ A TD D +    +  E++    NL+ I++T+    I E  +++ GK +   K  
Sbjct: 221 AKKVKSAVTDTDTVIRYDA--EHKPGISNLLTIYSTLTGTGIPELEEKYTGKGYGALKTD 278

Query: 300 LADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           LA+ +++ + P  ++ Q  L D   LD+IL +GA +AR  A ET+    + VG 
Sbjct: 279 LAEVMVDFVTPFRERTQQYLDDPETLDSILAKGAEKARAVAAETLSQAYDRVGF 332


>gi|39932176|sp|Q891C7|SYW_CLOTE RecName: Full=Tryptophanyl-tRNA synthetase; AltName:
           Full=Tryptophan--tRNA ligase; Short=TrpRS
 gi|28204480|gb|AAO36918.1| tryptophanyl-tRNA synthetase [Clostridium tetani E88]
          Length = 338

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 133/344 (38%), Positives = 201/344 (58%), Gaps = 24/344 (6%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G L +GNY G ++N ++ Q+  N    Y I DLHAIT   V + LR ++   +A
Sbjct: 15  SGIQPSGNLTIGNYFGALKNWVKLQDEYNCF--YCIVDLHAITVRQVPQELRKRTLEVLA 72

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            ++A+G+DP +N +F QS V  H + +W+L+C   +G +N M QFK+KS +N  E+ S G
Sbjct: 73  VYIASGLDPEKNTLFIQSHVPAHTEAAWLLNCFTYLGELNRMTQFKDKS-QNAGESISAG 131

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L  YPVLMAADILLY A  VPVG DQ+QHLE+TR IA RFN  +                
Sbjct: 132 LLNYPVLMAADILLYNADLVPVGNDQKQHLELTRDIATRFNNLYSPT------------- 178

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                F + E  I  + +RI  L++  KKMSKS  +    I ++D P+II  KI +A TD
Sbjct: 179 -----FKVPEPYIGKTGARIMDLQEPKKKMSKSAENKNGYILIMDPPNIIQNKINRAVTD 233

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            + +   V   + +   KNL+ I +T     +E   K++ G  +S+FK  +A+A+I E+ 
Sbjct: 234 NEGI---VRYSDEQPGVKNLMNILSTATGKNVESIEKEYAGLGYSKFKKDVAEAIIAEVE 290

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           P+ ++++  L+DKSYL+ +  EGA +A   A +T+  +   +G 
Sbjct: 291 PLQKEVKRYLEDKSYLEKVYKEGAQKASYVANKTLSKMKRKIGF 334


>gi|307172597|gb|EFN63956.1| Tryptophanyl-tRNA synthetase, mitochondrial [Camponotus floridanus]
          Length = 740

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 144/347 (41%), Positives = 203/347 (58%), Gaps = 27/347 (7%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QPTG +HLGNY G I+  +  Q T   + +  IADLH+IT +   + LR  + L  A
Sbjct: 402 SGIQPTGSVHLGNYFGAIQRWVEFQNTGEKV-LCSIADLHSITLSQDPKKLRENTLLMTA 460

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           + +A GVD  ++I+F+QS V  H +L W+L  +  M  + ++ QFKEKS+  K     LG
Sbjct: 461 TLVACGVDFEKSILFQQSKVPMHTELCWVLGTITTMARLAHLPQFKEKSESLK--NIPLG 518

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L++YPVL AADILLY+ATHVPVG+DQ QH+++ + +A  FN  F +              
Sbjct: 519 LYIYPVLQAADILLYKATHVPVGQDQAQHIQLAQDLAHIFNKRFGQT------------- 565

Query: 190 YSKGFFPIIEGLI-DSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                FPI   LI D  + RI+SLR+  KKMSKS     SR+N+LD PD++ +KI+KA T
Sbjct: 566 -----FPIPHTLISDGPSQRIKSLREPMKKMSKSHKDPKSRLNMLDEPDVLLEKIKKAVT 620

Query: 249 DGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
           D     SEV+   E R    NLI I + +     +E  K+    N  Q+KL LAD VIE+
Sbjct: 621 D---FTSEVTYEPEKRPGVTNLINIHSLVTGKTPDEICKEVVELNTGQYKLVLADVVIEK 677

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYV-NEIVGL 353
           + PI + I  L+K+ +YLD IL +G  RA   A    + V N++ G+
Sbjct: 678 LSPIRENILRLMKEPAYLDEILHKGTERATELATNCWEEVTNKVFGI 724


>gi|87303303|ref|ZP_01086096.1| tryptophanyl-tRNA synthetase [Synechococcus sp. WH 5701]
 gi|87282198|gb|EAQ74159.1| tryptophanyl-tRNA synthetase [Synechococcus sp. WH 5701]
          Length = 322

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 134/340 (39%), Positives = 202/340 (59%), Gaps = 26/340 (7%)

Query: 18  LHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVASFLAAGVD 77
           +HLGN+LG IRN +  Q+  +H   + + DLHAIT       L   +    A +LA+G+D
Sbjct: 1   MHLGNWLGAIRNWVSLQD--DHDTFFCVVDLHAITVPHDPALLAENTLRTAALYLASGID 58

Query: 78  PSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLGLFMYPVLM 137
           P R+ +F QS V  H++L+W+L+CV  + W+  MIQFKEK+++ + E  S+GL  YPVLM
Sbjct: 59  PERSSVFVQSQVTAHSELTWLLNCVTPLNWLERMIQFKEKARK-QGENVSVGLLDYPVLM 117

Query: 138 AADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQYSKGFFPI 197
           AADILLY A  VPVGEDQ+QHLE+ R IAQ          + +  ++A E++       +
Sbjct: 118 AADILLYDADLVPVGEDQKQHLELARDIAQ----------QRINARFAPEDE---PLLKV 164

Query: 198 IEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTDGDVLPSEV 257
            E LI +  +R+ SL D   KMSKSD ++ SR+NLLD P++I +KI++AKTD       V
Sbjct: 165 PEPLILTEGARVMSLVDGRSKMSKSDPNEGSRVNLLDPPELITRKIKRAKTD------PV 218

Query: 258 SGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIVPISQ 313
            GLE     R EA NL+ ++A +  +  E A ++     + QFK  LA+A +E + P+ +
Sbjct: 219 MGLEFGNPERPEADNLLGLYALLSGVGREAAARECASMGWGQFKPLLAEAAVEALRPLQE 278

Query: 314 KIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + + +  +  YLD +L  G  RA   A+ +++ V   +G 
Sbjct: 279 RYEAIRAEAGYLDQVLRRGRERASVVAEASLERVRAAMGF 318


>gi|274324174|ref|NP_001162112.1| tryptophanyl tRNA synthetase 2 (mitochondrial) [Rattus norvegicus]
          Length = 360

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 135/356 (37%), Positives = 216/356 (60%), Gaps = 34/356 (9%)

Query: 3   SSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAIT----NNIVQE 58
           S + +F SG+QPTG+ HLGNYLG I + ++ QE  + + +Y I DLH+IT      I+Q+
Sbjct: 33  SGERVF-SGIQPTGIPHLGNYLGAIESWVKLQEEYDTV-IYSIVDLHSITVPQDPGILQQ 90

Query: 59  NLRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKS 118
           ++   +    A  LA G+DP R+I+F+QS V  H  LSWIL+C+ R+  + ++ Q+K K+
Sbjct: 91  SILDMT----AVLLACGIDPERSILFQQSQVSEHTQLSWILTCMVRLPRLQHLHQWKAKA 146

Query: 119 KENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIK 178
              K +  ++GL  YPVL AADIL Y++THVPVGEDQ QH+E+ + +A+ FN        
Sbjct: 147 ARQKHD-GTVGLLTYPVLQAADILCYKSTHVPVGEDQVQHMELVQDLARSFN-------- 197

Query: 179 EVAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDI 238
              QKY +        FP+   ++ +S  +++SLRD S KMSKSD    + + + D+P+ 
Sbjct: 198 ---QKYGE-------LFPLPRSIL-TSMKKVKSLRDPSAKMSKSDPDKLATVQITDSPEE 246

Query: 239 IAKKIQKAKTDGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFK 297
           I +K +KA TD     SEV+   ++R    N++ I A +  + +EE ++   G + +++K
Sbjct: 247 IVRKFRKAVTD---FTSEVTYEPDSRPGVSNMVAIHAAVSGLSVEEVVRNSAGVDTARYK 303

Query: 298 LALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           L +ADAVIE+  PI  +I+ L  DK +L  +L+ G+ +A+  A    + V ++VG+
Sbjct: 304 LLVADAVIEKFAPIRSEIEKLKMDKDHLRKVLLVGSAKAKELASPVFEEVKKLVGI 359


>gi|304408174|ref|ZP_07389823.1| tryptophanyl-tRNA synthetase [Paenibacillus curdlanolyticus YK9]
 gi|304342862|gb|EFM08707.1| tryptophanyl-tRNA synthetase [Paenibacillus curdlanolyticus YK9]
          Length = 329

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 139/353 (39%), Positives = 200/353 (56%), Gaps = 41/353 (11%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQET--CNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           +SG+QP+G L LGNY+G ++N ++ QET  C     + + DLHAIT       LR Q+  
Sbjct: 5   LSGIQPSGQLTLGNYIGAMQNFVKLQETEEC----FFMVVDLHAITVPQEPAALREQTES 60

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A F+AAG+DP+++  F QS V  H++L W+ + +A MG +  M QFK+KS    +++ 
Sbjct: 61  VTALFIAAGIDPAKSSTFVQSHVRAHSELGWLFTTLAYMGELERMTQFKDKS--TGKDSV 118

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
             GLF+YP LMAADILLY A  VPVG+DQ+QHLE+TR +A RFN+ F             
Sbjct: 119 GAGLFVYPTLMAADILLYNADLVPVGDDQKQHLELTRDLAHRFNSRF------------- 165

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                  FF + E  I    +RI SL DASKKMSKS+ +  S I LLD+PD+I KK+ +A
Sbjct: 166 -----GDFFKVPEPYIPKVGARIMSLDDASKKMSKSNPNPGSFIALLDSPDVIRKKLSRA 220

Query: 247 KTDGDVLPSEVSGLE------NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLAL 300
            TD        SG E      N+ E  NL+ I++    + ++    Q+ G+ +  FK  L
Sbjct: 221 TTD--------SGREVKYDPANKPEVSNLMTIYSHCAGLSLDAIEAQYDGQGYGAFKKDL 272

Query: 301 ADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           A+AV+  I P+  +    ++    +  IL +GA RA   A ET+    E++G 
Sbjct: 273 AEAVVSVIEPLQARYNE-IRSSGAIHDILKQGAERASVVADETLAKTKELMGF 324


>gi|73981244|ref|XP_540263.2| PREDICTED: similar to Tryptophanyl-tRNA synthetase, mitochondrial
           precursor (Tryptophan--tRNA ligase) (TrpRS) ((Mt)TrpRS)
           [Canis familiaris]
          Length = 363

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 135/345 (39%), Positives = 203/345 (58%), Gaps = 25/345 (7%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QPTG+ HLGNYLG I   ++ QE    + +Y I DLH+IT       LR       A
Sbjct: 42  SGIQPTGIPHLGNYLGAIETWVKLQEEHGSV-LYSIVDLHSITVPQDPAVLRQSILDMTA 100

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
             LA G++P ++I+F+QS V  H  LSWIL+C+ R+  + ++ Q+K K    K    ++G
Sbjct: 101 VLLACGINPEKSILFQQSQVSEHTQLSWILTCMVRLPRLQHLHQWKAKIATQKH-GGTVG 159

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L  YPVL AADILLY++THVPVGEDQ QH+E+ + +AQ FN           +KY +   
Sbjct: 160 LLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQGFN-----------KKYGE--- 205

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                FP+   ++ +S  +++SLRD S KMSKSD    + + + D+P+ I +K +KA TD
Sbjct: 206 ----VFPVPRSIL-TSMKKVKSLRDPSAKMSKSDPDKLATVRITDSPEEIVQKFRKAVTD 260

Query: 250 GDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
                SEV+     R    NL+ I A +  + +EEAL+   G + +++KL +ADAVI++ 
Sbjct: 261 ---FTSEVTYEPARRAGVSNLVAIHAAVVGVPVEEALQHSAGLDTARYKLLVADAVIQKF 317

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            PI  +I+ L  D+ +L+ +L  G+ +AR  A    + V ++VGL
Sbjct: 318 APIKSEIEKLKTDRGHLEKVLQVGSAKARELAHPVCQEVKKLVGL 362


>gi|167855240|ref|ZP_02478009.1| tryptophanyl-tRNA synthetase [Haemophilus parasuis 29755]
 gi|167853604|gb|EDS24849.1| tryptophanyl-tRNA synthetase [Haemophilus parasuis 29755]
          Length = 342

 Score =  239 bits (610), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 136/329 (41%), Positives = 196/329 (59%), Gaps = 11/329 (3%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  +  SGVQP+G L LGNYLG +RN ++ Q+   +  ++ I D HAIT     E LR  
Sbjct: 2   SKPIVFSGVQPSGELSLGNYLGALRNWVKMQD--EYECLFCIVDSHAITVRQDPEALRKA 59

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           +   +A +LA G+DP ++ IF QS V  H+ L+WIL+C    G M  M QFK+KS  + E
Sbjct: 60  TLDTLAIYLACGIDPVKSTIFIQSHVPEHSQLAWILNCYTYFGEMGRMTQFKDKSARH-E 118

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
           +  ++GLF YPVLMAADILLY+A  VPVG+DQ+QHLEITR IA RFN  + +K       
Sbjct: 119 DNVNVGLFTYPVLMAADILLYQANQVPVGDDQKQHLEITRDIANRFNALYGKK------- 171

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
              E    +  F + E  I  + +RI SL + +KKMSKSD +  + I LL++P  +AKKI
Sbjct: 172 -DAEGNVLEPIFAVPEVFIAKTGARIMSLLEPTKKMSKSDDNRNNVIGLLEDPKSVAKKI 230

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           ++A TDGD  P     ++N+    NL++I A++    I E   +F GK +   K A+AD 
Sbjct: 231 KRAMTDGDEPPVVRYDVQNKPGVSNLLDILASVTGKTIPELETEFEGKMYGHLKTAVADE 290

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEG 332
           V   +  + ++  H   +++ L++I  EG
Sbjct: 291 VSAMLSQLQERYHHFRNNEALLESIYREG 319


>gi|271962808|ref|YP_003337004.1| tryptophan--tRNA ligase [Streptosporangium roseum DSM 43021]
 gi|270505983|gb|ACZ84261.1| Tryptophan--tRNA ligase [Streptosporangium roseum DSM 43021]
          Length = 334

 Score =  239 bits (610), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 140/348 (40%), Positives = 200/348 (57%), Gaps = 27/348 (7%)

Query: 9   VSGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SG+QPT    HLGNYLG +R  +  QE   H   Y + DLHAIT +   E LR ++R+ 
Sbjct: 7   LSGIQPTADSFHLGNYLGAVRQYVAMQE--GHDAFYCVVDLHAITVDYQPETLRRRTRVA 64

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A   AAG+DP R+ +F QS V  H++L+W+L C+  MG    M QFK+KS ++ E +AS
Sbjct: 65  AAQLFAAGLDPERSTVFVQSHVREHSELAWVLICLTGMGEAGRMTQFKDKSAKSGESSAS 124

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GLF YP+L AADILLY+A  VPVG DQ+QHLE+TR +AQRFN  F              
Sbjct: 125 VGLFTYPILQAADILLYQADKVPVGADQKQHLELTRDLAQRFNHRFGET----------- 173

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F + +  I +   +I  L+D + KMSKS SS    ++LL+ P  + KK+ +A 
Sbjct: 174 -------FTLPKPHIVAGVEKITDLQDPTAKMSKSSSSPGGILDLLEQPGPLRKKVMRAV 226

Query: 248 TD--GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVI 305
           TD   +VL  +    EN+    NL+ I + +    I E   ++ G+ +  FK  +A+ V+
Sbjct: 227 TDTGSEVLADD----ENKPGVTNLLRIQSALTGTPISELEARYAGQGYGAFKKDVAEVVV 282

Query: 306 EEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           +   PI ++ + LL D++ LD +L  GA RAR  A ETM  V + VG 
Sbjct: 283 DTFTPIRERTEKLLADEAELDRMLAVGAARARAVAAETMTRVRDRVGF 330


>gi|270264419|ref|ZP_06192685.1| tryptophanyl-tRNA synthetase [Serratia odorifera 4Rx13]
 gi|270041555|gb|EFA14653.1| tryptophanyl-tRNA synthetase [Serratia odorifera 4Rx13]
          Length = 334

 Score =  239 bits (610), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 135/350 (38%), Positives = 200/350 (57%), Gaps = 21/350 (6%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  +  SG QP+G L +GNY+G +R  ++ Q+  ++  +Y I DLHAIT     E LR  
Sbjct: 2   SKPIVFSGAQPSGELSIGNYMGALRQWVKLQD--DYDCIYCIVDLHAITVRQDAEKLRKA 59

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           +   +A +LA G+DP ++ IF QS V  H  LSW+L+C    G ++ M QFK+KS    E
Sbjct: 60  TLDTLALYLACGIDPQKSTIFVQSHVPEHTQLSWVLNCYTYFGELSRMTQFKDKSARYAE 119

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
              + GLF YPVLMAADILLY+   VPVGEDQ+QHLE++R I QRFN  +          
Sbjct: 120 NINA-GLFSYPVLMAADILLYQTNQVPVGEDQKQHLELSRDIGQRFNALY---------- 168

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
                      F + E  I  S +R+ SL+D +KKMSKSD +  + I LL++P  +AKKI
Sbjct: 169 --------GDVFKVPEPFIPKSGARVMSLQDPTKKMSKSDDNRNNVIGLLEDPKAVAKKI 220

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           ++A TD +  P     + N+    NL++I + +    I +   +F G+ +   K A+ADA
Sbjct: 221 KRAMTDSEEPPVIRYDVANKPGVSNLLDILSGVTGKSIAQLEAEFEGQMYGHLKGAVADA 280

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           V   +  + ++  +   D++ L  ++ +GA +AR RAQET+  V + VG 
Sbjct: 281 VSGMLGELQERYHNFRNDEALLQQVMRDGAAKARARAQETLAKVYQAVGF 330


>gi|320539805|ref|ZP_08039464.1| tryptophanyl-tRNA synthetase [Serratia symbiotica str. Tucson]
 gi|320029991|gb|EFW12011.1| tryptophanyl-tRNA synthetase [Serratia symbiotica str. Tucson]
          Length = 334

 Score =  239 bits (610), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 134/350 (38%), Positives = 200/350 (57%), Gaps = 21/350 (6%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  +  SG QP+G L +GNY+G +R  ++ Q+  ++  +Y I DLHAIT     E LR  
Sbjct: 2   SKPIVFSGAQPSGELTIGNYMGALRQWVQMQD--HYDCIYCIVDLHAITVRQDAEQLRKA 59

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           +   +A +LA G+DP R+ IF QS V  H  L W+L+C    G ++ M QFK+KS    E
Sbjct: 60  TLDTLALYLACGIDPERSTIFVQSHVPEHTQLGWVLNCYTYFGELSRMTQFKDKSTRYAE 119

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
              + GLF YPVLMAADILLY+   VPVGEDQ+QHLE++R ++QRFN  +          
Sbjct: 120 NINA-GLFSYPVLMAADILLYQTHQVPVGEDQKQHLELSRDVSQRFNALYGE-------- 170

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
                      F + E  I  S +R+ SL++  KKMSKSD +  + I LL++P+ + KKI
Sbjct: 171 ----------VFKVPEPFIPKSGARVMSLQEPHKKMSKSDDNRNNVIGLLEDPNAVTKKI 220

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           ++A TD +  P     + N+    NL++I + +    I +   +F G+ + Q K  +A+A
Sbjct: 221 KRAMTDSEEPPVIRYDVANKAGVSNLLDILSGVTGKSIVQLEAEFAGQMYGQLKGLVAEA 280

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           V   +  + Q+   L KD++YL  ++ +GA +A  RAQET+  V + VG 
Sbjct: 281 VSGMLSELQQRYYSLRKDEAYLQQVMCDGAAKASARAQETLAKVYQAVGF 330


>gi|149708805|ref|XP_001500995.1| PREDICTED: similar to Tryptophanyl tRNA synthetase 2, mitochondrial
           [Equus caballus]
          Length = 360

 Score =  239 bits (610), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 131/345 (37%), Positives = 209/345 (60%), Gaps = 25/345 (7%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QPTG+ HLGNYLG I + ++ Q     + +Y I DLH+IT       LR       A
Sbjct: 39  SGIQPTGIPHLGNYLGAIESWVKLQNEHGSV-LYSIVDLHSITVPQDPAVLRQSILDMTA 97

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           + LA G++P ++I+F+QS V  H  LSWIL+C+ R+  + ++ Q+K K+ + K +  ++G
Sbjct: 98  ALLACGINPEKSILFQQSQVPEHTQLSWILTCMVRLPRLQHLHQWKAKTTKQKHD-GTMG 156

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L  YPVL AAD+LLY++THVPVGEDQ QH+E+ + +AQ FN           +KY +   
Sbjct: 157 LLTYPVLQAADVLLYKSTHVPVGEDQVQHMELVQDLAQGFN-----------KKYGE--- 202

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
               FFP+ + ++ +S  +++SLRD S KMSKSD    + + + D+P+ I +K +KA TD
Sbjct: 203 ----FFPVPKSIL-TSMKKVKSLRDPSAKMSKSDPDKLATVRITDSPEEIVQKFRKAVTD 257

Query: 250 GDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
                SEV+    +R    N++ I A +  + +EE +++  G + +++KL +ADAVIE+ 
Sbjct: 258 ---FTSEVTYDPASRGGVSNMVAIHAAVTGLPVEEVVRRSTGMDTARYKLVVADAVIEKF 314

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            PI  +I+ L  DK +L+ +L  G+ +A+  A    + V ++VG 
Sbjct: 315 APIKSEIEKLKMDKDHLEKVLHVGSAKAKELAYPVCQEVKKLVGF 359


>gi|322787990|gb|EFZ13831.1| hypothetical protein SINV_07847 [Solenopsis invicta]
          Length = 375

 Score =  239 bits (610), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 143/344 (41%), Positives = 203/344 (59%), Gaps = 28/344 (8%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QPTG +HLGNY G IR  +  Q +   + +  I DLH+IT     + LR    L  A
Sbjct: 40  SGIQPTGSVHLGNYFGAIRRWVELQNSGEAV-LCSIVDLHSITLPQNPQRLRENILLMTA 98

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           + +A G+D  R+I+F+QS V  H +L W+L  +  M  + ++ QFKEKS+  K     LG
Sbjct: 99  TLIACGIDVKRSILFQQSKVPMHTELCWVLCSITTMARLAHLPQFKEKSESLK--NVPLG 156

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L++YPVL AADILL  ATHVPVG+DQ QH+++ + +AQ FN +F +              
Sbjct: 157 LYIYPVLQAADILL--ATHVPVGQDQAQHIQLAQDLAQIFNRQFGKT------------- 201

Query: 190 YSKGFFPIIEGLI-DSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                FPI   LI D+ + RI+SLR+  KKMSKS ++  SR+++LD PDI+ +K++KA T
Sbjct: 202 -----FPIPHTLISDNPSQRIKSLREPMKKMSKSHTNAKSRLDILDEPDILLEKVKKAIT 256

Query: 249 DGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
           D     SEV+   E R    NLI+I + +     EE  K+  G N  Q+KL LAD +IE+
Sbjct: 257 D---FTSEVTYEPERRPGVTNLIDIHSLLTGKTPEEICKEAVGLNTGQYKLVLADVIIEK 313

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIV 351
           + PI + +  L+++ +YLD IL EGA RA   A +    V E V
Sbjct: 314 LSPIRKDVLRLIREPAYLDEILKEGAERATELATDCWTEVTEKV 357


>gi|305680216|ref|ZP_07403026.1| tryptophan--tRNA ligase [Corynebacterium matruchotii ATCC 14266]
 gi|305660836|gb|EFM50333.1| tryptophan--tRNA ligase [Corynebacterium matruchotii ATCC 14266]
          Length = 346

 Score =  239 bits (610), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 132/347 (38%), Positives = 198/347 (57%), Gaps = 25/347 (7%)

Query: 9   VSGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SG+QPT    HLGNYLG ++  I  Q+T  +   YFI DLHAIT +   + LR ++   
Sbjct: 17  LSGIQPTSDSYHLGNYLGALKQWIDLQDT--YEAFYFIPDLHAITVDQDPKELRARTISG 74

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A  LA G+DP +  +F QS V  HA L+W+ +C+   G  + M QFK+KS +   +  S
Sbjct: 75  AAQLLALGIDPDKAALFVQSHVPEHAQLAWVFTCLTGFGEASRMTQFKDKSTKQGADRTS 134

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
            GL+ YP+LMAADILLYR   VPVGEDQRQHLE+TR +A+RFN+ ++             
Sbjct: 135 AGLYAYPMLMAADILLYRPEIVPVGEDQRQHLELTRTLAERFNSRYQET----------- 183

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  FP+ E  I + +++I  L+D + KMSKS S+    INLLD+P I  K+I+ A 
Sbjct: 184 -------FPVPEPFIPTGSAKIYDLQDPTAKMSKSTSNPKGLINLLDDPKISTKRIKSAV 236

Query: 248 TDGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
           TD D    E+    E +    NL+ I A +    +++ + ++ G+ +   KL  A A+  
Sbjct: 237 TDND---GEIRFDKETKPGVSNLLVIQAALTGTTVDDLVARYAGQGYGALKLDTAAALEA 293

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            +VP+ ++    + D++ L+ +L  GA RAR  A +T+  V + +G 
Sbjct: 294 FVVPLKERFDMYMSDQAELENVLARGAERAREVATQTLADVYDRIGF 340


>gi|213964800|ref|ZP_03392999.1| tryptophanyl-tRNA synthetase [Corynebacterium amycolatum SK46]
 gi|213952336|gb|EEB63719.1| tryptophanyl-tRNA synthetase [Corynebacterium amycolatum SK46]
          Length = 351

 Score =  239 bits (610), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 137/347 (39%), Positives = 198/347 (57%), Gaps = 25/347 (7%)

Query: 9   VSGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SG+QPT    HLGNYLG ++N I  Q+  +    YFI DLHAIT     + LR ++   
Sbjct: 22  LSGIQPTADSYHLGNYLGALKNWINLQDDFD--AYYFIPDLHAITVEQNPKELRQRTIAG 79

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A  +A G+DP ++++F QS V  HA+L W+L+C+   G  + M QFK+KS     E  S
Sbjct: 80  AAQLIALGIDPEKSVLFVQSHVPEHAELGWVLTCLTGFGEASRMTQFKDKSSRQGAEHTS 139

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
            GLF YP+LMAADILLYR   VPVGEDQRQHLE+TR +AQRFN+ +++            
Sbjct: 140 AGLFAYPMLMAADILLYRPQLVPVGEDQRQHLELTRNLAQRFNSRYKKT----------- 188

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F + +  I   +++I  L+D + KMSKS ++    INLLD+P + AK+I+ A 
Sbjct: 189 -------FVVPDPHIMEGSAKIYDLQDPTSKMSKSGANPKGIINLLDDPKVSAKRIRSAV 241

Query: 248 TDGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
           TD D    E+    EN+    NL+ I + +    ++E +  + G  + Q K   ADA+  
Sbjct: 242 TDND---GEIRFDRENKPGVSNLLVIQSALTDKPVDELVAGYEGAGYGQLKADTADALEA 298

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
              P+  + + L+ D+  L+ IL EGA+ AR  A +T+  V E VG 
Sbjct: 299 FTTPLRARYEELMADRGELERILAEGADHAREVAAKTLADVYERVGF 345


>gi|254431692|ref|ZP_05045395.1| tryptophanyl-tRNA synthetase [Cyanobium sp. PCC 7001]
 gi|197626145|gb|EDY38704.1| tryptophanyl-tRNA synthetase [Cyanobium sp. PCC 7001]
          Length = 336

 Score =  239 bits (609), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 135/346 (39%), Positives = 198/346 (57%), Gaps = 23/346 (6%)

Query: 12  VQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVASF 71
           +QPTG LHLGN+LG IRN +  Q++  H   + + DLHAIT       L   +    A +
Sbjct: 1   MQPTGALHLGNWLGAIRNWVDLQDS--HDTFFCVVDLHAITVPHDPAQLAEATLTTAALY 58

Query: 72  LAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLGLF 131
           LA G+DP+R+ +F QS V  H+ L W+L+CV  + W+  MIQFKEK+ +  ++  S GL 
Sbjct: 59  LACGIDPARSTVFVQSHVAAHSALCWLLNCVTPLNWLERMIQFKEKALKQGDQV-SAGLL 117

Query: 132 MYPVLMAADILLYRATHVPVGEDQRQHLEITRLIA-QRFNTEFERKIKEVAQKYAQEEQY 190
            YPVLMAADILLY A  VPVGEDQ+QHLE+ R IA QR N  F              +  
Sbjct: 118 DYPVLMAADILLYDADLVPVGEDQKQHLELARDIAQQRINARF---------GSPGPDGE 168

Query: 191 SKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTDG 250
                 + E +I +  +R+ SL D   KMSKSD ++ SRI LLD P++I+KKI++AKTD 
Sbjct: 169 PLPVLKVPEPMILTEGARVMSLSDGRSKMSKSDPNEGSRITLLDPPELISKKIKRAKTDP 228

Query: 251 DVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
            +      GLE     R EA NL+ ++A +     + A  +     + +FK  L + ++E
Sbjct: 229 TL------GLEFGNPERPEADNLLGLYALLSGKGRQAAATECAEMGWGRFKPLLTEVLVE 282

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVG 352
            + P+ ++ ++   D   L+ +L EG  RA   A+ T++ V++ +G
Sbjct: 283 ALAPVQERYRNWRGDPGALEQVLAEGRQRAESVAEATLERVHDALG 328


>gi|329297334|ref|ZP_08254670.1| tryptophanyl-tRNA synthetase [Plautia stali symbiont]
          Length = 334

 Score =  239 bits (609), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 137/350 (39%), Positives = 202/350 (57%), Gaps = 21/350 (6%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  +  SG QP+G L +GNY+G +R  ++ Q+  +   +Y I DLHAIT       LR  
Sbjct: 2   SKPIVFSGAQPSGELTIGNYMGALRQWVQMQDDFH--CIYCIVDLHAITVRQDPAALRKA 59

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           +   +A +LA G+DP ++ IF QS V  HA LSW+L+C A  G ++ M QFK+KS    E
Sbjct: 60  TLDTLALYLACGIDPEKSTIFVQSHVQEHAQLSWVLNCYAYFGELSRMTQFKDKSAR-YE 118

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
           E  + GLF YPVLMAADILLY+   VPVGEDQ+QHLE++R IA RFN  +          
Sbjct: 119 ENINAGLFDYPVLMAADILLYQTNQVPVGEDQKQHLELSRDIAARFNALY---------- 168

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
                      F I E  I  S +R+ SL + +KKMSKSD +  + I LL++   + KKI
Sbjct: 169 --------GDVFKIPEPFIPKSGARVMSLLEPTKKMSKSDDNRNNVIGLLEDTKSVVKKI 220

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           Q+A TD +  P     ++++    NL++I + +    I +  ++F GK +   K A+ADA
Sbjct: 221 QRAVTDSEEPPVVRYDIKDKAGVSNLLDILSGVTGKSIAQLEQEFEGKMYGHLKGAVADA 280

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           V E +  + ++      D+++L+ ++ +GA +AR  AQET+K V + VG 
Sbjct: 281 VSEMLTELQERYHRFRNDEAFLNQVMRDGAAKARAHAQETLKKVYDAVGF 330


>gi|254422586|ref|ZP_05036304.1| tryptophanyl-tRNA synthetase [Synechococcus sp. PCC 7335]
 gi|196190075|gb|EDX85039.1| tryptophanyl-tRNA synthetase [Synechococcus sp. PCC 7335]
          Length = 336

 Score =  239 bits (609), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 139/351 (39%), Positives = 201/351 (57%), Gaps = 27/351 (7%)

Query: 8   FVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
            +SG+Q TG +HLGNYLG IRN +  Q    +    F+ADLHAIT     + L   +   
Sbjct: 6   ILSGIQTTGNMHLGNYLGAIRNWVELQ--AQYDCFLFMADLHAITVPQDPKTLAENTLKL 63

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A+++A G+DP ++ IF QS +  H++L+W+ +C+  + W+  MIQFKEK+ + + E  S
Sbjct: 64  AATYIACGIDPEQSTIFVQSQLPEHSELAWLFNCITPLNWLERMIQFKEKALK-QGENVS 122

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GL  YPVL AADILLY    VPVGEDQ+QHLE+TR IA R N +F +K K V +     
Sbjct: 123 VGLMDYPVLQAADILLYEPDLVPVGEDQKQHLELTRDIAGRLNHQFGKKKKPVLKV---- 178

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                      E LI  + +R+ SL D +KKMSKSD SD SRI+L D P  I KKI++AK
Sbjct: 179 ----------PEPLIRETGARVMSLTDGTKKMSKSDPSDQSRIDLTDTPQAITKKIKRAK 228

Query: 248 TDGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           TD +       GLE     R E  NL+ ++  +          +     + QFK  LA+ 
Sbjct: 229 TDLE------RGLEFDNPERPECNNLLGLYQLLSGQTKAAVADECRDMGWGQFKPLLAET 282

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
            +E + PI +K   L+ D++YL ++L +G ++A+  A  T+  V   +G +
Sbjct: 283 TVEALRPIQEKYAELMDDRTYLLSVLADGKSKAQAIAIPTLDKVKTAMGFT 333


>gi|299535949|ref|ZP_07049268.1| tryptophanyl-tRNA synthetase [Lysinibacillus fusiformis ZC1]
 gi|298728554|gb|EFI69110.1| tryptophanyl-tRNA synthetase [Lysinibacillus fusiformis ZC1]
          Length = 329

 Score =  239 bits (609), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 137/345 (39%), Positives = 199/345 (57%), Gaps = 25/345 (7%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQPTG++ LGNYLG  +     Q+  N   +Y I D HAIT     + LR   R   A
Sbjct: 6   SGVQPTGIVTLGNYLGAFKQFPALQDEGN--AIYCIVDQHAITVAQDPKELRESIRKLAA 63

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           +++A G+DP ++ +F QS+V  HA   W+L CVA +G +  M QFK+KS  + +E+ S  
Sbjct: 64  TYIATGIDPKKSTLFIQSEVPAHAQAGWMLQCVASIGELERMTQFKDKS--HGKESVSAA 121

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L  YP LMAADILLY    VPVG+DQ+QH+E+TR +A+RFN  F                
Sbjct: 122 LLTYPPLMAADILLYNTNIVPVGDDQKQHIELTRDLAERFNKRF---------------- 165

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                  I E  +  + +RI+SL++ +KKMSKSD +  + I LLD    I KKI+ A TD
Sbjct: 166 --GDVLTIPEIQLPKAGARIKSLQEPTKKMSKSDPNTKATIRLLDTAKDIEKKIKSAVTD 223

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            D + +    +EN+    NL+ I + +  + +E+ +K++ G  +  FK  +A AVIE ++
Sbjct: 224 SDGIVA--FDVENKPGVSNLLTIESAISGVAVEDLVKKYEGIGYGGFKQGVATAVIEHLI 281

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
           PI +K  HL+ + S LD IL EGA +A   A  T+K + + +GL 
Sbjct: 282 PIQEKFYHLV-ESSELDVILDEGAEKANAIASATLKRMEDAMGLG 325


>gi|256785682|ref|ZP_05524113.1| tryptophanyl-tRNA synthetase [Streptomyces lividans TK24]
          Length = 337

 Score =  238 bits (608), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 139/346 (40%), Positives = 193/346 (55%), Gaps = 23/346 (6%)

Query: 9   VSGVQPT-GVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SG+QPT G  HLGNYLG +R  +  Q+T  H   Y + DLHAIT     + LR  +R+ 
Sbjct: 9   LSGIQPTSGSFHLGNYLGAVRQWVDMQDT--HDAFYMVVDLHAITVPQDPKELRENTRVA 66

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A  LAAG+DP R  +F QS V  HA L W+++C+   G  + M QFK+KS +   +  +
Sbjct: 67  AAQLLAAGLDPDRCTLFVQSHVPEHAQLGWLMNCITGFGEASRMTQFKDKSAKQGNDRTT 126

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GLF YP+LM ADILLY+A  VPVGEDQRQHLE+TR +A RFN           Q Y   
Sbjct: 127 VGLFTYPMLMVADILLYQADQVPVGEDQRQHLELTRDLADRFN-----------QTYGDA 175

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F +    I    ++I  L+D + KMSKS ++    INLLD P   AKK++ A 
Sbjct: 176 -------FTVPTAYILKETAKIYDLQDPTAKMSKSAATPKGLINLLDEPKATAKKVKSAV 228

Query: 248 TDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
           TD D +       E +    NL+ I++T+   +I E  +++ GK +   K  LAD V+E 
Sbjct: 229 TDTDTVVR--FDRETKPGVSNLLTIYSTLTGAEIAELERKYEGKGYGALKTDLADVVVEF 286

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + P  ++ +  L D   LD IL +GA +AR  A ET+    + VG 
Sbjct: 287 VTPFRERTRQYLDDPETLDAILAKGAEKARSVAAETLARAYDEVGF 332


>gi|126433841|ref|YP_001069532.1| tryptophanyl-tRNA synthetase [Mycobacterium sp. JLS]
 gi|126233641|gb|ABN97041.1| tryptophanyl-tRNA synthetase [Mycobacterium sp. JLS]
          Length = 344

 Score =  238 bits (608), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 133/346 (38%), Positives = 194/346 (56%), Gaps = 25/346 (7%)

Query: 10  SGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           SGVQPT   LHLGN LG + +    Q+  ++   + + DLHAIT     E LRY++ +  
Sbjct: 17  SGVQPTSDSLHLGNALGAVTHWTALQD--DYDAYFCVVDLHAITVPQDPETLRYRTLVTA 74

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+DP+R+ +F QS V  H +L+W+L C    G  + M QFK+KS++   +  ++
Sbjct: 75  AQYLALGIDPARSTVFVQSHVPAHTELAWVLGCFTGFGQASRMTQFKDKSQKQGADATTV 134

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GLF YPVLMAAD+LLY    VPVGEDQRQHLE+ R +AQRFN  F               
Sbjct: 135 GLFTYPVLMAADVLLYDTDLVPVGEDQRQHLELARDVAQRFNARFPDT------------ 182

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                 F I E +I  + ++I  L+D + KMSKS  +D   I LLD+P   AKKI+ A T
Sbjct: 183 ------FVIPEPMIPKATAKIYDLQDPTAKMSKSAGTDAGLITLLDDPKKTAKKIRSAVT 236

Query: 249 DGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
           D +    E+    E +    NL+ I A +    ++  ++ + G+ +   K   ADAV+E 
Sbjct: 237 DSE---REIRFDREQKAGVSNLLTIQAAVTGTDVDVLVEAYQGRGYGDLKKDTADAVVEF 293

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + PI  ++  LL D + L+ +L  GA RAR    +T++ V + +G 
Sbjct: 294 VTPIKNRVDELLADPAELEGVLATGAERARDVTAKTLQRVYDRLGF 339


>gi|21223215|ref|NP_628994.1| tryptophanyl-tRNA synthetase [Streptomyces coelicolor A3(2)]
 gi|289769575|ref|ZP_06528953.1| tryptophanyl-tRNA synthetase [Streptomyces lividans TK24]
 gi|25009450|sp|Q9KZA7|SYW2_STRCO RecName: Full=Tryptophanyl-tRNA synthetase 2; AltName:
           Full=Tryptophan--tRNA ligase 2; Short=TrpRS 2
 gi|7649569|emb|CAB89058.1| tryptophanyl-tRNA synthetase [Streptomyces coelicolor A3(2)]
 gi|289699774|gb|EFD67203.1| tryptophanyl-tRNA synthetase [Streptomyces lividans TK24]
          Length = 339

 Score =  238 bits (608), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 139/346 (40%), Positives = 193/346 (55%), Gaps = 23/346 (6%)

Query: 9   VSGVQPT-GVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SG+QPT G  HLGNYLG +R  +  Q+T  H   Y + DLHAIT     + LR  +R+ 
Sbjct: 11  LSGIQPTSGSFHLGNYLGAVRQWVDMQDT--HDAFYMVVDLHAITVPQDPKELRENTRVA 68

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A  LAAG+DP R  +F QS V  HA L W+++C+   G  + M QFK+KS +   +  +
Sbjct: 69  AAQLLAAGLDPDRCTLFVQSHVPEHAQLGWLMNCITGFGEASRMTQFKDKSAKQGNDRTT 128

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GLF YP+LM ADILLY+A  VPVGEDQRQHLE+TR +A RFN           Q Y   
Sbjct: 129 VGLFTYPMLMVADILLYQADQVPVGEDQRQHLELTRDLADRFN-----------QTYGDA 177

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F +    I    ++I  L+D + KMSKS ++    INLLD P   AKK++ A 
Sbjct: 178 -------FTVPTAYILKETAKIYDLQDPTAKMSKSAATPKGLINLLDEPKATAKKVKSAV 230

Query: 248 TDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
           TD D +       E +    NL+ I++T+   +I E  +++ GK +   K  LAD V+E 
Sbjct: 231 TDTDTVVR--FDRETKPGVSNLLTIYSTLTGAEIAELERKYEGKGYGALKTDLADVVVEF 288

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + P  ++ +  L D   LD IL +GA +AR  A ET+    + VG 
Sbjct: 289 VTPFRERTRQYLDDPETLDAILAKGAEKARSVAAETLARAYDEVGF 334


>gi|114561571|ref|YP_749084.1| tryptophanyl-tRNA synthetase [Shewanella frigidimarina NCIMB 400]
 gi|114332864|gb|ABI70246.1| tryptophanyl-tRNA synthetase [Shewanella frigidimarina NCIMB 400]
          Length = 332

 Score =  238 bits (608), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 131/347 (37%), Positives = 197/347 (56%), Gaps = 21/347 (6%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           + +SG QP+G L +GNY+G +R  +  Q++  H  +Y + DLHAIT     + LR     
Sbjct: 5   IVLSGAQPSGELTIGNYMGALRQWVAMQDS--HDCLYCVVDLHAITVRQDPKALREACLD 62

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
            +A +LA GVDP ++ +F QS V  H  L W+L+C  +MG +N M QFK+KS ++     
Sbjct: 63  TLALYLACGVDPKKSTVFIQSQVPQHTQLGWVLNCYTQMGELNRMTQFKDKSLKHANNI- 121

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           ++GL+ YPVLMAADILLY+A  +PVG+DQ+QHLE+TR IA RFN  +             
Sbjct: 122 NVGLYGYPVLMAADILLYQANEIPVGQDQKQHLELTRDIATRFNNAYGDT---------- 171

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F I E  I    +++ SL+D  KKMSKSD +  + I LL++P  I KK++KA
Sbjct: 172 --------FTIPEPFIPEHGAKVMSLQDPLKKMSKSDDNRNNVIGLLEDPKAILKKVKKA 223

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
            TD +  P     +E +    NL+ + +      I     +F GK +   K+A  +AV+ 
Sbjct: 224 MTDSEEPPVVRFDMEQKPGVSNLLSLMSGCTGQSIASLEAEFEGKMYGHLKVATGEAVVG 283

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + P+  + +    D +YL  ++ EGA +A+ RA+ T+K V E +GL
Sbjct: 284 MLEPLQARFKEYRADHAYLSQVMAEGAEKAQARAEVTIKKVYEKIGL 330


>gi|268609406|ref|ZP_06143133.1| tryptophanyl-tRNA synthetase [Ruminococcus flavefaciens FD-1]
          Length = 331

 Score =  238 bits (608), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 139/347 (40%), Positives = 195/347 (56%), Gaps = 24/347 (6%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           L  S +QPTG   LGNY+G +RN    QE  N   +Y IAD+HAIT       LR  S  
Sbjct: 6   LIFSAIQPTGTFTLGNYIGAVRNWAPLQEDYN--CIYCIADMHAITVKQEPAKLRQNSMA 63

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A  +A G+DP ++I+F QS V  HA L+W+L C  + G ++ M QFK+KS+++ E+  
Sbjct: 64  AYALLMACGLDPEKSILFIQSHVPTHALLNWVLCCNTQFGELSRMTQFKDKSQKHPEDIN 123

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           + GLF YP LMAADIL Y A  VPVG DQ+QHLE+ R IAQRFN           Q+Y  
Sbjct: 124 A-GLFTYPSLMAADILAYNADFVPVGVDQKQHLELARTIAQRFN-----------QRYGD 171

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                  FF + E  I    +++ SL+D +KKMSKSD +  S I +LD+ D I +K ++A
Sbjct: 172 -------FFTLPEPYIIDVGAKVMSLQDPTKKMSKSDENPNSCILILDDKDTIIRKFKRA 224

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
            TD +   +EV   E +    NL+ I++ +     E   K+F GK +  FKLA+ +AV +
Sbjct: 225 VTDSE---AEVCYREGKDGINNLMAIYSCVTGKDFEAIEKEFAGKGYGDFKLAVGEAVAD 281

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + P+  K   L+ DK+YL     +GA +A   +Q  +  V   VG 
Sbjct: 282 HLEPVRTKFDQLIADKAYLKQCYTDGAAKAFKYSQRIVSKVYHKVGF 328


>gi|332375901|gb|AEE63091.1| unknown [Dendroctonus ponderosae]
          Length = 370

 Score =  238 bits (608), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 141/346 (40%), Positives = 201/346 (58%), Gaps = 26/346 (7%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QPTG +H+GNYLG I   ++ Q+    L +  I DLH+IT       L        A
Sbjct: 33  SGIQPTGSIHIGNYLGAISQWVKLQDQNEDL-ILSIVDLHSITLPHDPHTLSTNILELTA 91

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           + L +G+DP++ I+F+QS+V  HA+L W L C++ M  + ++ Q+KEKS   K     LG
Sbjct: 92  TLLGSGIDPNKVILFQQSNVHAHAELCWCLGCISTMARLAHLPQYKEKSASLKN--IPLG 149

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF+YPVL AADIL Y++TH+PVGEDQ Q +++ + +A+ FN++F                
Sbjct: 150 LFVYPVLQAADILSYKSTHIPVGEDQVQQIQLCQELARMFNSKFGET------------- 196

Query: 190 YSKGFFPIIEGLIDSSA-SRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                FPI   +I SS   RI+SLRD SKKMSKSD  + SRI L D PD+I + I+KA T
Sbjct: 197 -----FPIPHTMITSSEYGRIKSLRDPSKKMSKSDPDEKSRICLTDAPDVIVRNIKKAVT 251

Query: 249 DGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
           D     SEV+   E R    NL+ I + +    I+   K+    +  +FKL +ADAV+  
Sbjct: 252 D---FQSEVTFDAEKRPGISNLLSIHSFVTGKSIDTICKEAEHLDTGRFKLEVADAVVAY 308

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + PI   I   L DKSYL  +L +GA +A   A +T+K V+E +G+
Sbjct: 309 VKPIQDTIAQHLSDKSYLLNVLAQGAEKASNIANDTLKEVHEKLGM 354


>gi|167769684|ref|ZP_02441737.1| hypothetical protein ANACOL_01018 [Anaerotruncus colihominis DSM
           17241]
 gi|167668045|gb|EDS12175.1| hypothetical protein ANACOL_01018 [Anaerotruncus colihominis DSM
           17241]
          Length = 348

 Score =  238 bits (608), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 135/346 (39%), Positives = 203/346 (58%), Gaps = 28/346 (8%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QPTG   LGNYLG +RN +  Q+  + +  Y I ++HA+T     + LR  +   +A
Sbjct: 18  SGIQPTGTFTLGNYLGAVRNWVELQDEYDCV--YSIVNMHAMTIRQEPKALRDNTISALA 75

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
             +A G+DP ++I+F QS V  HA+LSW+LSC  + G ++ M QFK+KS ++ E   + G
Sbjct: 76  LLMACGIDPEKSILFIQSHVRTHAELSWVLSCYTQFGELSRMTQFKDKSAKHPENI-NAG 134

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YPVLMAADILLY+   VPVG DQ+QHLE+ R IAQRFN  +                
Sbjct: 135 LFTYPVLMAADILLYQTDLVPVGIDQKQHLELARNIAQRFNGIY---------------- 178

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                F I +G     A+++ SL D +KKMSKSD +  + I++LD P+ I KK + A TD
Sbjct: 179 --GNVFAIPDGYYPKLAAKVMSLSDPTKKMSKSDDNPKAYISILDKPETIVKKFKSAVTD 236

Query: 250 GDVLPSEVSGLENRLEAKNLIEIF--ATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
            D   +EV+  + +    NL+ I+  AT R     EA  +F G+ +  FKLA+ +AV+E 
Sbjct: 237 SD---AEVAYRQGKDGVNNLMAIYSVATGRDFSAIEA--EFAGRGYGDFKLAVGEAVVEM 291

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + P+ ++    ++D++YL+    +GA RA   +  T++ V + +G 
Sbjct: 292 LRPVRERYDQYMQDRAYLEACYTQGAQRALSVSYRTLEKVYKKIGF 337


>gi|330465686|ref|YP_004403429.1| tryptophanyl-tRNA synthetase [Verrucosispora maris AB-18-032]
 gi|328808657|gb|AEB42829.1| tryptophanyl-tRNA synthetase [Verrucosispora maris AB-18-032]
          Length = 341

 Score =  238 bits (608), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 139/347 (40%), Positives = 200/347 (57%), Gaps = 27/347 (7%)

Query: 10  SGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           SG+QPT    HLGNYLG +R+ +  QE+  H  +Y + DLHAIT     + L  +SR+  
Sbjct: 12  SGIQPTADSFHLGNYLGAVRHWVALQES--HDAVYCVVDLHAITAGHDPKVLHQRSRVAA 69

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A  LA G+DP R  +F QS V  HA L+W+L C+   G  + M QFK+KS++   E AS+
Sbjct: 70  AQLLAVGLDPERCTLFVQSQVPEHAQLAWVLGCLTGFGEASRMTQFKDKSQKQGNERASV 129

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GLF YP+L AADILLY+A  VPVGEDQRQHLE++R +AQRFNT F               
Sbjct: 130 GLFTYPILQAADILLYQANAVPVGEDQRQHLELSRDLAQRFNTHF--------------- 174

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                F   +  ++ ++A +I  L+D + KMSKS SS    ++LL++P   AKKI+ A T
Sbjct: 175 --GPTFTVPVPHIVKATA-KITDLQDPTAKMSKSSSSPAGIVDLLEDPARSAKKIRSAVT 231

Query: 249 DG--DVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
           D   +++  E    E +    NL+ I++ +   +I++ +  + GK +   K  LA+ V E
Sbjct: 232 DTGREIVFDE----ETKPGISNLLTIYSALSGREIDDLVAAYDGKGYGDLKKDLAEVVRE 287

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + PI  + +  L+D + LD +L  GA +AR  A  T+  V E VG 
Sbjct: 288 FVTPIQARTRSYLEDPAQLDKLLAAGAEKARRLAVPTLLKVYERVGF 334


>gi|295097000|emb|CBK86090.1| tryptophanyl-tRNA synthetase [Enterobacter cloacae subsp. cloacae
           NCTC 9394]
          Length = 334

 Score =  238 bits (608), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 134/347 (38%), Positives = 195/347 (56%), Gaps = 21/347 (6%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           +  SG QP+G L +GNY+G +R  +  Q+  ++  +Y I DLHAIT     E LR  +  
Sbjct: 5   IVFSGAQPSGELTIGNYMGALRQWVSMQD--DYHCIYCIVDLHAITARQDPEKLRKATLD 62

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
            +A +LA G+DP ++ IF QS V  HA L W L+C    G ++ M QFK+KS    E   
Sbjct: 63  TLALYLACGIDPEKSTIFVQSHVPEHAQLGWALNCYTYFGELSRMTQFKDKSARYSENIN 122

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           + GLF YPVLMAADILLY+   VPVGEDQ+QHLE++R IAQRFN  +             
Sbjct: 123 A-GLFDYPVLMAADILLYQTNQVPVGEDQKQHLELSRDIAQRFNALY------------- 168

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F + E  I  S +R+ SL + +KKMSKSD +  + I LL++P  + KK+++A
Sbjct: 169 -----GDVFKVPEPFIPKSGARVMSLLEPTKKMSKSDDNRNNVIGLLEDPKSVVKKLKRA 223

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
            TD D  P     ++N+    NL++I + +    I E  K F GK +   K  +ADAV  
Sbjct: 224 VTDSDEPPVVRYDVQNKAGVSNLLDILSGVTGQSIPELEKHFEGKMYGHLKGEVADAVSG 283

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            +  + ++      D+++L  ++ EGA +A  RA ET+K V + +G 
Sbjct: 284 MLTELQERYHRYRNDEAFLQKVMKEGAEKASARASETLKAVYDAIGF 330


>gi|328884561|emb|CCA57800.1| Tryptophanyl-tRNA synthetase [Streptomyces venezuelae ATCC 10712]
          Length = 337

 Score =  238 bits (608), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 141/358 (39%), Positives = 195/358 (54%), Gaps = 31/358 (8%)

Query: 1   MLSSDNLFVSGVQPT-GVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQEN 59
           M S     +SG+QPT G  HLGNYLG +R  +  QET  H   Y + DLHAIT       
Sbjct: 1   MASDSPRVLSGIQPTAGSFHLGNYLGAVRQWVALQET--HDAFYMVVDLHAITVPQDPAE 58

Query: 60  LRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSK 119
           LR  +RL  A  LAAG+DP R  +F QS V  HA L W+++C+   G  + M QFK+KS 
Sbjct: 59  LRANTRLAAAQLLAAGLDPERCTLFVQSHVPEHAQLGWVMNCLTGFGEASRMTQFKDKSA 118

Query: 120 ENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKE 179
           +   + A++GLF YP+L  ADILLY+A  VPVGEDQRQH+E+TR +A+RFN  F      
Sbjct: 119 KQGADRATVGLFTYPILQVADILLYQANQVPVGEDQRQHIELTRDLAERFNGRFGET--- 175

Query: 180 VAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDII 239
                          F I    I    ++I  L+D + KMSKS S+    INLLD+P   
Sbjct: 176 ---------------FTIPAPYILKETAKIYDLQDPAIKMSKSASTPKGLINLLDDPKTT 220

Query: 240 AKKIQKAKTDGDVL----PSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQ 295
           AKK++ A TD + +    P      EN+    NL+ I +T+    +E+  K + GK +  
Sbjct: 221 AKKVKSAVTDTETVIRFDP------ENKAGVSNLLTIMSTLTATSVEDLEKSYEGKMYGA 274

Query: 296 FKLALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            K  LA+ +++ + P   + Q  L D   LD++L +GA +AR  A ET+    E +G 
Sbjct: 275 LKTDLAEVMVDFVTPFRTRTQEYLDDPETLDSVLAKGAEKARTVAAETLAQTYERIGF 332


>gi|116070821|ref|ZP_01468090.1| tryptophanyl-tRNA synthetase [Synechococcus sp. BL107]
 gi|116066226|gb|EAU71983.1| tryptophanyl-tRNA synthetase [Synechococcus sp. BL107]
          Length = 337

 Score =  238 bits (608), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 146/351 (41%), Positives = 198/351 (56%), Gaps = 28/351 (7%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQPTG LHLGN+LG IRN +  Q+T  H     + DLHAIT       L   +R   
Sbjct: 7   LSGVQPTGALHLGNWLGAIRNWVDLQDT--HDTYVCVVDLHAITVPHDPSQLAADTRSTA 64

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+DP R  IF QS V  H++L W+L+CV  + W+  MIQFKEKS + + +  S+
Sbjct: 65  ALYLACGMDPERCSIFIQSQVAAHSELCWLLNCVTPLNWLERMIQFKEKSVK-QGDNVSV 123

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIA-QRFNTEFERKIKEVAQKYAQE 187
           GL  YPVLMAADILLY A  VPVGEDQ+QHLE+ R IA QR N  F  K   V       
Sbjct: 124 GLLDYPVLMAADILLYDADLVPVGEDQKQHLELARDIAQQRINARFGSKENPVLN----- 178

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                    + + LI    +R+ SL D   KMSKSD ++ SRI LLD P++I KKI++AK
Sbjct: 179 ---------VPKPLILKEGARVMSLTDGRNKMSKSDPNEGSRITLLDPPELITKKIKRAK 229

Query: 248 TDGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           TD +       GLE    +R E  NL+ ++A + +   E    Q     + QFK  LA+A
Sbjct: 230 TDPE------RGLEFGNPDRPETDNLLGLYAILSEQGREAVATQCADMGWGQFKPLLAEA 283

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
            +  + PI  + + L+ +   LD +L +G  +A   A  T+  V + +G +
Sbjct: 284 AVAALEPIQGRYKELIDNPEELDLVLEQGRQKAEAVANATLNRVKKSLGFA 334


>gi|293393370|ref|ZP_06637682.1| tryptophan-tRNA ligase [Serratia odorifera DSM 4582]
 gi|291424107|gb|EFE97324.1| tryptophan-tRNA ligase [Serratia odorifera DSM 4582]
          Length = 334

 Score =  238 bits (607), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 134/350 (38%), Positives = 197/350 (56%), Gaps = 21/350 (6%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  +  SG QP+G L +GNY+G +R  +  Q+  ++  +Y I DLHAIT     E LR  
Sbjct: 2   SKPIVFSGAQPSGELTIGNYMGALRQWVHLQD--DYDCIYCIVDLHAITVRQDAETLRKA 59

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           +   +A +LA G+DP+++ IF QS V  H  LSW L+C    G ++ M QFK+KS    E
Sbjct: 60  TLDTLALYLACGIDPNKSTIFVQSHVPEHTQLSWALNCYTYFGELSRMTQFKDKSSRYAE 119

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
              + GLF YPVLMAADILLY+   VPVGEDQ+QHLE++R +A RFN  +          
Sbjct: 120 NINA-GLFSYPVLMAADILLYQTNQVPVGEDQKQHLELSRDVASRFNALYGE-------- 170

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
                      F + E  I  S +R+ SL++ +KKMSKSD +  + I LL++P  + KKI
Sbjct: 171 ----------IFKVPEPFIPKSGARVMSLQEPTKKMSKSDDNRNNVIGLLEDPKAVTKKI 220

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           ++A TD D  P     + N+    NL++I + +    I E   +F G+ +   K A+ADA
Sbjct: 221 KRAMTDSDEPPVIRYDVANKAGVSNLLDILSGVTGKPIAELEAEFEGQMYGHLKGAVADA 280

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           V   +  +  +      D++YL  ++ +GA +AR RAQET+  V + +G 
Sbjct: 281 VSGMLSELQVRYHQFRNDEAYLQQVMRDGAAKARARAQETLSKVYQAIGF 330


>gi|20807900|ref|NP_623071.1| tryptophanyl-tRNA synthetase [Thermoanaerobacter tengcongensis MB4]
 gi|25009428|sp|Q8R9X8|SYW_THETN RecName: Full=Tryptophanyl-tRNA synthetase; AltName:
           Full=Tryptophan--tRNA ligase; Short=TrpRS
 gi|20516467|gb|AAM24675.1| Tryptophanyl-tRNA synthetase [Thermoanaerobacter tengcongensis MB4]
          Length = 327

 Score =  238 bits (607), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 137/345 (39%), Positives = 205/345 (59%), Gaps = 28/345 (8%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQP+G +H+GNYLG +R  +  Q+  ++   + + DLHA+T       L+  +    A
Sbjct: 6   SGVQPSGDIHIGNYLGAMRQFVALQD--DYDCFFCVVDLHALTVPQDPVELKKNTIELAA 63

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            ++A G+DP +  +F QS V  HA+L+W+L C+   G ++ M QFKEKSK   +E+ S+G
Sbjct: 64  LYMAIGLDPKKVTLFVQSHVSAHAELAWLLQCITYFGELSRMTQFKEKSK--GKESVSVG 121

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LMAADILLY+  +VPVGEDQ+QHLE+TR +AQRFN  F                
Sbjct: 122 LFTYPDLMAADILLYKTHYVPVGEDQKQHLELTRDVAQRFNNRFGET------------- 168

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                F I E +I    +RI SL + +KKMSKSD+   +R+NLLD+PD I +KI KA TD
Sbjct: 169 -----FVIPEPMILKFGARIMSLTNPTKKMSKSDADPNNRVNLLDDPDTIYRKIMKAVTD 223

Query: 250 GDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
            +   SE+    E +    NL+ I++    ++++E + +F G+ +   K  LA+ VI+++
Sbjct: 224 SE---SEIRLDWEKKPGISNLLTIYSLFTGMEVDEVVNKFKGQGYGTLKKELAEVVIDKL 280

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
             I +  + + +++     +L EGA RA   A ET+K V E +GL
Sbjct: 281 SVIQKNYRDISEEEVL--RVLKEGAERAEAVAVETLKEVKEKMGL 323


>gi|254479483|ref|ZP_05092808.1| tryptophanyl-tRNA synthetase [Carboxydibrachium pacificum DSM
           12653]
 gi|214034587|gb|EEB75336.1| tryptophanyl-tRNA synthetase [Carboxydibrachium pacificum DSM
           12653]
          Length = 329

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 137/345 (39%), Positives = 205/345 (59%), Gaps = 28/345 (8%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQP+G +H+GNYLG +R  +  Q+  ++   + + DLHA+T       L+  +    A
Sbjct: 8   SGVQPSGDIHIGNYLGAMRQFVALQD--DYDCFFCVVDLHALTVPQDPVELKKNTIELAA 65

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            ++A G+DP +  +F QS V  HA+L+W+L C+   G ++ M QFKEKSK   +E+ S+G
Sbjct: 66  LYMAIGLDPKKVTLFVQSHVSAHAELAWLLQCITYFGELSRMTQFKEKSK--GKESVSVG 123

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LMAADILLY+  +VPVGEDQ+QHLE+TR +AQRFN  F                
Sbjct: 124 LFTYPDLMAADILLYKTHYVPVGEDQKQHLELTRDVAQRFNNRFGET------------- 170

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                F I E +I    +RI SL + +KKMSKSD+   +R+NLLD+PD I +KI KA TD
Sbjct: 171 -----FVIPEPMILKFGARIMSLTNPTKKMSKSDADPNNRVNLLDDPDTIYRKIMKAVTD 225

Query: 250 GDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
            +   SE+    E +    NL+ I++    ++++E + +F G+ +   K  LA+ VI+++
Sbjct: 226 SE---SEIRLDWEKKPGISNLLTIYSLFTGMEVDEVVNKFKGQGYGTLKKELAEVVIDKL 282

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
             I +  + + +++     +L EGA RA   A ET+K V E +GL
Sbjct: 283 SVIQKNYRDISEEEVL--RVLKEGAERAEAVAVETLKEVKEKMGL 325


>gi|88861002|ref|ZP_01135637.1| tryptophanyl-tRNA synthetase [Pseudoalteromonas tunicata D2]
 gi|88816930|gb|EAR26750.1| tryptophanyl-tRNA synthetase [Pseudoalteromonas tunicata D2]
          Length = 334

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 141/355 (39%), Positives = 201/355 (56%), Gaps = 37/355 (10%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           + +SG+QPTG + +GNY+G I   +  Q+  +H   + + DLHAIT  + QE    + R+
Sbjct: 5   VVLSGIQPTGGMTIGNYIGAINQWLTLQQ--DHDCFFMLVDLHAIT--VRQEPAVLRQRV 60

Query: 67  F--VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEE 124
              +A + A G+DP ++ +F QS V  HA LSW+L+C A+MG +N M QFK+KS +N   
Sbjct: 61  LDGIALYAACGIDPEKSALFVQSQVPEHAQLSWVLNCYAQMGELNRMTQFKDKSAKNVNN 120

Query: 125 TASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKY 184
             ++GL+ YPVL AADILLY+A  VPVGEDQ+QHLE+TR IA RFN  +           
Sbjct: 121 I-NVGLYSYPVLQAADILLYQADQVPVGEDQKQHLELTRDIANRFNNLY----------- 168

Query: 185 AQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQ 244
                     F I E  I    +R+ SL+D SKKMSKSD +    I LLD P  I KK++
Sbjct: 169 -------GDVFKIPEPYIPQFGARVMSLQDPSKKMSKSDENPNGYIMLLDEPKQIEKKLK 221

Query: 245 KAKTDGD------VLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKL 298
           KA TD D        P E +G+       NL+ + +   +  IEE +  + GK +   K 
Sbjct: 222 KAVTDSDEQARIYFDPQEKAGVS------NLLTLLSVATKRSIEELVPDYEGKMYGHLKK 275

Query: 299 ALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
             ADAV+  I PI  + + +  D++ L+ I+  GA +A  RA+ T+K V + VG 
Sbjct: 276 DTADAVVSMIEPIQARFKEIRNDQALLNQIMRTGAEKAGVRAENTLKAVYDAVGF 330


>gi|293375831|ref|ZP_06622100.1| tryptophan--tRNA ligase [Turicibacter sanguinis PC909]
 gi|325841032|ref|ZP_08167241.1| tryptophan--tRNA ligase [Turicibacter sp. HGF1]
 gi|292645539|gb|EFF63580.1| tryptophan--tRNA ligase [Turicibacter sanguinis PC909]
 gi|325490098|gb|EGC92441.1| tryptophan--tRNA ligase [Turicibacter sp. HGF1]
          Length = 332

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 137/348 (39%), Positives = 203/348 (58%), Gaps = 25/348 (7%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +S +QP+G L +GNYLG ++N ++ Q+   H   +FI D HAIT    +  LR + +   
Sbjct: 5   LSAIQPSGTLTIGNYLGALKNFVKLQD--EHECFFFIVDQHAITVPQDRLELRKKIKELT 62

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKEN--KEETA 126
           A +LA G+DP +  IF QS+V  H  L+W+L+C   MG +  M QFK+KS++   K +  
Sbjct: 63  ALYLACGLDPEKATIFVQSEVPAHTQLAWMLTCNTSMGELERMTQFKDKSQKQSAKGQGI 122

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
            +GLFMYPVLMAADILLY    VPVG+DQ+QHLE+TR +A+RFN  F             
Sbjct: 123 GVGLFMYPVLMAADILLYDVDFVPVGDDQKQHLELTRDLAERFNNRFGET---------- 172

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F I E LI  + +RI SL++ +KKMSKSD +  + I + D P++I KKI+ A
Sbjct: 173 --------FKIPEPLIAKTGARIMSLQEPTKKMSKSDDNARNFILMTDEPNVIRKKIKSA 224

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
            TD D + +     EN+    NL+EI++T+    I+  + ++ G  +  FK  LA+ V+ 
Sbjct: 225 MTDSDGIIA--FDRENKPGISNLLEIYSTITGESIDSLVARYDGAGYGTFKSDLAEVVVA 282

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
           E+ PI Q+++ LL +   +D +L  GA RA   A + +K     +GL 
Sbjct: 283 ELEPIQQRMKELL-NSPIIDEVLDRGAERANQLAFKKVKKAEHKMGLG 329


>gi|239929353|ref|ZP_04686306.1| tryptophanyl-tRNA synthetase [Streptomyces ghanaensis ATCC 14672]
 gi|291437683|ref|ZP_06577073.1| tryptophanyl-tRNA synthetase 2 [Streptomyces ghanaensis ATCC 14672]
 gi|291340578|gb|EFE67534.1| tryptophanyl-tRNA synthetase 2 [Streptomyces ghanaensis ATCC 14672]
          Length = 337

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 138/354 (38%), Positives = 195/354 (55%), Gaps = 23/354 (6%)

Query: 1   MLSSDNLFVSGVQPT-GVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQEN 59
           M S     +SG+QPT G  HLGNYLG +R  +  Q T  H   Y + DLHA+T     + 
Sbjct: 1   MASERPRVLSGIQPTSGSFHLGNYLGAVRQWVDMQNT--HDAFYMVVDLHAVTVPQDPKE 58

Query: 60  LRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSK 119
           LR  +R+  A  LAAG+DP R  +F QS V  HA L W+++C+   G  + M QFK+KS 
Sbjct: 59  LRENTRVAAAQLLAAGLDPDRCTLFVQSHVPEHAQLGWLMNCITGFGEASRMTQFKDKSA 118

Query: 120 ENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKE 179
               +  ++GLF YP+LM ADILLY+A  VPVGEDQRQHLE+TR +A RFN         
Sbjct: 119 RQGSDRTTVGLFTYPMLMVADILLYQADQVPVGEDQRQHLELTRDLADRFN--------- 169

Query: 180 VAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDII 239
             Q Y          F +    I    ++I  L+D + KMSKS S+    INLLD P   
Sbjct: 170 --QTYGDT-------FTVPSAYILKETAKIYDLQDPTIKMSKSASTPKGLINLLDEPKTT 220

Query: 240 AKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLA 299
           AKK++ A TD D +    +  EN+    NL+ I++T+    + E  +++ GK +   K  
Sbjct: 221 AKKVKSAVTDTDTVIRYDA--ENKPGVSNLLTIYSTLTGTGVTELEERYAGKGYGALKTD 278

Query: 300 LADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           LA+ ++E + P  ++ Q  L D   LD++L +GA +AR  A ET+    + +G 
Sbjct: 279 LAEVMVEFVTPFKERTQQYLDDPETLDSLLAKGAEKARAVAAETLARAYDRMGF 332


>gi|296105076|ref|YP_003615222.1| tryptophanyl-tRNA synthetase [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295059535|gb|ADF64273.1| tryptophanyl-tRNA synthetase [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 334

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 134/347 (38%), Positives = 195/347 (56%), Gaps = 21/347 (6%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           +  SG QP+G L +GNY+G +R  +  Q+  ++  +Y I DLHAIT     E LR  +  
Sbjct: 5   IVFSGAQPSGELTIGNYMGALRQWVSMQD--DYHCIYCIVDLHAITARQDPEKLRKATLD 62

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
            +A +LA G+DP ++ IF QS V  HA L W L+C    G ++ M QFK+KS    E   
Sbjct: 63  TLALYLACGIDPEKSTIFVQSHVPEHAQLGWALNCYTYFGELSRMTQFKDKSARYSENIN 122

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           + GLF YPVLMAADILLY+   VPVGEDQ+QHLE++R IAQRFN  +             
Sbjct: 123 A-GLFDYPVLMAADILLYQTNQVPVGEDQKQHLELSRDIAQRFNALYGE----------- 170

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F + E  I  S +R+ SL + +KKMSKSD +  + I LL++P  + KK+++A
Sbjct: 171 -------VFKVPEPFIPKSGARVMSLLEPTKKMSKSDDNRNNVIGLLEDPKSVVKKLKRA 223

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
            TD D  P     ++N+    NL++I + +    I E  + F GK +   K  +ADAV  
Sbjct: 224 VTDSDEPPVVRYDVQNKAGVSNLLDILSGVTGQSIPELEQHFEGKMYGHLKGEVADAVSG 283

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            +  + ++      D+++L  ++ EGA +A  RA ET+K V E +G 
Sbjct: 284 MLTELQERYHRYRNDEAFLQKVMKEGAEKASARASETLKAVYEAIGF 330


>gi|38233242|ref|NP_939009.1| tryptophanyl-tRNA synthetase [Corynebacterium diphtheriae NCTC
           13129]
 gi|38199501|emb|CAE49152.1| tryptophanyl-tRNA synthetase [Corynebacterium diphtheriae]
          Length = 344

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 134/347 (38%), Positives = 197/347 (56%), Gaps = 25/347 (7%)

Query: 9   VSGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SG+QPT    HLGNYLG ++  I  Q+  N+   YFI DLHAIT +     LR ++   
Sbjct: 16  LSGIQPTADSYHLGNYLGALKQWIELQD--NYEAFYFIPDLHAITVDQDPRELRERTIAG 73

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A  LA G+DP ++ +F QS V  HA+L W+L+C+   G  + M QFK+KS +   +  S
Sbjct: 74  AAQLLALGIDPHKSTLFVQSHVPEHAELGWVLTCLTGFGEASRMTQFKDKSAKRGADRTS 133

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
            GLF YP+LMAADILLYR   VPVGEDQRQHLE+TR +A+RFN+ F++            
Sbjct: 134 AGLFTYPMLMAADILLYRPQFVPVGEDQRQHLELTRTLAERFNSRFKKT----------- 182

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F + +G+I   A++I  L+D + KMSKS S+    INLLD+P + AK+I+ A 
Sbjct: 183 -------FVVPDGIIPEGAAKIYDLQDPTSKMSKSGSNPKGLINLLDDPKVSAKRIRSAV 235

Query: 248 TDGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
           TD D    E+    EN+    NL+ I + +    I+  +  + G+ +   K+  ADA+  
Sbjct: 236 TDND---GEIRFDKENKPGVSNLLVIQSALTGKTIDSLVDAYQGQGYGALKVDTADALEA 292

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + P+  +    + D++ L+ +L  GA +AR  A  T+    E +G 
Sbjct: 293 FVTPLKAQYDMYMSDRAELENVLALGAEKAREIASRTLADAYEHIGF 339


>gi|295116055|emb|CBL36902.1| tryptophanyl-tRNA synthetase [butyrate-producing bacterium SM4/1]
          Length = 378

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 133/353 (37%), Positives = 204/353 (57%), Gaps = 24/353 (6%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENL 60
           ML       SG+Q TG L LGNYLG ++N +   +   +   + + D+H+IT       L
Sbjct: 45  MLDGKKTLFSGMQATGNLTLGNYLGALKNWVTISD--EYQTFFSVVDMHSITVRQDPAEL 102

Query: 61  RYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKE 120
           R ++R  +  ++AAG+DP +N I+ QS V  HA+L+WIL+C   MG +N M QFK+K+ +
Sbjct: 103 RKRARNLLTLYIAAGLDPEKNCIYYQSHVSGHAELAWILNCFTYMGELNRMTQFKDKAAK 162

Query: 121 NKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEV 180
           + +   + GLF YPVLMAADILLY+A  VPVG DQ QHLE+TR IA RFN  +       
Sbjct: 163 HADNINA-GLFTYPVLMAADILLYQADVVPVGIDQMQHLELTRDIAIRFNNIY------- 214

Query: 181 AQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIA 240
                         F + E  I  + ++I SL+D +KKMSKSD +    I L+D+PD I 
Sbjct: 215 -----------GDVFTVPEAYIGKAGAKIMSLQDPAKKMSKSDENPNGSIYLMDDPDTII 263

Query: 241 KKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLAL 300
           +K ++A TD +     V   + +   KNLI+I+        E+  ++F GK +  FK+A+
Sbjct: 264 RKFKRAVTDSEAC---VRYCDEQPGIKNLIDIYRACTGKTPEDVEREFDGKGYGDFKMAV 320

Query: 301 ADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            +AV+  + P+ +K   L KDK+Y+D+++   A +A+  + +T++ V + VG 
Sbjct: 321 GEAVVGVLRPLQEKYAELSKDKAYIDSVIKTNAEKAQYFSSKTLRKVQKKVGF 373


>gi|146294781|ref|YP_001185205.1| tryptophanyl-tRNA synthetase [Shewanella putrefaciens CN-32]
 gi|145566471|gb|ABP77406.1| tryptophanyl-tRNA synthetase [Shewanella putrefaciens CN-32]
          Length = 332

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 130/347 (37%), Positives = 201/347 (57%), Gaps = 21/347 (6%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           + +SG QP+G L +GNY+G +R  +  Q++  H  +Y + DLHAIT     + LR     
Sbjct: 5   IVLSGAQPSGELTIGNYMGALRQWVAMQDS--HDCLYCVVDLHAITVRQDPKTLREACLD 62

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
            +A +LA GVDP ++ +F QS V  H  L W L+C  +MG ++ M QFK+KS+++     
Sbjct: 63  TLALYLACGVDPKKSTVFIQSQVPQHTQLGWALNCYTQMGELSRMTQFKDKSQKHANNI- 121

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           ++GLF YPVLMAADIL+Y+A  +PVG+DQ+QHLE+TR IA RFN  +             
Sbjct: 122 NVGLFGYPVLMAADILIYQANEIPVGQDQKQHLELTRDIATRFNNAYGDT---------- 171

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F I E  I    +++ SL++  KKMSKSD +  + I LL++P  + KK++KA
Sbjct: 172 --------FTIPEPFIPEHGAKVMSLQEPLKKMSKSDENRNNVIGLLEDPKSVLKKLKKA 223

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
            TD D  P     L+N+    NL+ + + +    I     +F GK +   K+A  +AV+ 
Sbjct: 224 MTDSDEPPVVRFDLDNKPGVSNLLSLMSGVTGQSIASLEAEFEGKMYGHLKVAAGEAVVG 283

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + P+ ++ + +  D++YLD ++  GA  A+ RA+ T+K V E +GL
Sbjct: 284 MLEPLQERYRAIRADRAYLDQVMKAGAENAQARAEVTLKKVYEKIGL 330


>gi|255994577|ref|ZP_05427712.1| tryptophan--tRNA ligase [Eubacterium saphenum ATCC 49989]
 gi|255993290|gb|EEU03379.1| tryptophan--tRNA ligase [Eubacterium saphenum ATCC 49989]
          Length = 326

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 150/348 (43%), Positives = 199/348 (57%), Gaps = 29/348 (8%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQPTG +HLGNYLG +R     Q+  +   MY I DLH+IT       L+       A
Sbjct: 6   SGVQPTGNIHLGNYLGAMRQFTELQDEYD--TMYCIVDLHSITVEQDPAELKEHILDVAA 63

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LA GVDP +  IF QS+V  H++L+W+L C +  G ++ M Q+KEKSK N  E++ +G
Sbjct: 64  LYLAIGVDPKKATIFVQSNVPAHSELAWLLMCNSYTGELSRMTQYKEKSKGN--ESSIVG 121

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YPVLMAADILLY    VPVGEDQRQHLE+TR IA+RFNT           KY +   
Sbjct: 122 LFTYPVLMAADILLYDTDVVPVGEDQRQHLELTRDIARRFNT-----------KYGET-- 168

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                F + E     +A+RI SL D  KKMSKS+ S++SRI LLD+   I K I KA+TD
Sbjct: 169 -----FTVPEARTLKTATRIMSLDDPGKKMSKSNESEYSRIALLDDEKKINKTIAKAQTD 223

Query: 250 --GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
             G +   E    +N+    NLI I+AT+     EE    +    +S FK  LA  +   
Sbjct: 224 SEGHIRYDE----KNKPAVSNLINIYATITCKTKEEVENLYKDSRYSDFKKDLATEIERL 279

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLSH 355
           I PI ++   +   K  +D IL EG  +A+ RA+  MK V + +GL +
Sbjct: 280 IKPIRERFSEVRGSKELVD-ILKEGDMKAKDRAEIMMKKVKDKIGLGY 326


>gi|148239116|ref|YP_001224503.1| tryptophanyl-tRNA synthetase [Synechococcus sp. WH 7803]
 gi|147847655|emb|CAK23206.1| Tryptophanyl-tRNA synthetase [Synechococcus sp. WH 7803]
          Length = 337

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 140/349 (40%), Positives = 195/349 (55%), Gaps = 28/349 (8%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQPTG LHLGN+LG IRN +  Q   +H   + + DLHA+T     + L   +    
Sbjct: 7   LSGVQPTGALHLGNWLGAIRNWVDLQH--DHDTFFCVVDLHAVTVPHDPQRLAEDTLTTA 64

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+DP    IF QS V  H++L W+L+CV  + W+  MIQFKEK+ + + +  S+
Sbjct: 65  ALYLACGLDPELCTIFVQSQVSAHSELCWLLNCVTPLNWLERMIQFKEKAVK-QGDNVSV 123

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIA-QRFNTEFERKIKEVAQKYAQE 187
           GL  YPVLMAADILLY A  VPVGEDQ+QHLE+ R IA QR N  F  +   + +     
Sbjct: 124 GLLDYPVLMAADILLYDADLVPVGEDQKQHLELARDIAQQRINARFGSEDAPILK----- 178

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                    + + LI    +R+ SL D   KMSKSD ++ SRI LLD P++I KKI++AK
Sbjct: 179 ---------VPKPLILKDGARVMSLTDGRSKMSKSDPNEGSRITLLDPPELITKKIKRAK 229

Query: 248 TDGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           TD +       GLE     R E  NL+ ++A +     E A  +     + QFK  LA+A
Sbjct: 230 TDPE------RGLEFGNPERPETDNLLGLYALLSGKGREAAATECAAMGWGQFKPLLAEA 283

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVG 352
            +  + PI ++ Q L+ D+  L  +L  G  RA   A  + + V   +G
Sbjct: 284 TVAALEPIQKRYQDLMADRGQLLAVLETGRERASAVADASAQRVRAALG 332


>gi|50549011|ref|XP_501976.1| YALI0C18425p [Yarrowia lipolytica]
 gi|49647843|emb|CAG82296.1| YALI0C18425p [Yarrowia lipolytica]
          Length = 370

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 141/362 (38%), Positives = 203/362 (56%), Gaps = 34/362 (9%)

Query: 10  SGVQPTGVLHLGNYLGMIR---NVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           S +QPTGV HLGNYLG +R   +V +          +  ADLHAIT     + L+     
Sbjct: 23  SMIQPTGVFHLGNYLGAVRGWADVAKANPDPTTEIFFGAADLHAITMPKDPKQLQEWRHD 82

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
            +AS LAAG+DP R  +F QS +  H  L W+LS    MG++N M+Q+K  SK    E+A
Sbjct: 83  ALASILAAGIDPDRCSVFFQSAIPEHTQLYWVLSNSIGMGYLNRMVQWK--SKAGVAESA 140

Query: 127 SL------------GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFE 174
           S             GLF YP L AADIL+Y++THVPVGEDQ QHLE+TR  AQ FN ++ 
Sbjct: 141 SFFEDSELLSQLKHGLFSYPALQAADILMYKSTHVPVGEDQSQHLELTRAAAQSFNAQYA 200

Query: 175 RKIKEVAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLD 234
            K               K FFPI   L  +   +I SLRD SKKMSKSD +  + I + +
Sbjct: 201 SK--------------KKPFFPIPTTLF-APTKKIASLRDPSKKMSKSDPNKMASIFITE 245

Query: 235 NPDIIAKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGG-KNF 293
           +P+ I KK + A +D D  P  +   ENR    NL+ I A ++++ IE+  K     K F
Sbjct: 246 SPEQIYKKFKSAVSDSDPAPF-LYDPENRPGLSNLMTIMAGVQRVSIEDVEKNIADIKTF 304

Query: 294 SQFKLALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + K  ++D V+E++ P+  +   L  D++YL++I+ +G  +AR +A +T+K V +++G 
Sbjct: 305 GELKKTVSDIVVEDLAPVRSEFDRLKNDRAYLESIVNKGNLKAREKASKTLKEVYDLIGF 364

Query: 354 SH 355
            +
Sbjct: 365 GN 366


>gi|311277681|ref|YP_003939912.1| tryptophanyl-tRNA synthetase [Enterobacter cloacae SCF1]
 gi|308746876|gb|ADO46628.1| tryptophanyl-tRNA synthetase [Enterobacter cloacae SCF1]
          Length = 334

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 136/347 (39%), Positives = 196/347 (56%), Gaps = 21/347 (6%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           +  SG QP+G L +GNY+G +R  +  Q+  ++  +Y I D HAIT     + LR  +  
Sbjct: 5   IVFSGAQPSGELTIGNYMGALRQWVNMQD--DYHCIYCIVDQHAITVRQDPQALRKATLD 62

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
            +A +LA G+DP ++ IF QS V  HA LSW L+C    G ++ M QFK+KS    E   
Sbjct: 63  TLALYLACGIDPEKSTIFVQSHVPEHAQLSWALNCYTYFGELSRMTQFKDKSARYAENIN 122

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           + GLF YPVLMAADILLY+   VPVGEDQ+QHLE++R IAQRFN  +             
Sbjct: 123 A-GLFDYPVLMAADILLYQTNQVPVGEDQKQHLELSRDIAQRFNAIY------------- 168

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F + E  I  S +R+ SL + +KKMSKSD +  + I LL++P  + KKI++A
Sbjct: 169 -----GDIFKVPEPFIPKSGARVMSLLEPTKKMSKSDDNRNNVIGLLEDPKSVVKKIKRA 223

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
            TD D  P     ++N+    NL++I A +    I E  + F GK +   K  +ADAV  
Sbjct: 224 VTDSDEPPVVRYDVQNKAGVSNLLDILAGVTGKSIPELEQHFEGKMYGHLKGDVADAVSG 283

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            +  + ++      D+++L  ++ EGA +AR RA ET+K V E +G 
Sbjct: 284 MLSELQERYNRYRNDEAFLQNVMKEGAAKARARASETLKAVYEAIGF 330


>gi|302558865|ref|ZP_07311207.1| tryptophanyl-tRNA synthetase [Streptomyces griseoflavus Tu4000]
 gi|302476483|gb|EFL39576.1| tryptophanyl-tRNA synthetase [Streptomyces griseoflavus Tu4000]
          Length = 337

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 142/347 (40%), Positives = 197/347 (56%), Gaps = 25/347 (7%)

Query: 9   VSGVQPT-GVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SG+QPT G  HLGNYLG +R  +  QET  H   Y + DLHAIT     + LR  +RL 
Sbjct: 9   LSGIQPTAGSFHLGNYLGAVRQWVALQET--HDAFYMVVDLHAITLPQDPDVLRANTRLA 66

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A  LAAG+DP R  +F QS V  HA L+W+++C+   G  + M QFK+KS +   + AS
Sbjct: 67  AAQLLAAGLDPDRCTLFVQSHVPEHAQLAWVMNCLTGFGEASRMTQFKDKSAKQGADRAS 126

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GLF YP+L  ADILLY+A  VPVGEDQRQH+E+TR +A RFN  F        + +   
Sbjct: 127 VGLFTYPILQVADILLYQADEVPVGEDQRQHIELTRDLADRFNGRF-------GETFTMP 179

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
           + Y           I    ++I  L+D S KMSKS S+    INLLD P   AKK++ A 
Sbjct: 180 KPY-----------ILKETAKIYDLQDPSIKMSKSASTPKGLINLLDEPRTTAKKVKSAV 228

Query: 248 TDGD-VLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
           TD D V+  +V     +    NL+ IF+T+    I E  +++ GK +   K  LA+ ++E
Sbjct: 229 TDTDTVIRYDVV---EKPGVSNLLTIFSTLTGTGIPELEERYAGKGYGALKTDLAEVMVE 285

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + P  ++ Q  L D   LD++L +GA +AR  A ET+    + VG 
Sbjct: 286 FVTPFKERTQQYLDDPETLDSVLAKGAEKARAVAAETLARAYDRVGF 332


>gi|291619215|ref|YP_003521957.1| TrpS [Pantoea ananatis LMG 20103]
 gi|291154245|gb|ADD78829.1| TrpS [Pantoea ananatis LMG 20103]
 gi|327395545|dbj|BAK12967.1| tryptophanyl-tRNA synthetase TrpS [Pantoea ananatis AJ13355]
          Length = 334

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 135/350 (38%), Positives = 199/350 (56%), Gaps = 21/350 (6%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  +  SG QP+G L +GNY+G +R  ++ Q+  + +  Y I DLHAIT       LR  
Sbjct: 2   SKPIVFSGAQPSGELTIGNYMGALRQWVQMQDDFHCI--YCIVDLHAITVRQDPAALRKA 59

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           +   +A +LA G+DP ++ IF QS V  H  LSWIL+C    G +N M QFK+KS    E
Sbjct: 60  TLDTLALYLACGIDPEKSTIFVQSHVPEHTQLSWILNCYTYFGELNRMTQFKDKSSRY-E 118

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
           E  + GLF YPVLMAADILLY+ T VPVGEDQ+QHLE++R IA RFN  +          
Sbjct: 119 ENINAGLFSYPVLMAADILLYQTTQVPVGEDQKQHLELSRDIASRFNALY---------- 168

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
                      F + E  I  S +R+ SL + +KKMSKSD +  + I LL++P  + KKI
Sbjct: 169 --------GDIFKVPEPFIPKSGARVMSLLEPTKKMSKSDDNRNNVIGLLEDPKSVVKKI 220

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           ++A TD +  P     ++ +    NL++I + +    +    ++F GK +   K A+ADA
Sbjct: 221 KRAMTDSEEPPVIRYDIKEKAGVSNLLDILSGVTGKPVTALEQEFEGKMYGHLKGAVADA 280

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           V   +  + ++      D++ L+ ++ +GA +AR +AQET+K V + VG 
Sbjct: 281 VSGMLTDLQERYHRFRNDEALLEQVMRDGAQKARAQAQETLKKVYDAVGF 330


>gi|313888127|ref|ZP_07821801.1| tryptophan--tRNA ligase [Peptoniphilus harei ACS-146-V-Sch2b]
 gi|312845817|gb|EFR33204.1| tryptophan--tRNA ligase [Peptoniphilus harei ACS-146-V-Sch2b]
          Length = 330

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 137/344 (39%), Positives = 205/344 (59%), Gaps = 25/344 (7%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QP+G L +GNY+G ++N I  Q+  N L  Y I D+HAIT     ++LR  +   +A
Sbjct: 9   SGIQPSGSLTIGNYIGALKNFIGLQDEYNCL--YCIVDMHAITVAQEPKDLRKNTLDVLA 66

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LAAG+DP ++II+ QS V  HA+L W+L+ +  +G +  M QFK+K+K+  +  A  G
Sbjct: 67  LYLAAGLDPKKSIIYIQSHVPAHAELGWVLNTMTGLGQLQRMTQFKDKAKKYTDVQA--G 124

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L  YPVLMAADILLY+++ VPVGEDQ+QH+EITR +AQRFN+ +                
Sbjct: 125 LLNYPVLMAADILLYQSSFVPVGEDQKQHIEITRDLAQRFNSRYSET------------- 171

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                F I E L     +RI SL+D S KMSKSD +    I LLD+ D   KKI++A TD
Sbjct: 172 -----FTIPEILTPKVGARIMSLKDPSSKMSKSDPNKDGYILLLDSEDDTRKKIKRAVTD 226

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
                 E    + +   KNLI I A+   +  EE +K++    + +FK  L + V+E + 
Sbjct: 227 SS---GEFRYSDEQAGLKNLINIHASFSGMSPEEIVKKYENLGYGEFKEDLGEVVVEGLR 283

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           P+ ++ + + +DK+YL+++  EGA +A   A +T++ V + VG 
Sbjct: 284 PLRERFKEIREDKAYLESVYKEGAEKASYLANKTLRKVYKKVGF 327


>gi|302524150|ref|ZP_07276492.1| tryptophanyl-tRNA synthetase [Streptomyces sp. AA4]
 gi|302433045|gb|EFL04861.1| tryptophanyl-tRNA synthetase [Streptomyces sp. AA4]
          Length = 339

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 141/352 (40%), Positives = 193/352 (54%), Gaps = 35/352 (9%)

Query: 9   VSGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SG+QPT    HLGNYLG +R  +R Q+T  H   Y + DLHAIT     + L  ++R  
Sbjct: 12  LSGIQPTADSFHLGNYLGALRQWVRLQDT--HETFYCVVDLHAITVEQDPKVLLERTRRS 69

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A  LA GVDP+R+ +F QS V  HA LSW+L C    G    M QFK+K+ +   + AS
Sbjct: 70  AAQLLAIGVDPARSALFVQSHVPEHAQLSWVLECQTGFGEAGRMTQFKDKAAKQGSDHAS 129

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GLF YPVLMAADILLY+   VPVGEDQRQHLE+TR +AQRFN+ F +            
Sbjct: 130 VGLFTYPVLMAADILLYQTNAVPVGEDQRQHLELTRNLAQRFNSRFGKT----------- 178

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F + E  I    ++I  L++ + KMSKS S+    I LL++P   AKKI+ A 
Sbjct: 179 -------FVMPEPFIVKDTAKIYDLQEPTAKMSKSASTGNGLIELLEDPKRSAKKIRSAV 231

Query: 248 TDGDVLPSEVSGLENRLE------AKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALA 301
           TD        +G E R +        NL+ I++ +    I +    + GK +   K  LA
Sbjct: 232 TD--------TGREVRFDREEKAGVSNLLTIYSALTDRTIADLETAYEGKGYGDLKKDLA 283

Query: 302 DAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + +++ + P+ + +Q  L D + LD IL  GA RAR  A  T+  V E VG 
Sbjct: 284 EVLVDWVTPLQESVQSYLDDVAELDRILAAGAQRAREVASATLASVYERVGF 335


>gi|317509130|ref|ZP_07966756.1| tryptophanyl-tRNA synthetase [Segniliparus rugosus ATCC BAA-974]
 gi|316252566|gb|EFV12010.1| tryptophanyl-tRNA synthetase [Segniliparus rugosus ATCC BAA-974]
          Length = 339

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 139/351 (39%), Positives = 200/351 (56%), Gaps = 32/351 (9%)

Query: 8   FVSGVQPTGV-LHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
            +SG+Q TG  +HLGNYLG I+  +  Q   ++  +YFI DLH+IT       LR  +  
Sbjct: 6   LISGIQATGSSVHLGNYLGAIKQWVELQH--DYEALYFIPDLHSITTPHDPAQLRESTLQ 63

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
           ++A  LA G+DP++  IF QS V  +A L+W+LSC+   G  + M QFK+KS +  E+T 
Sbjct: 64  YIAQLLALGLDPAQCTIFVQSHVPANAQLAWVLSCLTGFGEASRMTQFKDKSDKQGEQT- 122

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           S+GLF YP LMAADIL Y+A  VPVG+DQ QHLE+TR +A+RFN  F +           
Sbjct: 123 SVGLFTYPCLMAADILAYQAELVPVGDDQSQHLELTRNLAERFNHRFGQT---------- 172

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F + +  +  + +R+  LR+ +KKMSKS SSD   +N +D+P   AKK + A
Sbjct: 173 --------FVVPKARLVKAGARVYDLREPTKKMSKSASSDSGIVNFMDDPKTSAKKFRSA 224

Query: 247 KT--DGDVL--PSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALAD 302
            T  DG+V   P+   G+       NL+ IFA +     EE   ++ G  +   K+ LAD
Sbjct: 225 VTDMDGEVRFDPAAKPGV------SNLLAIFAALTGQTAEEVALKYQGGGYGALKVDLAD 278

Query: 303 AVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           A +E   P+ ++    L+++S LD I+ EG  RAR  A  T+  V E+VG 
Sbjct: 279 AFVEFAAPVRERTLGWLENRSELDRIISEGGERAREIASATVARVYEVVGF 329


>gi|307243492|ref|ZP_07525643.1| tryptophan--tRNA ligase [Peptostreptococcus stomatis DSM 17678]
 gi|306493136|gb|EFM65138.1| tryptophan--tRNA ligase [Peptostreptococcus stomatis DSM 17678]
          Length = 335

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 139/350 (39%), Positives = 205/350 (58%), Gaps = 30/350 (8%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           +  SGVQP+G + LGNYLG +++  + Q+   +   + + ++HAIT     E LR Q+  
Sbjct: 8   VIFSGVQPSGKMTLGNYLGALKSWTKLQD--EYECFFSMVNMHAITVPQDPEVLRRQTIE 65

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
            +A F+A G+DP  N IF QS V  HA+LSW L  +  MG +N M Q+K+KS+++ E+  
Sbjct: 66  LLAQFIACGIDPDLNTIFIQSHVHEHAELSWALCTLTYMGELNRMTQYKDKSRKS-EQNL 124

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           + GLF YPVLMAADILLY+   VPVG+DQ+QH+E+ R +A RFN  F             
Sbjct: 125 NAGLFTYPVLMAADILLYQTDLVPVGDDQKQHMELARDLATRFNNRFGDT---------- 174

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F + EG      +R+ SL++  KKMSKSD++  + I L ++ D  AKKI+KA
Sbjct: 175 --------FIVPEGYYPKETARVMSLQEPEKKMSKSDANPSAFILLAEDADSTAKKIKKA 226

Query: 247 KTD--GDV-LPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
            TD  G V    E  GL      KNLI I++ M    +EE +  + GK +  FK  +A+A
Sbjct: 227 VTDSIGIVKYNDEQPGL------KNLINIYSAMTDKSVEEIVAMYDGKGYGAFKGEMAEA 280

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           V+E + PI +K  +LL+++ YL+ I   GA +A  RA +T++ V + +G 
Sbjct: 281 VVEHLRPIREKYNYLLENRDYLEGIYTRGAEKASARAGKTLRDVYDRIGF 330


>gi|238898713|ref|YP_002924394.1| tryptophanyl-tRNA synthetase [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|229466472|gb|ACQ68246.1| tryptophanyl-tRNA synthetase [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 340

 Score =  237 bits (605), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 137/344 (39%), Positives = 196/344 (56%), Gaps = 21/344 (6%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG QP+G L +GNY+G +R  +  QE  ++  ++ I DLHAIT     E+LR  +   +A
Sbjct: 13  SGAQPSGSLTIGNYMGALRQWVNLQE--DYDCIFCIVDLHAITTRQNPESLRKSTLDTLA 70

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            + A G+D  ++ IF QS V  H  LSWIL+C    G +N M QFK+KS  + E   + G
Sbjct: 71  LYFACGIDAKKSTIFVQSHVPEHTQLSWILNCFTYFGELNRMTQFKDKSSRHSENMNA-G 129

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L  YPVLMAADILLY+   VPVGEDQ+QHLE+ R IA+RFN  +                
Sbjct: 130 LLNYPVLMAADILLYQTHQVPVGEDQKQHLELARDIAKRFNGIY---------------- 173

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                F I E  I  S +RI SL++ +KKMSKSD +  + I LL++P+ I KKI+KA TD
Sbjct: 174 --GDIFVIPEPFIAQSGARIMSLQEPNKKMSKSDENRNNVIELLEDPENIIKKIKKAMTD 231

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            D        ++N+    NL++I + +    + E  K F GK +   K  LA+A+   + 
Sbjct: 232 SDEPAQIYYDIKNKPGVSNLLDILSGVVNKNMSELEKNFSGKMYGHLKTELAEALTHMLN 291

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            I ++ QH   D+ YL  ++ +GA++AR R Q T+K V + +G 
Sbjct: 292 DIQKRYQHYRSDEPYLQQVMKQGADQARARGQLTIKKVYDALGF 335


>gi|322831004|ref|YP_004211031.1| tryptophanyl-tRNA synthetase [Rahnella sp. Y9602]
 gi|321166205|gb|ADW71904.1| tryptophanyl-tRNA synthetase [Rahnella sp. Y9602]
          Length = 338

 Score =  237 bits (605), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 133/353 (37%), Positives = 199/353 (56%), Gaps = 23/353 (6%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  +  SG QP+G L +GNY+G +R  ++ Q+  ++  +Y I DLHAIT     E LR  
Sbjct: 2   SKPIVFSGAQPSGELTIGNYMGALRQWVKMQD--DYECIYCIVDLHAITVRQDAEKLRKA 59

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKS---KE 120
           +   +A +LA G+DP ++ IF QS V  H+ LSW L+C    G +  M QFK+KS   + 
Sbjct: 60  TLDTLALYLAVGIDPKKSTIFVQSHVPEHSQLSWALNCYTYFGELGRMTQFKDKSARYET 119

Query: 121 NKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEV 180
           +  E+ + GLF YPVLMAADILLY+   VPVGEDQ+QHLE++R IA RFN  +       
Sbjct: 120 SNSESITAGLFDYPVLMAADILLYQTNQVPVGEDQKQHLELSRDIAARFNALY------- 172

Query: 181 AQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIA 240
                         F + E  I  S +R+ SL++ +KKMSKSD +  + I LL++P  + 
Sbjct: 173 -----------GDVFTVPEPFIPKSGARVMSLQEPTKKMSKSDDNRKNVIGLLEDPKAVT 221

Query: 241 KKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLAL 300
           KKI+ A TD +  P     ++N+    NL++I + +    I E   +F G+ +   K A+
Sbjct: 222 KKIKSAMTDSEEPPVIRYDIKNKPGVSNLLDILSGVTGKAIPELEAEFEGQMYGHLKGAV 281

Query: 301 ADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           A+AV   +  + ++      D++YL  ++ EGA +AR RA  T+K   E +G 
Sbjct: 282 AEAVSGMLTEVQERFNRFRSDEAYLQQVMKEGAEKARARASVTLKKAYEAIGF 334


>gi|318079465|ref|ZP_07986797.1| tryptophanyl-tRNA synthetase [Streptomyces sp. SA3_actF]
          Length = 315

 Score =  237 bits (605), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 129/338 (38%), Positives = 191/338 (56%), Gaps = 25/338 (7%)

Query: 8   FVSGVQPT-GVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
            +SG+QP+ G  HLGNYLG +R  +  QE+  H   Y + D+HAIT     + LR  +RL
Sbjct: 1   MLSGIQPSAGSFHLGNYLGAVRQWVALQES--HDAFYTVVDMHAITVPQDPDTLRANTRL 58

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A  LAAG+DP R+ +F QS V  HA+L+WI++C+   G  + M QFK+K+ +   E  
Sbjct: 59  SAAQLLAAGIDPERSALFVQSHVREHAELAWIMNCLTGFGEASRMTQFKDKAAKQGAEGT 118

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           ++GLF YPVL  ADILLY+A  VPVGEDQRQH+E+TR +A+RFN  +             
Sbjct: 119 TVGLFTYPVLQVADILLYQAHQVPVGEDQRQHVELTRDLAERFNARYGET---------- 168

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F + E  I    ++I  L++ S KMSKS +S    +NL+D P   A+KI+ A
Sbjct: 169 --------FVVPEAYILKETAKIYDLQEPSAKMSKSAASPKGLVNLMDEPKATARKIKSA 220

Query: 247 KTDGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVI 305
            TD +   +E+    EN+    NL+ I++ +  + ++   +++ GK +   K  LA+ V+
Sbjct: 221 VTDTE---TEIRFDRENKPGVSNLLGIYSNLTGVTVQALEEKYAGKGYGALKTDLAEVVV 277

Query: 306 EEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQET 343
           + + P   +    L D + LD IL  GA +AR  A  T
Sbjct: 278 DFVTPFRDRTLEYLDDPATLDKILASGAEKAREVAAPT 315


>gi|120600625|ref|YP_965199.1| tryptophanyl-tRNA synthetase [Shewanella sp. W3-18-1]
 gi|120560718|gb|ABM26645.1| tryptophanyl-tRNA synthetase [Shewanella sp. W3-18-1]
 gi|319428294|gb|ADV56368.1| tryptophanyl-tRNA synthetase [Shewanella putrefaciens 200]
          Length = 332

 Score =  237 bits (605), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 130/347 (37%), Positives = 201/347 (57%), Gaps = 21/347 (6%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           + +SG QP+G L +GNY+G +R  +  Q++  H  +Y + DLHAIT     + LR     
Sbjct: 5   IVLSGAQPSGELTIGNYMGALRQWVAMQDS--HDCLYCVVDLHAITVRQDPKALREACLD 62

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
            +A +LA GVDP ++ +F QS V  H  L W L+C  +MG ++ M QFK+KS+++     
Sbjct: 63  TLALYLACGVDPKKSTVFIQSQVPQHTQLGWALNCYTQMGELSRMTQFKDKSQKHANNI- 121

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           ++GLF YPVLMAADIL+Y+A  +PVG+DQ+QHLE+TR IA RFN  +             
Sbjct: 122 NVGLFGYPVLMAADILIYQANEIPVGQDQKQHLELTRDIATRFNNAYGDT---------- 171

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F I E  I    +++ SL++  KKMSKSD +  + I LL++P  + KK++KA
Sbjct: 172 --------FTIPEPFIPEHGAKVMSLQEPLKKMSKSDENRNNVIGLLEDPKSVLKKLKKA 223

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
            TD D  P     L+N+    NL+ + + +    I     +F GK +   K+A  +AV+ 
Sbjct: 224 MTDSDEPPVVRFDLDNKPGVSNLLSLMSGVTGQSIASLEAEFEGKMYGHLKVAAGEAVVG 283

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + P+ ++ + +  D++YLD ++  GA  A+ RA+ T+K V E +GL
Sbjct: 284 MLEPLQERYRAIRADRAYLDQVMKAGAENAQARAEVTLKKVYEKIGL 330


>gi|302553691|ref|ZP_07306033.1| tryptophanyl-tRNA synthetase [Streptomyces viridochromogenes DSM
           40736]
 gi|302471309|gb|EFL34402.1| tryptophanyl-tRNA synthetase [Streptomyces viridochromogenes DSM
           40736]
          Length = 337

 Score =  237 bits (605), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 142/358 (39%), Positives = 200/358 (55%), Gaps = 31/358 (8%)

Query: 1   MLSSDNLFVSGVQPT-GVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQEN 59
           M S     +SG+QPT G  HLGNYLG +R  +  QE+  H   Y + DLHAIT     ++
Sbjct: 1   MASDRPRVLSGIQPTAGSFHLGNYLGAVRQWVALQES--HDAFYMVVDLHAITIPQDPKD 58

Query: 60  LRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSK 119
           LR  +RL  A  LAAG+DP R  +F QS V  HA L+W+++C+   G  + M QFK+K+ 
Sbjct: 59  LRANTRLAAAQLLAAGLDPDRCTLFVQSHVPEHAQLAWVMNCLTGFGEASRMTQFKDKAA 118

Query: 120 ENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKE 179
           +   E AS+GLF YP+L  ADILLY+A  VPVGEDQRQH+E+TR +A+RFN  F      
Sbjct: 119 KQGAERASVGLFTYPILQVADILLYQANEVPVGEDQRQHVELTRDLAERFNGRFGPT--- 175

Query: 180 VAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDII 239
                          F + +  I    ++I  L+D S KMSKS S+    INLLD P   
Sbjct: 176 ---------------FTVPKPYILKETAKIYDLQDPSIKMSKSASTPKGLINLLDEPKTT 220

Query: 240 AKKIQKAKTDGDVL----PSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQ 295
           AKK++ A TD D +     +E  G+       NL+ I++T+    I E  +++ GK +  
Sbjct: 221 AKKVKSAVTDTDTVIRFDAAEKPGI------SNLLGIYSTLTGEGIAELEEKYAGKGYGA 274

Query: 296 FKLALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            K  LA+ +++ + P  ++ Q  L D   LD+IL +GA +AR  A ET+    + VG 
Sbjct: 275 LKTDLAEIMVDFVTPFRERTQQYLDDPETLDSILAKGAEKARAVAAETLSQAYDRVGF 332


>gi|168179019|ref|ZP_02613683.1| tryptophanyl-tRNA synthetase [Clostridium botulinum NCTC 2916]
 gi|226950757|ref|YP_002805848.1| tryptophanyl-tRNA synthetase [Clostridium botulinum A2 str. Kyoto]
 gi|182670209|gb|EDT82185.1| tryptophanyl-tRNA synthetase [Clostridium botulinum NCTC 2916]
 gi|226841345|gb|ACO84011.1| tryptophan--tRNA ligase [Clostridium botulinum A2 str. Kyoto]
          Length = 332

 Score =  237 bits (605), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 134/353 (37%), Positives = 207/353 (58%), Gaps = 24/353 (6%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENL 60
           M  +  +  SG+QP+G L LGNYLG ++N ++ Q+   +   Y + DLHAIT     ++L
Sbjct: 1   MEDNKKIIFSGIQPSGNLTLGNYLGALKNWVKLQD--EYDCYYCVVDLHAITVRQEPKDL 58

Query: 61  RYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKE 120
           R ++   +A ++A+G+DP +N IF QS V  H +  W+L+C   +G +  M Q+K+KS+ 
Sbjct: 59  RRRTLEVLAIYIASGIDPDKNTIFIQSHVPTHCEAGWLLNCNTYIGELFRMTQYKDKSQR 118

Query: 121 NKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEV 180
             E + S GL  YPVLMAADILLY    VPVG+DQ+QHLEITR +AQRFN  +       
Sbjct: 119 YGE-SVSAGLLTYPVLMAADILLYNTDLVPVGKDQKQHLEITRDLAQRFNNLYSPT---- 173

Query: 181 AQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIA 240
                         F I E  I  + ++I  L+D +KKMSKS  ++ S I ++D PD I 
Sbjct: 174 --------------FKIPEPYIPEAGAKIMDLQDPTKKMSKSSDNENSYILIMDPPDAIR 219

Query: 241 KKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLAL 300
           +KI +  TD   +   V   + +   KNL+ I +T+  + +EE  K++ GK ++QFK  +
Sbjct: 220 RKINRCVTDSLGI---VKYTDEQPGIKNLMTILSTITGMTMEEIEKKYEGKGYAQFKNDV 276

Query: 301 ADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           A+A+I E+ PI  K+  LL +K YL++I  EGA +A   + + ++ + + +G 
Sbjct: 277 AEAIISELEPIQNKVNELLTNKEYLESIYKEGAEKAYKVSYKMLRKMQKKIGF 329


>gi|78184513|ref|YP_376948.1| tryptophanyl-tRNA synthetase [Synechococcus sp. CC9902]
 gi|78168807|gb|ABB25904.1| tryptophanyl-tRNA synthetase [Synechococcus sp. CC9902]
          Length = 337

 Score =  237 bits (605), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 146/351 (41%), Positives = 196/351 (55%), Gaps = 28/351 (7%)

Query: 9   VSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           +SGVQPTG LHLGN+LG IRN +  QET  H     + DLHAIT       L   +R   
Sbjct: 7   LSGVQPTGALHLGNWLGAIRNWVELQET--HDTYVCVVDLHAITVPHDPSQLAADTRSTA 64

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+DP R  IF QS V  H++L W+L+CV  + W+  MIQFKEKS + + +  S+
Sbjct: 65  ALYLACGMDPKRCSIFIQSQVAAHSELCWLLNCVTPLNWLERMIQFKEKSVK-QGDNVSV 123

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIA-QRFNTEFERKIKEVAQKYAQE 187
           GL  YPVLMAADILLY A  VPVGEDQ+QHLE+ R IA QR N  F  K   V       
Sbjct: 124 GLLDYPVLMAADILLYDADLVPVGEDQKQHLELARDIAQQRINARFGSKENPVLN----- 178

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                    + + LI    +R+ SL D   KMSKSD ++ SRI LLD P++I KKI++AK
Sbjct: 179 ---------VPKPLILKEGARVMSLTDGRSKMSKSDPNEGSRITLLDPPELITKKIKRAK 229

Query: 248 TDGDVLPSEVSGLE----NRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           TD +       GLE    +R E  NL+ ++A +     +    Q     + QFK  LA+A
Sbjct: 230 TDPE------RGLEFGNPDRPETDNLLGLYAILSGQGRDSVAAQCADMGWGQFKPLLAEA 283

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
            +  + PI  + + L+     LD +L +G  +A   A  T+  V + +G +
Sbjct: 284 AVAALEPIQGRYKELIDHPEELDLVLEQGRQKAEAVANATLNRVRQALGFA 334


>gi|326381942|ref|ZP_08203635.1| tryptophanyl-tRNA synthetase [Gordonia neofelifaecis NRRL B-59395]
 gi|326199368|gb|EGD56549.1| tryptophanyl-tRNA synthetase [Gordonia neofelifaecis NRRL B-59395]
          Length = 339

 Score =  237 bits (605), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 140/346 (40%), Positives = 195/346 (56%), Gaps = 23/346 (6%)

Query: 9   VSGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SG+QPT    HLGNYLG +R  ++ Q+  +    YFI D+HAIT     + LR ++R  
Sbjct: 11  LSGIQPTSDSFHLGNYLGAVRQWVQLQDEFD--AFYFIPDMHAITVPQDPKVLRERTRRS 68

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
           VA  LA GVDP R  I+ QS V   A L+W+L+C+   G  + M QFK+KS ++  + A 
Sbjct: 69  VAQLLAVGVDPERATIYVQSHVPEIAQLTWVLTCLTGFGEASRMTQFKDKSAKSGTDAAG 128

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GLF YP+LMAADIL ++   VPVGEDQRQHLE+TR +AQRFN  + + +  V + Y  E
Sbjct: 129 VGLFTYPILMAADILAFQVDSVPVGEDQRQHLELTRDLAQRFNKRYGKALT-VPKPYIVE 187

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
           E                  ++I  L++ + KMSKS  SD   INLLD P   AKKI+ A 
Sbjct: 188 E-----------------FAKIYDLQNPTAKMSKSADSDAGLINLLDEPKRSAKKIRSAV 230

Query: 248 TDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
           TD D     V     +    NL+ I A +    ++E +  + GK +   K+  AD + E 
Sbjct: 231 TDNDR--EIVFDRTAKPGVSNLLTIQAALTGRAMDEIVASYQGKGYGDLKVETADILTEF 288

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + P+  ++  LL D ++LD IL +GA RAR  A  T+  V E VG 
Sbjct: 289 VTPLRGRVDELLADTAHLDAILADGAARAREIAATTVADVYEKVGF 334


>gi|168182044|ref|ZP_02616708.1| tryptophan--tRNA ligase [Clostridium botulinum Bf]
 gi|237796771|ref|YP_002864323.1| tryptophanyl-tRNA synthetase [Clostridium botulinum Ba4 str. 657]
 gi|182674858|gb|EDT86819.1| tryptophan--tRNA ligase [Clostridium botulinum Bf]
 gi|229263587|gb|ACQ54620.1| tryptophan--tRNA ligase [Clostridium botulinum Ba4 str. 657]
          Length = 332

 Score =  237 bits (605), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 134/353 (37%), Positives = 207/353 (58%), Gaps = 24/353 (6%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENL 60
           M  +  +  SG+QP+G L LGNYLG ++N ++ Q+   +   Y + DLHAIT     ++L
Sbjct: 1   MEDNKKIIFSGIQPSGNLTLGNYLGALKNWVKLQD--EYDCYYCVVDLHAITVRQEPKDL 58

Query: 61  RYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKE 120
           R ++   +A ++A+G+DP +N IF QS V  H +  W+L+C   +G +  M Q+K+KS+ 
Sbjct: 59  RRRTLEVLAIYIASGIDPDKNTIFIQSHVPTHCEAGWLLNCNTYIGELFRMTQYKDKSQR 118

Query: 121 NKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEV 180
             E + S GL  YPVLMAADILLY    VPVG+DQ+QHLEITR +AQRFN  +       
Sbjct: 119 YGE-SVSAGLLTYPVLMAADILLYNTDLVPVGKDQKQHLEITRDLAQRFNNLYSPT---- 173

Query: 181 AQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIA 240
                         F I E  I  + ++I  L+D +KKMSKS  ++ S I ++D PD I 
Sbjct: 174 --------------FKIPEPYIPEAGAKIMDLQDPTKKMSKSSDNENSYILIMDPPDAIR 219

Query: 241 KKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLAL 300
           +KI +  TD   +   V   + +   KNL+ I +T+  + +EE  K++ GK ++QFK  +
Sbjct: 220 RKISRCVTDSLGI---VKYTDEQPGIKNLMTILSTITGMTMEEIEKKYEGKGYAQFKNDV 276

Query: 301 ADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           A+A+I E+ PI  K+  LL +K YL++I  EGA +A   + + ++ + + +G 
Sbjct: 277 AEAIISELEPIQNKVNELLTNKEYLESIYKEGAEKAYKVSYKMLRKMQKKIGF 329


>gi|283787981|ref|YP_003367846.1| tryptophanyl-tRNA synthetase [Citrobacter rodentium ICC168]
 gi|282951435|emb|CBG91134.1| tryptophanyl-tRNA synthetase [Citrobacter rodentium ICC168]
          Length = 334

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 134/347 (38%), Positives = 195/347 (56%), Gaps = 21/347 (6%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           +  SG QP+G L +GNY+G +R  +  Q+  ++  +Y I D HAIT     + LR  +  
Sbjct: 5   IVFSGAQPSGELTIGNYMGALRQWVNMQD--DYHCIYCIVDQHAITVRQDAQQLRKATLD 62

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
            +A +LA G+DP ++ IF QS V  HA LSW L+C    G ++ M QFK+KS    E   
Sbjct: 63  TLALYLACGIDPEKSTIFVQSHVPEHAQLSWALNCYTYFGELSRMTQFKDKSARYAENIN 122

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           + GLF YPVLMAADILLY+   VPVGEDQ+QHLE++R IAQRFN  +             
Sbjct: 123 A-GLFDYPVLMAADILLYQTNQVPVGEDQKQHLELSRDIAQRFNALYGE----------- 170

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F + E  I  S +R+ SL + +KKMSKSD +  + I LL++P  + KKI++A
Sbjct: 171 -------IFKVPEPFIPKSGARVMSLLEPTKKMSKSDDNRNNVIGLLEDPKSVVKKIKRA 223

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
            TD D  P     ++N+    NL++I + +    I E  K F GK +   K  +A+AV  
Sbjct: 224 VTDSDEPPVVRYDIQNKAGVSNLLDILSAVTGQSIPELEKHFEGKMYGHLKGEVAEAVSG 283

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            +  + ++      D+++L  ++ EGA +A  RA ET+K V E +G 
Sbjct: 284 MLTGLQERYHRFRNDEAFLQKVMKEGAEKASARASETLKAVYEAIGF 330


>gi|225020581|ref|ZP_03709773.1| hypothetical protein CORMATOL_00588 [Corynebacterium matruchotii
           ATCC 33806]
 gi|224946527|gb|EEG27736.1| hypothetical protein CORMATOL_00588 [Corynebacterium matruchotii
           ATCC 33806]
          Length = 346

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 131/347 (37%), Positives = 197/347 (56%), Gaps = 25/347 (7%)

Query: 9   VSGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SG+QPT    HLGNYLG ++  I  Q+T  +   YFI DLHAIT +   + LR ++   
Sbjct: 17  LSGIQPTSDSYHLGNYLGALKQWIDLQDT--YEAFYFIPDLHAITVDQDPKELRARTISG 74

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A  LA G+DP +  +F QS V  HA L+W+ +C+   G  + M QFK+KS +   +  S
Sbjct: 75  AAQLLALGIDPDKAALFVQSHVPEHAQLAWVFTCLTGFGEASRMTQFKDKSTKQGADRTS 134

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
            GL+ YP+LMAADILLYR   VPVGEDQRQHLE+TR +A+RFN+ ++             
Sbjct: 135 AGLYAYPMLMAADILLYRPEIVPVGEDQRQHLELTRTLAERFNSRYQET----------- 183

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  FP+ E  I + +++I  L+D + KMSKS S+    INLLD+P I  K+I+ A 
Sbjct: 184 -------FPVPEPFIPTGSAKIYDLQDPTAKMSKSTSNPKGLINLLDDPKISTKRIKSAV 236

Query: 248 TDGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
           TD D    E+    E +    NL+ I + +    +++ + ++ G+ +   KL  A A+  
Sbjct: 237 TDND---GEIRFDKETKPGVSNLLVIQSALTGTTVDDLVTRYAGQGYGALKLDTAAALEA 293

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            +VP+ ++    + D++ L  +L  GA RAR  A +T+  V + +G 
Sbjct: 294 FVVPLKERFDMYMSDQAELKNVLARGAERAREVATQTLADVYDRIGF 340


>gi|91227441|ref|ZP_01261805.1| tryptophanyl-tRNA synthetase [Vibrio alginolyticus 12G01]
 gi|269964499|ref|ZP_06178740.1| Tryptophanyl-tRNA synthetase [Vibrio alginolyticus 40B]
 gi|91188591|gb|EAS74882.1| tryptophanyl-tRNA synthetase [Vibrio alginolyticus 12G01]
 gi|269830837|gb|EEZ85055.1| Tryptophanyl-tRNA synthetase [Vibrio alginolyticus 40B]
          Length = 338

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 136/351 (38%), Positives = 202/351 (57%), Gaps = 19/351 (5%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  + +SGVQP+G L +GNYLG +R   + Q+  ++   Y + DLHAIT     + L   
Sbjct: 2   SKPIVLSGVQPSGELSIGNYLGALRQWQQMQD--DYDCQYCVVDLHAITVRQDPKALHEA 59

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           +   +A  LA GVDP ++ +F QS V  HA L W+L+C  +MG ++ M QFK+KS     
Sbjct: 60  TLDALAICLAVGVDPKKSTLFVQSHVPEHAQLGWLLNCYTQMGELSRMTQFKDKSARYAN 119

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
           +  ++GLF YPVLMAADILLY A  VPVG DQ+QHLE+ R IA RFN  +  +       
Sbjct: 120 DV-NVGLFDYPVLMAADILLYGAHQVPVGSDQKQHLELARDIATRFNNIYSPE------- 171

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
                   +  F + E  I +  +R+ SL+DA+KKMSKSD +  + I LL+ P  I KKI
Sbjct: 172 --------QPIFQVPEPYIPTVNARVMSLQDATKKMSKSDDNRKNVITLLEEPKSILKKI 223

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGG-KNFSQFKLALAD 302
            KA+TD +  PS    +EN+    NL+ +++    +  EE   ++ G + +  FK  + +
Sbjct: 224 NKAQTDTETPPSIRHDIENKAGIANLMGLYSAATGMSFEEIEAKYQGVEMYGPFKKDVGE 283

Query: 303 AVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           AV+  + PI  +   +  D++Y+D ++ +GA +A  RA ET+K   E VG 
Sbjct: 284 AVVAMLEPIQAEYHRIRADRAYMDEVMQQGAEKASARAAETLKKAYEAVGF 334


>gi|251793623|ref|YP_003008353.1| tryptophanyl-tRNA synthetase [Aggregatibacter aphrophilus NJ8700]
 gi|247535020|gb|ACS98266.1| tryptophanyl-tRNA synthetase [Aggregatibacter aphrophilus NJ8700]
          Length = 334

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 137/344 (39%), Positives = 196/344 (56%), Gaps = 21/344 (6%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQP+G L +GNYLG +R  ++ Q+  ++  ++ I D HAIT       LR  +   +A
Sbjct: 8   SGVQPSGELTIGNYLGALRQWVKMQD--DYECLFCIVDQHAITVRQDPAALRKATLDVLA 65

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            +LA G+DP+++ IF QS V  HA L+WIL+C    G M  M QFK+KS    E   ++G
Sbjct: 66  LYLACGIDPAKSTIFIQSHVPEHAQLAWILNCYTYFGEMGRMTQFKDKSTRYAENI-NVG 124

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YPVLMA+DILLY+A  VPVGEDQ+QHLEITR IAQRFN  +                
Sbjct: 125 LFTYPVLMASDILLYQANQVPVGEDQKQHLEITRDIAQRFNALY---------------- 168

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                F + E  I  + +R+ SL +  KKMSKSD +  + I LL++P  +AKKI++A TD
Sbjct: 169 --GPHFAVPEVFIPKAGARVMSLLEPEKKMSKSDENRNNVIGLLEDPKAVAKKIKRAVTD 226

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            D  P     ++N+    NL++I + +    I E   +F GK +   K A+AD V   + 
Sbjct: 227 SDEPPVIRYDVKNKAGVSNLLDILSGVSGKTIAELELEFEGKMYGHLKGAVADEVSAMLT 286

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + ++  H   ++  L  I  EGA +A+ RAQ T+  V + +G 
Sbjct: 287 TLQERYYHFRNNEELLLQIAKEGAEKAKARAQATLAKVYDAIGF 330


>gi|145294850|ref|YP_001137671.1| tryptophanyl-tRNA synthetase [Corynebacterium glutamicum R]
 gi|140844770|dbj|BAF53769.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 345

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 136/346 (39%), Positives = 191/346 (55%), Gaps = 23/346 (6%)

Query: 9   VSGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SG+QPT    HLGNYLG ++  I  Q++ +    YFI DLHAIT +   E LR ++   
Sbjct: 17  LSGIQPTADSYHLGNYLGAVKQWIDLQDSYD--AFYFIPDLHAITVDQEPEELRNRTISG 74

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A  LA G+DP R+ +F QS V  HA+LSW+L+C+   G  + M QFK+KS +   +  S
Sbjct: 75  AAQLLALGIDPERSTLFVQSHVPAHAELSWVLTCLTGFGEASRMTQFKDKSSKRGADRTS 134

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
            GLF YP+LMAADILLYR   VPVGEDQRQHLE+TR +A+RFN  F +            
Sbjct: 135 AGLFTYPMLMAADILLYRPHLVPVGEDQRQHLELTRTLAERFNNRFGKA----------- 183

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F + EG I   AS+I  L++ + KMSKS  +    INLLD+P +  K+I+ A 
Sbjct: 184 -------FEVPEGFIPQGASKIYDLQNPTAKMSKSGDNPKGIINLLDDPKVSTKRIKSAV 236

Query: 248 TDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
           TD D + +     EN+    NL+ I + +    I+  +  + G  +   K   ADA+   
Sbjct: 237 TDNDGVIAYDP--ENKPGVSNLLVIQSALTGTSIDSLVDGYQGAGYGALKGDTADALEAF 294

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
             P+  K    + D+  L+ +L  GA RA   A ET+  V + +G 
Sbjct: 295 TTPLKAKYDEYMNDRGELERVLAIGAERATEVANETLADVYDKIGF 340


>gi|320008983|gb|ADW03833.1| tryptophanyl-tRNA synthetase [Streptomyces flavogriseus ATCC 33331]
          Length = 337

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 139/354 (39%), Positives = 198/354 (55%), Gaps = 23/354 (6%)

Query: 1   MLSSDNLFVSGVQPT-GVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQEN 59
           M S     +SG+QPT G  HLGNYLG +R  +  QE+  H   Y + DLHAIT     + 
Sbjct: 1   MASDRPRVLSGIQPTAGSFHLGNYLGAVRQWVALQES--HDAFYMVVDLHAITVPQDPKE 58

Query: 60  LRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSK 119
           LR  +RL  A  LAAG+DP R  +F QS V  HA L WI++C+   G  + M QFK+KS 
Sbjct: 59  LRANTRLAAAQLLAAGLDPERCTLFVQSHVPEHAQLGWIMNCLTGFGEASRMTQFKDKSA 118

Query: 120 ENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKE 179
           +   + A++GLF YPVL  ADILLY+A  VPVGEDQRQH+E+TR +A+RFN+ F      
Sbjct: 119 KQGADRATVGLFTYPVLQVADILLYQANQVPVGEDQRQHIELTRDLAERFNSRFGPT--- 175

Query: 180 VAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDII 239
                          F +    I    ++I  L+D + KMSKS S+    INLLD+P + 
Sbjct: 176 ---------------FTVPAPYILKETAKIFDLQDPAIKMSKSASTPKGLINLLDDPKVT 220

Query: 240 AKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLA 299
           AKK++ A TD D +    +  E +    NL+ I++T+    + +  +++ GK +   K  
Sbjct: 221 AKKVRSAVTDTDTVIRYDA--EKKPGVSNLLSIYSTLTGTAVPDLEQKYEGKGYGALKTD 278

Query: 300 LADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           LA+ ++E + P   + Q  L D   LD +L +GA +AR  A ET+    + +GL
Sbjct: 279 LAEVMVEFVTPFRTRTQEYLDDPETLDALLAKGAEKARTVAAETLAQTYDRMGL 332


>gi|19551907|ref|NP_599909.1| tryptophanyl-tRNA synthetase [Corynebacterium glutamicum ATCC
           13032]
 gi|62389566|ref|YP_224968.1| tryptophanyl-tRNA synthetase [Corynebacterium glutamicum ATCC
           13032]
 gi|25009421|sp|Q8NSJ4|SYW_CORGL RecName: Full=Tryptophanyl-tRNA synthetase; AltName:
           Full=Tryptophan--tRNA ligase; Short=TrpRS
 gi|21323443|dbj|BAB98070.1| Tryptophanyl-tRNA synthetase [Corynebacterium glutamicum ATCC
           13032]
 gi|41324900|emb|CAF19382.1| TRYPTOPHAN TRNA SYNTHETASE [Corynebacterium glutamicum ATCC 13032]
          Length = 345

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 136/346 (39%), Positives = 191/346 (55%), Gaps = 23/346 (6%)

Query: 9   VSGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SG+QPT    HLGNYLG ++  I  Q++ +    YFI DLHAIT +   E LR ++   
Sbjct: 17  LSGIQPTADSYHLGNYLGAVKQWIDLQDSYD--AFYFIPDLHAITVDQEPEELRNRTISG 74

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A  LA G+DP R+ +F QS V  HA+LSW+L+C+   G  + M QFK+KS +   +  S
Sbjct: 75  AAQLLALGIDPERSTLFVQSHVPAHAELSWVLTCLTGFGEASRMTQFKDKSSKRGADRTS 134

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
            GLF YP+LMAADILLYR   VPVGEDQRQHLE+TR +A+RFN  F +            
Sbjct: 135 AGLFTYPMLMAADILLYRPHLVPVGEDQRQHLELTRTLAERFNNRFGKA----------- 183

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F + EG I   AS+I  L++ + KMSKS  +    INLLD+P +  K+I+ A 
Sbjct: 184 -------FEVPEGFIPQGASKIYDLQNPTAKMSKSGDNPKGIINLLDDPKVSTKRIKSAV 236

Query: 248 TDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
           TD D + +     EN+    NL+ I + +    I+  +  + G  +   K   ADA+   
Sbjct: 237 TDNDGVIAYDP--ENKPGVSNLLVIQSALTGTSIDSLVDGYQGAGYGALKGDTADALEAF 294

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
             P+  K    + D+  L+ +L  GA RA   A ET+  V + +G 
Sbjct: 295 TTPLKAKYDEYMNDRGELERVLAIGAERATEVANETLADVYDKIGF 340


>gi|308188400|ref|YP_003932531.1| Tryptophanyl-tRNA synthetase [Pantoea vagans C9-1]
 gi|308058910|gb|ADO11082.1| Tryptophanyl-tRNA synthetase [Pantoea vagans C9-1]
          Length = 333

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 136/347 (39%), Positives = 199/347 (57%), Gaps = 21/347 (6%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           +  SG QP+G L +GNY+G +R  ++ Q+  + +  Y I DLHAIT       LR  +  
Sbjct: 4   IVFSGAQPSGELTIGNYMGALRQWVQMQDDFHCI--YCIVDLHAITVRQDPAALRKATLD 61

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
            +A +LA G+DP ++ IF QS V  H  LSWIL+C A  G ++ M QFK+KS    EE  
Sbjct: 62  TLALYLACGIDPQKSTIFVQSHVPEHTQLSWILNCYAYFGELSRMTQFKDKSA-RYEENI 120

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           + GLF YPVLMAADILLY+   VPVGEDQ+QHLE++R IA RFN  +             
Sbjct: 121 NAGLFDYPVLMAADILLYQTNQVPVGEDQKQHLELSRDIAHRFNAIY------------- 167

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F + E  I  S +R+ SL + +KKMSKSD +  + I LL++P  + KKI++A
Sbjct: 168 -----GDIFRVPEPFIPKSGARVMSLLEPTKKMSKSDDNRNNVIGLLEDPKAVVKKIKRA 222

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
            TD +  P     ++ +    NL++I + +    I E  ++F GK +   K A+ADAV  
Sbjct: 223 VTDSEEPPVVRYDIKEKAGVSNLLDILSGVTGKTIAELEQEFEGKMYGHLKGAVADAVSG 282

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            +  + ++      D++ L+ ++ +GA +AR +AQET+K V E VG 
Sbjct: 283 MLSELQERYHSFRNDEALLEQVMRDGAAKARAQAQETLKKVYEAVGF 329


>gi|271502305|ref|YP_003335331.1| tryptophanyl-tRNA synthetase [Dickeya dadantii Ech586]
 gi|270345860|gb|ACZ78625.1| tryptophanyl-tRNA synthetase [Dickeya dadantii Ech586]
          Length = 334

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 136/350 (38%), Positives = 200/350 (57%), Gaps = 21/350 (6%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  +  SG QP+G L +GNY+G +R  +  Q+  + +  Y I D HAIT     + LR  
Sbjct: 2   SKPIVFSGAQPSGELTIGNYMGALRQWVNMQDDFDCI--YCIVDQHAITVRQDPQQLRKA 59

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           +   +A +LA G+DP ++ IF QS V  HA L W+L+C    G ++ M QFK+KS    E
Sbjct: 60  TLDTLALYLACGIDPQKSTIFVQSHVPEHAQLGWLLNCYTYFGELSRMTQFKDKSAR-YE 118

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
           E  + GLF YPVLMAADILLY+   VPVGEDQ+QHLE++R IAQRFN  +     EV   
Sbjct: 119 ENINAGLFDYPVLMAADILLYQTNQVPVGEDQKQHLELSRDIAQRFNAIY----GEV--- 171

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
                      F + E  I  S +R+ SL + +KKMSKSD +  + I LL++P  + KKI
Sbjct: 172 -----------FRVPEPFIPKSGARVMSLLEPTKKMSKSDDNRNNVIGLLEDPKSVVKKI 220

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           ++A TD D  P     L+N+    NL++I + +    I +  K+F G+ +   K A+ADA
Sbjct: 221 KRAVTDSDEPPVVRYDLQNKAGVSNLLDILSGVTGKAIPDLEKEFEGQMYGHLKGAVADA 280

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           V   +  +  +      D+++L  ++ +GA +A  RAQET++   ++VG 
Sbjct: 281 VSGMLSELQARYHRFRDDEAFLQQVMRDGAQKASARAQETLRKAYDVVGF 330


>gi|294055459|ref|YP_003549117.1| tryptophanyl-tRNA synthetase [Coraliomargarita akajimensis DSM
           45221]
 gi|293614792|gb|ADE54947.1| tryptophanyl-tRNA synthetase [Coraliomargarita akajimensis DSM
           45221]
          Length = 354

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 139/366 (37%), Positives = 193/366 (52%), Gaps = 42/366 (11%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           + ++  QPTGVL +GNYLG I+N     +  +H   + + DLHAIT       LR  +  
Sbjct: 7   VILTCAQPTGVLTMGNYLGAIKNWATMLD--DHNCYFGVVDLHAITVKYTPAELRKNTLS 64

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEK--------- 117
            VA ++A G+DP R  IF QS V  H +L+W+LSC+  +G +  M QFKEK         
Sbjct: 65  CVAQYIACGLDPERANIFIQSHVIGHTELAWLLSCITPIGDLQRMTQFKEKAAKLGFKSS 124

Query: 118 --------SKENKEETASL--GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQ 167
                   S E   + AS+  GL MYPVLMAADILLY A  VPVG DQRQHLE+ R +AQ
Sbjct: 125 DEGNELKFSHEGARQGASVNSGLLMYPVLMAADILLYNADAVPVGNDQRQHLELCRDLAQ 184

Query: 168 RFNTEFERKIKEVAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDF 227
           RFN  +                     F I E  I  + +RI SL+D ++KMSKSD +  
Sbjct: 185 RFNHNYSET------------------FKIPEPFIPKAGARIMSLQDPTRKMSKSDENQN 226

Query: 228 SRINLLDNPDIIAKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQ 287
           S + +LD PD++ KKI  A TD     SE+   E++    NL++I + +    +E     
Sbjct: 227 STLYILDKPDVLKKKIMSAVTDSG---SEIKAAEDKPGVSNLLQIHSAISGTSVESLEAS 283

Query: 288 FGGKNFSQFKLALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYV 347
           F GK +   K  +AD VI  + P+  +   L+ DK YL+++L  GA  A+ RA + +  V
Sbjct: 284 FVGKGYGDLKKEVADVVISALEPVQSRYDELIGDKKYLESVLKAGAGEAQKRAYKVLAKV 343

Query: 348 NEIVGL 353
               G 
Sbjct: 344 YRKAGF 349


>gi|261341883|ref|ZP_05969741.1| tryptophan--tRNA ligase [Enterobacter cancerogenus ATCC 35316]
 gi|288315784|gb|EFC54722.1| tryptophan--tRNA ligase [Enterobacter cancerogenus ATCC 35316]
          Length = 334

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 133/347 (38%), Positives = 195/347 (56%), Gaps = 21/347 (6%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           +  SG QP+G L +GNY+G +R  +  Q+  ++  +Y I DLHAIT     E LR  +  
Sbjct: 5   IVFSGAQPSGELTIGNYMGALRQWVSMQD--DYHCIYCIVDLHAITARQDPEKLRKATLD 62

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
            +A +LA G+DP ++ IF QS V  HA L W L+C    G ++ M QFK+KS    E   
Sbjct: 63  TLALYLACGIDPEKSTIFVQSHVPEHAQLGWALNCYTYFGELSRMTQFKDKSARYSENIN 122

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           + GLF YPVLMAADILLY+   VPVGEDQ+QHLE++R IAQRFN  +             
Sbjct: 123 A-GLFDYPVLMAADILLYQTNQVPVGEDQKQHLELSRDIAQRFNALY------------- 168

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F + E  I  S +R+ SL + +KKMSKSD +  + I LL++P  + KK+++A
Sbjct: 169 -----GDVFKVPEPFIPKSGARVMSLLEPTKKMSKSDDNRNNVIGLLEDPKSVVKKLKRA 223

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
            TD D  P     ++N+    NL++I + +    I E  K F GK +   K  +ADAV  
Sbjct: 224 VTDSDEPPVVRYDVQNKAGVSNLLDILSGVTGQSIPELEKHFEGKMYGHLKGEVADAVSG 283

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            +  + ++      D+++L  ++ +GA +A  RA ET+K V + +G 
Sbjct: 284 MLTELQERYNRYRNDEAFLQKVMKDGAEKASARASETLKAVYQAIGF 330


>gi|293391451|ref|ZP_06635785.1| tryptophanyl-tRNA synthetase [Aggregatibacter actinomycetemcomitans
           D7S-1]
 gi|290951985|gb|EFE02104.1| tryptophanyl-tRNA synthetase [Aggregatibacter actinomycetemcomitans
           D7S-1]
          Length = 334

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 137/350 (39%), Positives = 198/350 (56%), Gaps = 21/350 (6%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  +  SGVQP+G L +GNYLG +R  ++ Q+  ++  ++ I D HAIT       LR  
Sbjct: 2   SKPIVFSGVQPSGELTIGNYLGALRQWVKMQD--DYECLFCIVDQHAITVRQDPAALRKA 59

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           +   +A +LA G+D +++ IF QS V  H  L+W+L+C    G M+ M QFK+KS    E
Sbjct: 60  TLDVLALYLACGIDSAKSTIFIQSHVPEHVQLAWVLNCYTYFGEMSRMTQFKDKSTRYAE 119

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
              ++GLF YPVLMAADILLY+A  VPVGEDQ+QHLEITR IAQRFN  +          
Sbjct: 120 NV-NVGLFTYPVLMAADILLYQANQVPVGEDQKQHLEITRDIAQRFNALY---------- 168

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
                      F + E  I  + +R+ SL +  KKMSKSD +  + I LL++P  +AKKI
Sbjct: 169 --------GPHFAVPEVFIPKAGARVMSLLEPEKKMSKSDENRNNVIGLLEDPKAVAKKI 220

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           ++A TD D  P     ++N+    NL++I + +    I E  ++F GK +   K A+A+ 
Sbjct: 221 RRAVTDSDEPPVIRYDVKNKAGVSNLLDILSGVSGKTIAELEQEFEGKMYGHLKGAVAEE 280

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           V   +  + ++  H   ++  L  I  EGA +A+ RAQ T+  V E VG 
Sbjct: 281 VSAMLTTLQERYHHFRNNEVLLHQIAKEGAEKAKARAQATLAKVYEAVGF 330


>gi|296395159|ref|YP_003660043.1| tryptophanyl-tRNA synthetase [Segniliparus rotundus DSM 44985]
 gi|296182306|gb|ADG99212.1| tryptophanyl-tRNA synthetase [Segniliparus rotundus DSM 44985]
          Length = 339

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 137/351 (39%), Positives = 196/351 (55%), Gaps = 32/351 (9%)

Query: 8   FVSGVQPTGV-LHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
            +SG+Q TG  +HLGNYLG I+  ++ Q+  ++  +YFI D H+IT  I    LR  +  
Sbjct: 6   LISGIQATGSSIHLGNYLGAIKQWVQLQQ--DYEALYFIPDQHSITTPIDPAQLRENTLR 63

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
           +VA  LA G+DP +  IF QS V  +A L+W+LSC+   G  + M QFK+KS +  E+T 
Sbjct: 64  YVAQLLALGLDPEQCTIFVQSHVPANAQLAWVLSCLTGFGEASRMTQFKDKSDKQGEQT- 122

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           S+GLF YP LMAADIL Y+A  VPVGEDQ QHLE+TR +A+RFN  F             
Sbjct: 123 SVGLFTYPCLMAADILAYQAELVPVGEDQSQHLELTRNLAERFNHRFGET---------- 172

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F + +  +  + +R+  LR+ +KKMSKS SS+   + L+D P + AKK + A
Sbjct: 173 --------FVVPKARLVKAGARVYDLREPTKKMSKSASSESGIVQLMDEPKVSAKKFRSA 224

Query: 247 KTDGD----VLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALAD 302
            TD D      P++  GL       NL+ IFA +     EE  +++ G  +   K  LAD
Sbjct: 225 VTDNDGEVRFDPAQKPGL------SNLLAIFAALTGATAEEVARKYQGGGYGALKTDLAD 278

Query: 303 AVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           A +E   P+ ++    L +++ L  I+ EG  RAR  A  T+  V + VG 
Sbjct: 279 AFVEFAAPVRERTLGWLDNRAALHRIVAEGGERAREIAGATLARVYDAVGF 329


>gi|313884952|ref|ZP_07818704.1| tryptophan--tRNA ligase [Eremococcus coleocola ACS-139-V-Col8]
 gi|312619643|gb|EFR31080.1| tryptophan--tRNA ligase [Eremococcus coleocola ACS-139-V-Col8]
          Length = 327

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 135/351 (38%), Positives = 194/351 (55%), Gaps = 26/351 (7%)

Query: 5   DNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQS 64
           +N+F SGVQP+G+  +GNY+G +++ +  Q+  N    Y + + HAIT     E LR  +
Sbjct: 3   ENIF-SGVQPSGIPTIGNYIGAMKSFVDLQDQYN--ATYCVVNQHAITVPQDPEKLRKMT 59

Query: 65  RLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEE 124
           R   A ++A GVDP ++ IF QSDV  HA L+WI+ C+  +G +  M QFK+KS +N  E
Sbjct: 60  RQLAALYIALGVDPKKSTIFVQSDVPAHAQLAWIIQCLTGLGELERMTQFKDKSAKN--E 117

Query: 125 TASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKY 184
           T + GL  YP LM  DI+LY+A +VPVGEDQ+QH+E+TR    RFN+ F           
Sbjct: 118 TVNAGLLTYPTLMVGDIVLYKAKYVPVGEDQKQHMELTRNFVDRFNSRF----------- 166

Query: 185 AQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQ 244
                   G     + +      RI SL+D + KMSKSDS+    I+L+D P  + KKI+
Sbjct: 167 -------GGILVKPDIITPKEGGRIMSLQDPTSKMSKSDSNPKGFISLMDEPKTVVKKIK 219

Query: 245 KAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
            A TD   L       EN+    NL+ I++ +    I++ + Q+ GK + QFK  LAD V
Sbjct: 220 SAMTDS--LGQVNYDKENQAAISNLLVIYSNLSGQSIDQLVAQYDGKGYGQFKTDLADLV 277

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLSH 355
              + PI  K+  L+      D IL EGA +A   A ET+  +   VGL +
Sbjct: 278 ASFLEPIQSKVNQLMSSSDLTD-ILSEGAKKASQTANETLAEIEAAVGLRY 327


>gi|297192557|ref|ZP_06909955.1| tryptophanyl-tRNA synthetase 1 [Streptomyces pristinaespiralis ATCC
           25486]
 gi|197718098|gb|EDY62006.1| tryptophanyl-tRNA synthetase 1 [Streptomyces pristinaespiralis ATCC
           25486]
          Length = 337

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 141/354 (39%), Positives = 195/354 (55%), Gaps = 23/354 (6%)

Query: 1   MLSSDNLFVSGVQPT-GVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQEN 59
           M SS    +SG+QPT G  HLGNYLG IR  +  QET  H   Y + DLHAIT       
Sbjct: 1   MASSRPRALSGIQPTAGSFHLGNYLGAIRQYVALQET--HDAFYMVVDLHAITVPQDPAE 58

Query: 60  LRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSK 119
           LR  +RL  A  LAAG+DP R  +F QS V  HA L W+++C+   G  + M QFK+KS 
Sbjct: 59  LRANTRLAAAQLLAAGLDPERCTLFVQSHVPEHAQLGWVMNCLTGFGEASRMTQFKDKSA 118

Query: 120 ENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKE 179
            +  + A++GLF YP+L  ADILLY+A  VPVGEDQRQH+E+TR +A+RFN  F R    
Sbjct: 119 RHGADRATVGLFTYPILQVADILLYQADAVPVGEDQRQHVELTRDLAERFNGRFGRT--- 175

Query: 180 VAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDII 239
                          F +    I    ++I  L+D + KMSKS S+    INLLD P   
Sbjct: 176 ---------------FTVPAPYIVKEVAKIYDLQDPTIKMSKSASTPKGLINLLDEPKTT 220

Query: 240 AKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLA 299
           AKK++ A TD D +       E +    NL+ I++T+    I +  +++ GK +   K  
Sbjct: 221 AKKVKSAVTDTDTVIR--FDAEEKPGVSNLLTIYSTLTGTAIADLEQKYEGKGYGALKTD 278

Query: 300 LADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           LA+ +++ + P   + Q  L D   LD+IL +GA +AR  A ET+    + +G 
Sbjct: 279 LAEVMVDFVTPFRTRTQEYLDDTETLDSILAKGAEKARAVAAETLADTYDKLGF 332


>gi|317472698|ref|ZP_07932013.1| tryptophanyl-tRNA synthetase [Anaerostipes sp. 3_2_56FAA]
 gi|316899875|gb|EFV21874.1| tryptophanyl-tRNA synthetase [Anaerostipes sp. 3_2_56FAA]
          Length = 349

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 139/356 (39%), Positives = 205/356 (57%), Gaps = 29/356 (8%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVI---RRQETCNHLGMYFIADLHAITNNIVQ 57
           ML       SG+Q TG + LGNYLG ++N +   + Q  C     Y + D+H+IT     
Sbjct: 15  MLDGKKSLFSGMQATGTITLGNYLGALKNWVDIDKDQYMC----FYSVVDMHSITVRQEP 70

Query: 58  ENLRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEK 117
             LR ++R  +A ++AAG+DP+ N I+ QS V  HA+L WIL+C   MG MN M QFK+K
Sbjct: 71  SELRKRARSLLALYIAAGLDPAENCIYYQSHVSAHAELMWILNCFTYMGEMNRMTQFKDK 130

Query: 118 SKENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKI 177
           S+++ E   + GLF YPVLMAADILL+++  VPVG+DQ QHLEITR IA+RFN  +    
Sbjct: 131 SQKHPENINT-GLFTYPVLMAADILLFQSDVVPVGKDQMQHLEITRDIAERFNKIY---- 185

Query: 178 KEVAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPD 237
                            F I E  I     +I SL++  KKMSKSD +  + I LLD+PD
Sbjct: 186 --------------GDVFTIPEAYIGKVGQKIMSLQEPEKKMSKSDENANAHILLLDDPD 231

Query: 238 IIAKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFK 297
            I +K +KA TD +     ++  E +   KNL++I+  +   K EEA+ +F G  + + K
Sbjct: 232 TIMRKFKKAVTDSEAC---IAYSEEKPGIKNLLDIYCAINGKKPEEAVAEFEGMGYGKLK 288

Query: 298 LALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
             + + V+EE+ PI ++   ++K+K YL+ I+ +   +A   A +T++ V   VG 
Sbjct: 289 ERVGEVVVEELRPIQERYNDIMKNKDYLNKIIKDNGEKASYYAAKTLRKVQHKVGF 344


>gi|261856606|ref|YP_003263889.1| tryptophanyl-tRNA synthetase [Halothiobacillus neapolitanus c2]
 gi|261837075|gb|ACX96842.1| tryptophanyl-tRNA synthetase [Halothiobacillus neapolitanus c2]
          Length = 336

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 140/349 (40%), Positives = 205/349 (58%), Gaps = 27/349 (7%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           + +SG+QP+G L + +Y+G +RN +  Q+T  H  ++ + DLHAIT  + Q+   +++R 
Sbjct: 9   IVLSGIQPSGQLLISHYVGAMRNWVAMQDT--HDSLFMLVDLHAIT--VRQDPAVFRARC 64

Query: 67  --FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEE 124
             FVA +LA G+DP +N IF QS V  HA+L W+L+C   MG +  M QFK+KS      
Sbjct: 65  YDFVALYLACGLDPQKNTIFVQSHVSAHAELGWLLNCYTNMGELERMTQFKDKSTRAGA- 123

Query: 125 TASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKY 184
             ++GLF YPVLMAADILLY+ATHVPVG DQ+QHLE+TR +A RFN  +           
Sbjct: 124 VINVGLFDYPVLMAADILLYQATHVPVGADQKQHLELTRDLAIRFNHIY----------- 172

Query: 185 AQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQ 244
                   G F + E  I  + +RI SL++ +KKMSKSD S+ S + LLD P  I KK +
Sbjct: 173 -------GGVFTVPEPFIPDTGARIMSLQEPTKKMSKSDPSELSYVGLLDEPKTILKKFK 225

Query: 245 KAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           +A TD D   +    +EN+    NL+ +F+      I +   +  G+ +   K+  A+AV
Sbjct: 226 RAVTDSDT--AIRFDVENKPGVSNLLTLFSIFSGESIPDLETRLDGQGYGTLKVQTAEAV 283

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           I  + PI  +   L  D++ LD IL +GA RAR RA+ T++   ++ G 
Sbjct: 284 IAFLEPIQARFHELRADEAALDRILADGAARARARAEPTLQRAFDVHGF 332


>gi|321465368|gb|EFX76370.1| hypothetical protein DAPPUDRAFT_198965 [Daphnia pulex]
          Length = 388

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 139/346 (40%), Positives = 200/346 (57%), Gaps = 26/346 (7%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QPTGVLHLGNY G +R  ++ Q   N   ++ I DLH+IT     + L+       A
Sbjct: 65  SGIQPTGVLHLGNYFGAVRQWVQTQ---NENSLFSIVDLHSITLPQDPKALKENILKMAA 121

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           S LA G+D  + I+F+QS V  HA+LSW+LSC+  +  + ++ QFKEKS   K     LG
Sbjct: 122 SLLACGIDHEKCILFQQSKVPQHAELSWVLSCLTTLPRLGHLPQFKEKSA--KMTDIPLG 179

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L++YPVL +ADILLY+ATHVPVGEDQ QH+++ + +A+ FN ++                
Sbjct: 180 LYIYPVLQSADILLYKATHVPVGEDQLQHIQLAQHLARVFNNKY---------------- 223

Query: 190 YSKGFFPIIEGLI-DSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                FP    ++ D SASR++SLR+  KKMSKSD    SRI L D+PD++ +K +KA T
Sbjct: 224 --GPIFPRPSAVVYDESASRLKSLRNPDKKMSKSDPDAKSRIELTDDPDVVVEKCKKAMT 281

Query: 249 DGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
           D     +    +  R    NLI + +    +  +    +    + +Q+KL +A+AV E +
Sbjct: 282 DFTSAVTYDPAI--RPAVSNLIILHSLCTGLDADRICHENQHIDTAQYKLVVAEAVNEFL 339

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
            PI  +   LLKD +YL +IL +G  RA   AQET + V   VGL+
Sbjct: 340 RPIRHRYMELLKDPNYLISILDQGGARAADIAQETWREVKSAVGLT 385


>gi|291519606|emb|CBK74827.1| tryptophanyl-tRNA synthetase [Butyrivibrio fibrisolvens 16/4]
          Length = 335

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 131/349 (37%), Positives = 201/349 (57%), Gaps = 25/349 (7%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           +  SG+Q TG L +GNY+G ++N +   E   +   + + DLH++T        R  +R 
Sbjct: 7   VLYSGMQATGKLTIGNYIGALKNWVNLHE--EYDCFFGVMDLHSLTVRQNPTEFRQNARR 64

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
               ++AAG+DP +N I+ QS V  HA+L W+L C   MG +N M QFK+KS ++ +   
Sbjct: 65  IYTQYVAAGLDPKKNCIYFQSHVSAHAELGWVLDCFTYMGELNRMTQFKDKSAKHADNIN 124

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           + GLF YP LMAADILLY+A  VP+G DQ+QHLEI R +A+RFN  +             
Sbjct: 125 A-GLFTYPALMAADILLYQADLVPIGADQKQHLEICRDVAERFNNIY------------- 170

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F I EG    + +RI SL + +KKMSKSD +  + I L+D+ D I +K +KA
Sbjct: 171 -----GDVFTIPEGYFPKTGARIMSLAEPTKKMSKSDENVNATIYLVDDRDTIIRKFKKA 225

Query: 247 KTDGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVI 305
            TD D   +EV    EN+    NL+EI+  +    ++E  K+F GK +  FKLA+ ++V 
Sbjct: 226 VTDSD---AEVRYDTENKPGVSNLMEIYGVVTGKTMDEIAKEFEGKGYGDFKLAVGESVA 282

Query: 306 EEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
           + + P  ++   L KDK+++D  + E A +A   A +T++ V++ +GL+
Sbjct: 283 DMLAPFHERCAELEKDKAFIDECIKENAEKASYFANKTLRKVHKKLGLT 331


>gi|332671379|ref|YP_004454387.1| tryptophanyl-tRNA synthetase [Cellulomonas fimi ATCC 484]
 gi|332340417|gb|AEE47000.1| tryptophanyl-tRNA synthetase [Cellulomonas fimi ATCC 484]
          Length = 354

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 133/349 (38%), Positives = 197/349 (56%), Gaps = 30/349 (8%)

Query: 10  SGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           SG+QPT   L LGNYLG +   +  Q+   H  +Y + DLHA+T N     LR ++R   
Sbjct: 10  SGMQPTSDSLQLGNYLGALTQWVALQD--EHDAIYCVVDLHALTVNPDPAVLRDRTRRTA 67

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A FLAAGVDP+R+I+F QS V  HA+L+W+LSC    G    M QFK+KS +   E  ++
Sbjct: 68  AQFLAAGVDPARSILFVQSHVPEHAELAWLLSCQTGFGEAGRMTQFKDKSSKQGSEGTTV 127

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GLF YPVLMAADILLY    VPVGEDQRQHLE++R +AQR N                 +
Sbjct: 128 GLFTYPVLMAADILLYDTNLVPVGEDQRQHLELSRDLAQRLN-----------------Q 170

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
           ++  G   + +  I  + ++I  L+D + KMSKS  S    I LLD+P ++AK+I+ A T
Sbjct: 171 RFGPGTAVVPDPHIVKATAKIYDLQDPTSKMSKSAESPNGLIELLDDPKVVAKRIRSAVT 230

Query: 249 DGD----VLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           D +      P+   G+       NL+ I++ +    ++  +  + GK +   K  LA+ V
Sbjct: 231 DAEREIRFDPAAKPGI------SNLLTIYSALTGRPVDAIVADYDGKGYGDLKKDLAEVV 284

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           +  + P  +++   L D + LD +L +GA+RA+  A  T++ + +  GL
Sbjct: 285 VGFLAPFQERVHGYLADPASLDEVLADGADRAQALAAPTLERLYDRFGL 333


>gi|242237800|ref|YP_002985981.1| tryptophanyl-tRNA synthetase [Dickeya dadantii Ech703]
 gi|242129857|gb|ACS84159.1| tryptophanyl-tRNA synthetase [Dickeya dadantii Ech703]
          Length = 334

 Score =  236 bits (601), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 133/350 (38%), Positives = 198/350 (56%), Gaps = 21/350 (6%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  +  SG QP+G L +GNY+G +R  +  Q+  + +  Y I D HAIT     + LR  
Sbjct: 2   SKPIVFSGAQPSGELTIGNYMGALRQWVNMQDEFDCI--YCIVDQHAITARQDPQQLRKA 59

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           +   +A +LA G+DP ++ IF QS V  HA L W+L+C    G ++ M QFK+KS    E
Sbjct: 60  TLDTLALYLACGIDPQKSTIFVQSHVPEHAQLGWLLNCYTYFGELSRMTQFKDKSARYAE 119

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
              + GLF YPVLMAADILLY+   VPVGEDQ+QHLE++R +AQRFN+ +          
Sbjct: 120 NINA-GLFDYPVLMAADILLYQTNQVPVGEDQKQHLELSRDVAQRFNSIY---------- 168

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
                      F + E  I  S +R+ SL + +KKMSKSD +  + I LL++P  + KKI
Sbjct: 169 --------GDIFKVPEPFIPKSGARVMSLLEPTKKMSKSDDNRNNVIGLLEDPKSVVKKI 220

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           ++A TD D  P     LEN+    NL++I + +    + E    F G+ +   K A+ADA
Sbjct: 221 KRAVTDSDEPPVVRYDLENKPGVSNLLDILSAVTGQTVAELETAFEGQMYGHLKGAVADA 280

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           V   +  + ++      D+++L  ++ +GA +A  RAQET++ V ++VG 
Sbjct: 281 VSGMLSELQERYYRFRNDEAFLQQVMRDGAAKAGARAQETLRKVYDVVGF 330


>gi|294631032|ref|ZP_06709592.1| tryptophanyl-tRNA synthetase [Streptomyces sp. e14]
 gi|292834365|gb|EFF92714.1| tryptophanyl-tRNA synthetase [Streptomyces sp. e14]
          Length = 337

 Score =  236 bits (601), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 137/350 (39%), Positives = 195/350 (55%), Gaps = 31/350 (8%)

Query: 9   VSGVQPT-GVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SG+QPT G  HLGNYLG +R  +  QE  +H   Y +ADLHAIT       LR  +R+ 
Sbjct: 9   LSGIQPTAGSFHLGNYLGAVRQWVSLQE--SHDAFYMLADLHAITVAQDPAELRANTRVA 66

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A  LAAG+DP R  +F QS V  HA L+W+++C+   G    M QFK+KS +   +  S
Sbjct: 67  AAQLLAAGLDPDRCTLFVQSHVPEHAQLAWVMNCLTGFGEAGRMTQFKDKSAKQGADRTS 126

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GLF YP+L  ADILLY+A  VPVGEDQRQH+E+TR +A+RFN  +              
Sbjct: 127 VGLFTYPILQVADILLYQAHEVPVGEDQRQHIELTRDLAERFNGRYGDT----------- 175

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F + +  I    ++I  L++ + KMSKS S+    INLLD+P   AKK++ A 
Sbjct: 176 -------FTVPKAYILKETAKIYDLQEPTAKMSKSASTPKGLINLLDDPKATAKKVRSAV 228

Query: 248 TDGDVL----PSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           TD D +    P   +G+       NL+ I++T+    I E  +++ GK +   K  LA+ 
Sbjct: 229 TDTDTVIRYDPETKAGV------SNLLTIYSTLTGTGIGELEEKYAGKGYGALKTDLAEI 282

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           ++E + P  ++ Q  L D   LD+IL +GA +AR  A ET+      VG 
Sbjct: 283 MVEFVTPFREQTQQYLDDPETLDSILAKGAEKARTVAAETLAQAYAKVGF 332


>gi|331699050|ref|YP_004335289.1| tryptophanyl-tRNA synthetase [Pseudonocardia dioxanivorans CB1190]
 gi|326953739|gb|AEA27436.1| tryptophanyl-tRNA synthetase [Pseudonocardia dioxanivorans CB1190]
          Length = 341

 Score =  236 bits (601), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 138/352 (39%), Positives = 197/352 (55%), Gaps = 35/352 (9%)

Query: 9   VSGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SG+QPT    HLGNYLG +R  +  Q+   H   YF+ DLHAIT +   + L  ++R  
Sbjct: 13  LSGIQPTSDSFHLGNYLGAVRQWVALQD--EHDAFYFVPDLHAITVDHDPKTLAARTRNA 70

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A  LA G+DP +  +F QS V  HA L+W+LSC+   G  + M QFK+KS +   +  +
Sbjct: 71  AAQLLALGLDPDKCTLFVQSHVPEHAQLAWVLSCITGFGEASRMTQFKDKSAKQGADRTT 130

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GLF YP+LMAAD+LLY+A  VPVGEDQRQHLE+TR +AQRFNT F              
Sbjct: 131 VGLFTYPILMAADVLLYQADQVPVGEDQRQHLELTRDLAQRFNTRFGTT----------- 179

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F + E  I + A++I+ L+D + KMSKS S+    I LLD+P + AKKI+ A 
Sbjct: 180 -------FVVPEPYILTGAAKIQDLQDPAIKMSKSASTPSGIIELLDDPKVSAKKIRSAV 232

Query: 248 TDGDVLPSEVSGLENRLEA------KNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALA 301
           TD +         E R +        NL+ I++ +   K+ E    + GK +   K  LA
Sbjct: 233 TDAE--------REIRFDTAAKPGISNLLTIYSALTDRKVSELEADYAGKGYGDLKKDLA 284

Query: 302 DAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + V +   P+ ++++  LKD + LD +L  GA RA   A  T+  V+E +G 
Sbjct: 285 EVVADFTAPLRERVEGYLKDPAELDRVLARGATRAGEVAAATLASVHEKIGF 336


>gi|238926704|ref|ZP_04658464.1| tryptophan--tRNA ligase [Selenomonas flueggei ATCC 43531]
 gi|304437820|ref|ZP_07397769.1| tryptophan--tRNA ligase [Selenomonas sp. oral taxon 149 str.
           67H29BP]
 gi|238885461|gb|EEQ49099.1| tryptophan--tRNA ligase [Selenomonas flueggei ATCC 43531]
 gi|304369177|gb|EFM22853.1| tryptophan--tRNA ligase [Selenomonas sp. oral taxon 149 str.
           67H29BP]
          Length = 334

 Score =  236 bits (601), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 134/347 (38%), Positives = 195/347 (56%), Gaps = 24/347 (6%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           + +SG+QPTG   LGNYLG ++N   RQ    +   YF+ADLHA+T        R  SR 
Sbjct: 11  IILSGIQPTGTFTLGNYLGAVKNW--RQLQKEYDCYYFVADLHALTVYHEPAMRRKASRA 68

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A  LA G+DP  +++F QS V  HA + W+LSC++  G ++ M QFK+KS ++ E+  
Sbjct: 69  AFALLLACGLDPEESLVFIQSHVSAHAQMGWMLSCLSPFGDLSRMTQFKDKSAKHPEDI- 127

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           + GLF YP LMA DILLY+A +VPVG DQ QHLE TR +A RFN             Y +
Sbjct: 128 NAGLFTYPALMAGDILLYQADYVPVGADQTQHLEFTRNVAARFN-----------HVYGE 176

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
             +  +G+FP        + +R+ SL + + KMSKSD +  + I +LD+   I KK + A
Sbjct: 177 TFRLPEGYFP-------KAGARVMSLAEPTAKMSKSDENAKATIFILDDEKTILKKFKSA 229

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
            TD D   +EV+  E +    NL+ I++ +     +    +F GK +  FK A+   V +
Sbjct: 230 VTDSD---AEVAFREGKDGINNLMTIYSAITGKSYDAITAEFAGKGYGDFKTAVGTVVAD 286

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           E+ PI ++   LL DK+YLD  +  GA RA   A++T+      +GL
Sbjct: 287 ELRPIRERYAELLTDKAYLDAEIARGAERAAHIAEKTLAKAKRKMGL 333


>gi|317131245|ref|YP_004090559.1| tryptophanyl-tRNA synthetase [Ethanoligenens harbinense YUAN-3]
 gi|315469224|gb|ADU25828.1| tryptophanyl-tRNA synthetase [Ethanoligenens harbinense YUAN-3]
          Length = 335

 Score =  236 bits (601), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 136/348 (39%), Positives = 201/348 (57%), Gaps = 25/348 (7%)

Query: 6   NLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSR 65
           N+F SG+QPTG+  LGNYLG +RN    QE   +  +Y + DLH++T      NLR Q+ 
Sbjct: 7   NVF-SGIQPTGIPTLGNYLGAMRNWPLLQE--EYHCIYSVVDLHSLTVRQEPANLRRQTL 63

Query: 66  LFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEET 125
             VA  LA G++P ++++F QS V  HA+L+W+L+C  + G ++ M QFK+KS ++ +  
Sbjct: 64  SLVALLLACGINPEKSLLFIQSHVPAHAELAWLLNCYTQFGELSRMTQFKDKSAKHPDNI 123

Query: 126 ASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYA 185
            + GLF YPVLMAADILLY+A  VPVG DQ+QH+E+ R +A RFN  +            
Sbjct: 124 NA-GLFCYPVLMAADILLYQADLVPVGADQKQHMELARDVAGRFNGIY------------ 170

Query: 186 QEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQK 245
                    F I E  I    +R+ SL++ +KKMSKSD +  + I LLD+ D I +K ++
Sbjct: 171 ------GDVFRIPEPYIPKDGARVMSLQEPAKKMSKSDENPNAYILLLDDADTILRKFRR 224

Query: 246 AKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVI 305
           A TD +   +EV   E +    NLI I++ +    + E   +F GK +  FK A+ +AV 
Sbjct: 225 AVTDSE---AEVVCREGKDGINNLISIYSIVTGKTVPEVEHEFAGKGYGDFKTAVGEAVA 281

Query: 306 EEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           E + P+ +    LLK+K YL  +  +GA +AR  A  T     + +GL
Sbjct: 282 EALRPVRETYADLLKNKDYLADVYTKGAEKARAIAGRTYAKACKKLGL 329


>gi|119963213|ref|YP_947022.1| tryptophanyl-tRNA synthetase [Arthrobacter aurescens TC1]
 gi|119950072|gb|ABM08983.1| tryptophanyl-tRNA synthetase [Arthrobacter aurescens TC1]
          Length = 374

 Score =  236 bits (601), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 132/347 (38%), Positives = 200/347 (57%), Gaps = 25/347 (7%)

Query: 9   VSGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SG+QP+   LHLGNYLG + N +R Q+  +   +YFI DLHAIT       L  ++R+ 
Sbjct: 36  LSGMQPSADSLHLGNYLGALVNWVRMQDEYD--AVYFIPDLHAITVPQDPAELARRTRVT 93

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A ++A GVD ++  +F QS V  HA L+W+L+C+  MG    M QFK+K+++   + AS
Sbjct: 94  AAQYIAGGVDVNKCTLFVQSQVPEHAQLAWVLNCITGMGEAARMTQFKDKAQKQGSDHAS 153

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GLF YP+L AADILLY+   VPVGEDQRQH+E++R +A RFN+ F              
Sbjct: 154 VGLFTYPILQAADILLYQPHGVPVGEDQRQHVELSRDLANRFNSRFGET----------- 202

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F + E  I   +++I  L++ + KMSKS  S    INLLD+P  +AK+I+ A 
Sbjct: 203 -------FQVPEAFIQKESAKIYDLQNPTAKMSKSAESPAGLINLLDDPKTVAKRIKSAV 255

Query: 248 TDGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
           TD +   +E+    EN+    NL+ I++ +    +++ +  + GK +   K+ LA+ V  
Sbjct: 256 TDTE---TEIRYDRENKPGVSNLLTIYSAISGTPVDKIVADYQGKMYGHLKVDLAELVSG 312

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + PI ++   LL D + LD +L  GA++AR  A  T+  V   VG 
Sbjct: 313 HLAPIRERANELLADPAELDRLLALGADKAREIAAATLADVYSKVGF 359


>gi|296420332|ref|XP_002839729.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295635923|emb|CAZ83920.1| unnamed protein product [Tuber melanosporum]
          Length = 369

 Score =  236 bits (601), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 148/367 (40%), Positives = 205/367 (55%), Gaps = 35/367 (9%)

Query: 3   SSDNLFV-SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLG--MYFIADLHAITNNIVQEN 59
           +S N+ V SG+QPTG+ HLGNYLG +R  +  Q+         + I DLHAIT     E 
Sbjct: 22  ASSNVSVFSGIQPTGIPHLGNYLGALRQWVGIQDNSPESAKLTFCIVDLHAITQPQEAEQ 81

Query: 60  LRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEK-- 117
           LR +    +A+ LA G+DP R  IF+QS V  H++L WILSCVA MG +N M Q+K K  
Sbjct: 82  LRKRKTELLATLLAVGLDPRRCTIFEQSRVPAHSELMWILSCVAPMGRLNRMTQWKSKLG 141

Query: 118 ------SKENKEETAS--LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRF 169
                 + + K   AS  LGL  YPVL AADIL+++ATHVPVGEDQ QHLE+TR IA  F
Sbjct: 142 VPSNQDALQEKATAASLKLGLLSYPVLQAADILIHKATHVPVGEDQSQHLELTREIASSF 201

Query: 170 NTEFERKIKEVAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSR 229
           N  F++ + +                PI    + S A R+ SL+D ++KM+KS +   SR
Sbjct: 202 NKAFKKDVLK---------------LPIT---LLSPAKRVMSLKDPTQKMTKSAADPASR 243

Query: 230 INLLDNPDIIAKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFA-TMRQIKIEEALKQF 288
           I L D+P  +  K++KA TD    P     ++NR    NLIEI A   R+   +E  K+ 
Sbjct: 244 ILLTDSPKEVHGKLRKAITDSVPGPP-TYDVQNRPGLSNLIEILAHVQRRQDFDEVAKEV 302

Query: 289 GGKNFSQFKLALADAVIEEIVPISQKIQHLL--KDKSYLDTILVEGANRARCRAQETMKY 346
              +   FK  +ADA+ E + PI  + + ++   ++  L  +  EG  +AR  A+ET+  
Sbjct: 303 SDLSLKAFKELVADAISEHLEPIRDEYEKIMAESNREVLHFVASEGERKARESAEETLAE 362

Query: 347 VNEIVGL 353
           V E VGL
Sbjct: 363 VKEAVGL 369


>gi|85060282|ref|YP_455984.1| tryptophanyl-tRNA synthase [Sodalis glossinidius str. 'morsitans']
 gi|84780802|dbj|BAE75579.1| tryptophanyl-tRNA synthase [Sodalis glossinidius str. 'morsitans']
          Length = 334

 Score =  236 bits (601), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 134/350 (38%), Positives = 195/350 (55%), Gaps = 21/350 (6%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  +  SG QP+G L +GNY+G +R  +  Q+  + +  Y I DLHAIT     + LR  
Sbjct: 2   SKPIVFSGAQPSGELTIGNYMGALRQWVSMQDEYDCI--YCIVDLHAITARQDAQQLRKA 59

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           +   +A +LA G+DP+++ +F QS V  H+ L W+L+C    G ++ M QFK+KS    E
Sbjct: 60  TLDVLALYLACGIDPAKSTVFIQSHVPEHSQLGWLLNCYTYFGELSRMTQFKDKSARYAE 119

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
              + GLF YPVLMAADILLY+   VPVGEDQ+QHLE++R IA+RFN  +          
Sbjct: 120 NINA-GLFDYPVLMAADILLYQTNQVPVGEDQKQHLELSRDIAKRFNALYGE-------- 170

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
                      F I E  I  S +R+ SL D  KKMSKSD +  + I LL++P  + KK+
Sbjct: 171 ----------IFTIPEPFIPKSGARVMSLLDPLKKMSKSDDNRNNVITLLEDPKSVVKKL 220

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           ++A TD D  P        +    NL++I + +    + E  + F GK +   K A+ADA
Sbjct: 221 KRAVTDSDEPPVVRYDPVAKPGVSNLLDILSGVTGTPVAELEQAFAGKMYGHLKSAVADA 280

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           V E +  +  +   L  D++YL+ +L +GA +AR +A  T+  V E VG 
Sbjct: 281 VSEMLTALQARYHALCADEAYLNQVLRDGAEKARAQASVTLAKVYEAVGF 330


>gi|302865265|ref|YP_003833902.1| tryptophanyl-tRNA synthetase [Micromonospora aurantiaca ATCC 27029]
 gi|315501809|ref|YP_004080696.1| tryptophanyl-tRNA synthetase [Micromonospora sp. L5]
 gi|302568124|gb|ADL44326.1| tryptophanyl-tRNA synthetase [Micromonospora aurantiaca ATCC 27029]
 gi|315408428|gb|ADU06545.1| tryptophanyl-tRNA synthetase [Micromonospora sp. L5]
          Length = 341

 Score =  236 bits (601), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 137/346 (39%), Positives = 193/346 (55%), Gaps = 25/346 (7%)

Query: 10  SGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFV 68
           SG+QPT    HLGNYLG +R+ +  Q++  H   Y + DLHAIT       L+ +SRL  
Sbjct: 12  SGIQPTADSFHLGNYLGALRHWVALQDS--HDAYYCVVDLHAITAGHDPLVLKRRSRLAA 69

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A   A G+DP R+ +F QS V  H+ L+W+L C+   G    M QFK+KS++   E AS+
Sbjct: 70  AQLFALGLDPERSTLFVQSQVPEHSQLAWVLGCITGFGEAGRMTQFKDKSQKQGSERASV 129

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
           GLF YP+L AADILLY+A  VPVGEDQRQHLE++R +AQRFN+ F R             
Sbjct: 130 GLFTYPILQAADILLYQANAVPVGEDQRQHLELSRDLAQRFNSLFGRT------------ 177

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                 F +    I    ++I  L+D + KMSKS SS    I+LL++P   AKKI+ A T
Sbjct: 178 ------FTVPSPHIVKDTAKITDLQDPTAKMSKSSSSPAGIIDLLEDPARSAKKIRSAVT 231

Query: 249 D-GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
           D G  +   V   E +    NL+ I++ +    +++ +  + GK +   K  LA+ V E 
Sbjct: 232 DTGREI---VFDAEGKPGITNLLTIYSALSGRSVDDLVAAYDGKGYGDLKKDLAEVVREF 288

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + PI ++    L D + LD +L  GA +AR  A  T++   E VG 
Sbjct: 289 VTPIQERTNAYLNDPAQLDKLLARGAEKARSVAAGTLRDAYERVGF 334


>gi|91083443|ref|XP_970123.1| PREDICTED: similar to tryptophanyl-tRNA synthetase [Tribolium
           castaneum]
          Length = 368

 Score =  236 bits (601), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 142/346 (41%), Positives = 197/346 (56%), Gaps = 26/346 (7%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QPTG +HLGNYLG I   ++ QE  N   +  I DLH+IT     + L        A
Sbjct: 33  SGIQPTGQIHLGNYLGAIAQWVKLQEN-NEDMILSIVDLHSITLPQDPKTLSKNILEMAA 91

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           + LA G+DPS+ I+F+QS V  H  LSW L C+  M  + ++  +KEKS   K+    LG
Sbjct: 92  TLLACGIDPSKVILFQQSMVPAHTHLSWCLGCICTMPRLAHLPAYKEKSANLKD--IPLG 149

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF+YPVL AADIL Y+ATHVPVGEDQ QH+++T+ +A+ FN  F                
Sbjct: 150 LFVYPVLQAADILAYKATHVPVGEDQAQHIQLTQDLARMFNNRFGET------------- 196

Query: 190 YSKGFFPIIEGLIDSSA-SRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                FP    +   S  +R+RSLRD +KKMSKSD    SRI L+D PD I KKI+K+ T
Sbjct: 197 -----FPTPHCIFPGSDFARLRSLRDPAKKMSKSDPDPKSRICLIDPPDEIVKKIKKSVT 251

Query: 249 DGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
           D     SEV+   ENR    NLI I + +    + +   +    N  Q+KL +ADAV+  
Sbjct: 252 D---FTSEVTYDPENRPGVANLISIHSFVTGKTVSQICDEAKNLNTGQYKLQVADAVVSH 308

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + PI +KI  LL ++ +L  +L  GA +A   ++ T++ V + +GL
Sbjct: 309 VAPIQKKISDLLHNQDFLLQVLESGAEKATEISEATLQEVKDKLGL 354


>gi|159036398|ref|YP_001535651.1| tryptophanyl-tRNA synthetase [Salinispora arenicola CNS-205]
 gi|157915233|gb|ABV96660.1| tryptophanyl-tRNA synthetase [Salinispora arenicola CNS-205]
          Length = 341

 Score =  235 bits (600), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 140/352 (39%), Positives = 191/352 (54%), Gaps = 35/352 (9%)

Query: 9   VSGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SG+QPT    HLGNYLG + + +  Q+T  H   Y + DLHAIT       L  +SR+ 
Sbjct: 11  LSGIQPTADSFHLGNYLGAVGHWVALQDT--HDAFYCVVDLHAITAGHDPRMLAQRSRIA 68

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A  LA G+DP R  +F QS V  HA L+W+L C+   G    M QFK+KS+    E AS
Sbjct: 69  AAQLLAVGLDPERCTLFVQSQVPEHAQLAWVLGCITGFGEAGRMTQFKDKSQRQGNERAS 128

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GLF YPVL AADILLY+A  VPVGEDQRQHLE++R +AQRFNT F              
Sbjct: 129 VGLFTYPVLQAADILLYQADAVPVGEDQRQHLELSRDLAQRFNTLFGPT----------- 177

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F + E  I    ++I  L+D + KMSKS SS    + LL++    AKKI+ A 
Sbjct: 178 -------FTVPEAHIVKDTAKITDLQDPTAKMSKSSSSPAGIVLLLEDAARSAKKIRSAV 230

Query: 248 TDGDVLPSEVSGLENRLEAK------NLIEIFATMRQIKIEEALKQFGGKNFSQFKLALA 301
           TD        +G E   +A+      NL+ I++ +    I++ +  + GK +   K  L 
Sbjct: 231 TD--------TGREVVFDAQQKPGVSNLLTIYSALSGRSIDDLVAAYAGKGYGDLKKDLG 282

Query: 302 DAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + V E + PI  + +  L D + LD +LV GA +AR  A  T++ V E VG 
Sbjct: 283 EVVREFVAPIQDRTRGYLADPAQLDRLLVTGAQKARAVAGPTLRAVYERVGF 334


>gi|289423050|ref|ZP_06424866.1| tryptophan--tRNA ligase [Peptostreptococcus anaerobius 653-L]
 gi|289156523|gb|EFD05172.1| tryptophan--tRNA ligase [Peptostreptococcus anaerobius 653-L]
          Length = 332

 Score =  235 bits (600), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 140/347 (40%), Positives = 202/347 (58%), Gaps = 30/347 (8%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQP+G + LGNYLG +RN  + Q+  ++   + + ++HAIT     + LR Q+   +A
Sbjct: 11  SGVQPSGKMTLGNYLGALRNWTKLQK--DYECFFSMVNMHAITVPQDPKVLRRQTIELLA 68

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
            F+A G++P  N IF QS V  HA+L+W+L     MG +N M Q+K+KS+++ E   + G
Sbjct: 69  QFIACGIEPDLNTIFVQSHVHEHAELNWVLCTTTYMGELNRMTQYKDKSQKS-EANLNAG 127

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YPVLMAADILLY+A  VPVG+DQ+QHLE+ R +A RFN  F                
Sbjct: 128 LFTYPVLMAADILLYQADLVPVGDDQKQHLELARDLATRFNNRFGDT------------- 174

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                F + EG      +R+ SL+D +KKMSKSDS+    I L ++ D  AKKI+ A TD
Sbjct: 175 -----FVVPEGYYPKETARVMSLQDPTKKMSKSDSNPKGFILLAEDADSTAKKIKSAVTD 229

Query: 250 --GDV-LPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
             G V    E  GL      KNLI I++ M    +EE +  + GK +  FK  +A+AV+E
Sbjct: 230 SVGIVRYTDEQPGL------KNLINIYSAMTDKSVEEVVAMYEGKGYGAFKGEMAEAVVE 283

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            + PI +K  +LL ++ YL+ I   GA +A+  A +T+  V + +G 
Sbjct: 284 TLRPIREKYAYLLDNQDYLEKIYRSGAEKAQLVAAKTLADVYDKIGF 330


>gi|161344764|ref|NP_441020.2| tryptophanyl-tRNA synthetase [Synechocystis sp. PCC 6803]
 gi|8039807|sp|P73655|SYW_SYNY3 RecName: Full=Tryptophanyl-tRNA synthetase; AltName:
           Full=Tryptophan--tRNA ligase; Short=TrpRS
          Length = 337

 Score =  235 bits (600), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 143/349 (40%), Positives = 199/349 (57%), Gaps = 25/349 (7%)

Query: 8   FVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYF-IADLHAITNNIVQENLRYQSRL 66
            +SGVQPTG LHLGNYLG IR+ + +Q+   H   +F + DLHAIT     + L   +  
Sbjct: 6   ILSGVQPTGNLHLGNYLGAIRSWVEQQQ---HYDNFFCVVDLHAITVPHNPQTLAQDTLT 62

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A +LA G+D   + IF QS V  H++L+W+L+CV  + W+  MIQFKEK+ + + E  
Sbjct: 63  IAALYLACGIDLQYSTIFVQSHVAAHSELAWLLNCVTPLNWLERMIQFKEKAVK-QGENV 121

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           S+GL  YPVLMAADILLY A  VPVGEDQ+QHLE+TR I  R N +F R+   V +    
Sbjct: 122 SVGLLDYPVLMAADILLYDADKVPVGEDQKQHLELTRDIVIRINDKFGREDAPVLK---- 177

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                     + E LI    +R+ SL D +KKMSKSD S+ SRINLLD P++I KK++K 
Sbjct: 178 ----------LPEPLIRKEGARVMSLADGTKKMSKSDESELSRINLLDPPEMIKKKVKKC 227

Query: 247 KTDGDVLPSEVSGLEN--RLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           KTD    P      ++  R E  NL+ ++  +     E   ++     + QFK  L +  
Sbjct: 228 KTD----PQRGLWFDDPERPECHNLLTLYTLLSNQTKEAVAQECAEMGWGQFKPLLTETA 283

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           I  + PI  K   +L D+  LD I+  G  +A   AQ+T+  V + +G 
Sbjct: 284 IAALEPIQAKYAEILADRGELDRIIQAGNAKASQTAQQTLARVRDALGF 332


>gi|1652781|dbj|BAA17700.1| tryptophanyl-tRNA synthetase [Synechocystis sp. PCC 6803]
          Length = 377

 Score =  235 bits (600), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 143/349 (40%), Positives = 199/349 (57%), Gaps = 25/349 (7%)

Query: 8   FVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYF-IADLHAITNNIVQENLRYQSRL 66
            +SGVQPTG LHLGNYLG IR+ + +Q+   H   +F + DLHAIT     + L   +  
Sbjct: 46  ILSGVQPTGNLHLGNYLGAIRSWVEQQQ---HYDNFFCVVDLHAITVPHNPQTLAQDTLT 102

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A +LA G+D   + IF QS V  H++L+W+L+CV  + W+  MIQFKEK+ + + E  
Sbjct: 103 IAALYLACGIDLQYSTIFVQSHVAAHSELAWLLNCVTPLNWLERMIQFKEKAVK-QGENV 161

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           S+GL  YPVLMAADILLY A  VPVGEDQ+QHLE+TR I  R N +F R+   V +    
Sbjct: 162 SVGLLDYPVLMAADILLYDADKVPVGEDQKQHLELTRDIVIRINDKFGREDAPVLK---- 217

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                     + E LI    +R+ SL D +KKMSKSD S+ SRINLLD P++I KK++K 
Sbjct: 218 ----------LPEPLIRKEGARVMSLADGTKKMSKSDESELSRINLLDPPEMIKKKVKKC 267

Query: 247 KTDGDVLPSEVSGLEN--RLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAV 304
           KTD    P      ++  R E  NL+ ++  +     E   ++     + QFK  L +  
Sbjct: 268 KTD----PQRGLWFDDPERPECHNLLTLYTLLSNQTKEAVAQECAEMGWGQFKPLLTETA 323

Query: 305 IEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           I  + PI  K   +L D+  LD I+  G  +A   AQ+T+  V + +G 
Sbjct: 324 IAALEPIQAKYAEILADRGELDRIIQAGNAKASQTAQQTLARVRDALGF 372


>gi|326912810|ref|XP_003202739.1| PREDICTED: tryptophanyl-tRNA synthetase, mitochondrial-like
           [Meleagris gallopavo]
          Length = 379

 Score =  235 bits (600), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 139/350 (39%), Positives = 204/350 (58%), Gaps = 26/350 (7%)

Query: 5   DNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQS 64
           D +F SG+QPTG  HLGNYLG I+N +  QE  N + +Y I DLH++T       LR   
Sbjct: 54  DRIF-SGIQPTGTPHLGNYLGAIQNWVNLQEKYNSV-LYSIMDLHSLTMPKEPAVLRQNV 111

Query: 65  RLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEE 124
               A+ LA G+DP +  +F+QS V  H +L+WIL C+  +  +  + Q+K K      +
Sbjct: 112 LDTTAAILACGIDPRKCFLFRQSLVPEHTELAWILGCLTNVPRLLRLPQWKMKCASQNND 171

Query: 125 TASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKY 184
             ++GL  YPVL AADILLY++THVPVGEDQ  HLE+ + IAQ FN           +KY
Sbjct: 172 -GNVGLLTYPVLQAADILLYKSTHVPVGEDQVLHLELAQDIAQHFN-----------KKY 219

Query: 185 AQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQ 244
            +       FFP+ + ++ S+  +I+SLRD + KMSKSD    + IN+ D+P+ +  K +
Sbjct: 220 GE-------FFPVPKAIL-STTKKIKSLRDPTVKMSKSDPQKLATINIADSPEEVVLKFR 271

Query: 245 KAKTDGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           KA TD     SEV+    +R    NL+ I A +  + IEE L Q  G + +Q+K+ +A++
Sbjct: 272 KAVTD---FTSEVTYDPSSRPGVSNLVSIHAAVTGLSIEEVLHQAVGLDTAQYKMVVAES 328

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           VI++  PI  +I+ L +DK+YL  IL  GA +A+  A    + V  +VG 
Sbjct: 329 VIQKFTPIRNEIKKLQEDKAYLIKILEAGAEKAKELATPIYQEVRRLVGF 378


>gi|315644079|ref|ZP_07897249.1| tryptophanyl-tRNA synthetase [Paenibacillus vortex V453]
 gi|315280454|gb|EFU43743.1| tryptophanyl-tRNA synthetase [Paenibacillus vortex V453]
          Length = 327

 Score =  235 bits (600), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 135/347 (38%), Positives = 199/347 (57%), Gaps = 27/347 (7%)

Query: 8   FVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
            +SG++P+G L++G Y G +R  +  Q   ++   +F+ D HA+T       L  ++R  
Sbjct: 4   LLSGIKPSGDLNIGGYGGALRQYVNLQH--DYEAYFFVPDFHAVTVYQDPRKLHQRTRDI 61

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A ++A+G+DP +  IF QS V  HA+L W+L   A  G +  M QFKEKS  + ++T S
Sbjct: 62  AALYIASGIDPRKATIFLQSQVPAHAELGWLLETQAHFGELKRMTQFKEKS--DGKDTVS 119

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
             LF YPVLMAAD+LLY+ATHVPVG+DQ+QHLE+TR +A+RFN  F              
Sbjct: 120 SALFTYPVLMAADVLLYQATHVPVGDDQKQHLELTRDVAERFNNRFGST----------- 168

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F I E +I    SR+  L D SKKMSKS+ +  S ++++D+P+ I +K  KA 
Sbjct: 169 -------FIIPEPIIQDIGSRVMGLDDPSKKMSKSNPNKNSCVHMMDSPEDIRRKFSKAV 221

Query: 248 TDGDVLPSEV-SGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
           TD +    EV    E +    NLIEI++   +  I    K++ G+ +  FK  LA+ VIE
Sbjct: 222 TDSE---GEVRHDWEQKPAVSNLIEIYSVFSEEDISVIEKRYDGQGYGTFKKELAEVVIE 278

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           +++PI +K  H + D S LD IL++GA RA   A  T+    + +G 
Sbjct: 279 KLLPIQEKF-HQIVDSSELDRILIDGAQRAAQTASGTLLAAKKAMGF 324


>gi|150389018|ref|YP_001319067.1| tryptophanyl-tRNA synthetase [Alkaliphilus metalliredigens QYMF]
 gi|149948880|gb|ABR47408.1| tryptophanyl-tRNA synthetase [Alkaliphilus metalliredigens QYMF]
          Length = 333

 Score =  235 bits (600), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 139/354 (39%), Positives = 206/354 (58%), Gaps = 28/354 (7%)

Query: 2   LSSDNLFVSGVQPTGVLHLGNYLGMIRN--VIRRQETCNHLGMYFIADLHAITNNIVQEN 59
           ++ + +  SG QPTG L LGNY+G I+N   + +   C    +Y I DLH++T     E 
Sbjct: 3   INGEKIIFSGAQPTGSLTLGNYIGAIQNWKALEQDYQC----LYSIVDLHSLTVKHDAEA 58

Query: 60  LRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSK 119
            R Q+  F+  +LA G+DP +NIIF QS V  H++L+W+L C   MG +N M QFKEKS+
Sbjct: 59  FRKQNLSFLVQYLACGLDPEKNIIFFQSHVPQHSELAWVLGCNTYMGELNRMTQFKEKSQ 118

Query: 120 ENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKE 179
           ++ +   + GL+ YPVLMAADIL+Y+   VPVGEDQ+QHLE+ R IA RFN         
Sbjct: 119 KH-QNNINAGLYTYPVLMAADILIYQTDVVPVGEDQKQHLELARDIAIRFNN-------- 169

Query: 180 VAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDII 239
                A  E      F + EG I    ++I SL++  KKMSKSD +  S I L+D+ D++
Sbjct: 170 -----AHGET-----FIVPEGHIPKVGAKIMSLQEPDKKMSKSDENLNSTIFLMDSEDVL 219

Query: 240 AKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLA 299
            KK++++ TD +   + VS  + +   KNL+ I++ +    IEE   ++ GK +  FK  
Sbjct: 220 LKKLKRSVTDSE---NRVSYNDEQPGIKNLMTIYSKLTGESIEEIQAKYEGKGYGIFKKE 276

Query: 300 LADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           +A+ V+E I P  +K +  + +  Y++ I   GA RA   A+ TMK V   +GL
Sbjct: 277 VAEVVVESIRPFKEKYEAYMNNLDYVEKIYQSGAERATEIAEITMKEVRNKIGL 330


>gi|28899578|ref|NP_799183.1| tryptophanyl-tRNA synthetase [Vibrio parahaemolyticus RIMD 2210633]
 gi|153840023|ref|ZP_01992690.1| tryptophanyl-tRNA synthetase [Vibrio parahaemolyticus AQ3810]
 gi|260361409|ref|ZP_05774471.1| tryptophan--tRNA ligase [Vibrio parahaemolyticus K5030]
 gi|260876681|ref|ZP_05889036.1| tryptophan--tRNA ligase [Vibrio parahaemolyticus AN-5034]
 gi|260896626|ref|ZP_05905122.1| tryptophan--tRNA ligase [Vibrio parahaemolyticus Peru-466]
 gi|260900885|ref|ZP_05909280.1| tryptophan--tRNA ligase [Vibrio parahaemolyticus AQ4037]
 gi|31076993|sp|Q87L13|SYW_VIBPA RecName: Full=Tryptophanyl-tRNA synthetase; AltName:
           Full=Tryptophan--tRNA ligase; Short=TrpRS
 gi|28807814|dbj|BAC61067.1| tryptophanyl-tRNA synthetase [Vibrio parahaemolyticus RIMD 2210633]
 gi|149746421|gb|EDM57442.1| tryptophanyl-tRNA synthetase [Vibrio parahaemolyticus AQ3810]
 gi|308086316|gb|EFO36011.1| tryptophan--tRNA ligase [Vibrio parahaemolyticus Peru-466]
 gi|308093970|gb|EFO43665.1| tryptophan--tRNA ligase [Vibrio parahaemolyticus AN-5034]
 gi|308106505|gb|EFO44045.1| tryptophan--tRNA ligase [Vibrio parahaemolyticus AQ4037]
 gi|308112893|gb|EFO50433.1| tryptophan--tRNA ligase [Vibrio parahaemolyticus K5030]
 gi|328472295|gb|EGF43165.1| tryptophanyl-tRNA synthetase [Vibrio parahaemolyticus 10329]
          Length = 338

 Score =  235 bits (600), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 134/351 (38%), Positives = 203/351 (57%), Gaps = 19/351 (5%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  + +SGVQP+G L +GNYLG +R   + Q+  ++   Y + DLHA+T     + L   
Sbjct: 2   SKPIVLSGVQPSGELSIGNYLGALRQWQQMQD--DYDCQYCVVDLHAVTVRQDPKALHEA 59

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           +   +A  LA GVDP ++ +F QS V  HA L W+L+C  +MG ++ M QFK+KS     
Sbjct: 60  TLDALAICLAVGVDPKKSTLFVQSHVPEHAQLGWLLNCYTQMGELSRMTQFKDKSARYAN 119

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
           +  ++GLF YPVLMAADILLY A  VPVG DQ+QHLE+ R IA RFN  +  +       
Sbjct: 120 DV-NVGLFDYPVLMAADILLYGAHQVPVGSDQKQHLELARDIATRFNNIYSPE------- 171

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
                      F + E  I +  +R+ SL+DA+KKMSKSD +  + I LL+ P  I KKI
Sbjct: 172 --------SPIFTVPEPYIPTVNARVMSLQDATKKMSKSDDNRKNVITLLEEPKSIIKKI 223

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGG-KNFSQFKLALAD 302
            KA+TD +  PS    +EN+    NL+ +++    +  EE   ++ G + +  FK  + +
Sbjct: 224 NKAQTDTETPPSIRHDVENKAGIANLMGLYSAATGMSFEEIEAKYKGVEMYGPFKKDVGE 283

Query: 303 AVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           AV+  + PI ++ + +  D++++D ++ +GA +A  RA ET+K   E VG 
Sbjct: 284 AVVAMLEPIQEEYRRIRADRAFMDEVMKQGAEKASARAAETLKKAYEAVGF 334


>gi|242309615|ref|ZP_04808770.1| tryptophanyl-tRNA synthetase [Helicobacter pullorum MIT 98-5489]
 gi|239523616|gb|EEQ63482.1| tryptophanyl-tRNA synthetase [Helicobacter pullorum MIT 98-5489]
          Length = 337

 Score =  235 bits (600), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 135/345 (39%), Positives = 199/345 (57%), Gaps = 25/345 (7%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QPTG +HLGNYLG ++N + RQ    +  ++ + + HAIT     + L+ ++    A
Sbjct: 16  SGIQPTGNIHLGNYLGAVKNWVERQN--EYENIFCVVNSHAITIPQNPKILKEKTFELCA 73

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
             LA G+DP ++ +F QS++  H  L+W+L+C+  MG ++ M QFK+KS++N +   + G
Sbjct: 74  MLLACGIDPKKSTLFIQSEIQEHTSLAWLLTCITPMGDLSRMTQFKDKSQKNPKSIFA-G 132

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YP LM+ADILLY++ +VPVGEDQ+QH+E+ R  A RFN +F                
Sbjct: 133 LFNYPNLMSADILLYKSEYVPVGEDQKQHIELARDTAMRFNRDFGET------------- 179

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSR-INLLDNPDIIAKKIQKAKT 248
                F + + LI    +RI  L D +KKMSKS     +  I LLD+PD I +K +KA T
Sbjct: 180 -----FVVPKPLIQKEGARIMGLDDPTKKMSKSSGDKPNHLIALLDSPDEILRKFKKATT 234

Query: 249 DGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
           D + L   ++  ENR    NL+ I+    +   E+    F GK + + K  +A+ VIE +
Sbjct: 235 DSEGL---IAFDENRAGVYNLLSIYQCFSKETKEQIESFFAGKGYGELKAKVAEIVIENL 291

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            PI +  + L+ D SYL  IL EGA  AR  AQ+T K   E +GL
Sbjct: 292 KPIRESYEKLIADSSYLHKILEEGAETAREIAQKTYKDAKEKMGL 336


>gi|304397803|ref|ZP_07379679.1| tryptophanyl-tRNA synthetase [Pantoea sp. aB]
 gi|304354514|gb|EFM18885.1| tryptophanyl-tRNA synthetase [Pantoea sp. aB]
          Length = 333

 Score =  235 bits (599), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 135/347 (38%), Positives = 199/347 (57%), Gaps = 21/347 (6%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           +  SG QP+G L +GNY+G +R  ++ Q+  + +  Y I DLHAIT       LR  +  
Sbjct: 4   IVFSGAQPSGELTIGNYMGALRQWVQMQDDFHCI--YCIVDLHAITVRQDPAALRKATLD 61

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
            +A +LA G+DP ++ IF QS V  H  LSWIL+C A  G ++ M QFK+KS    EE  
Sbjct: 62  TLALYLACGIDPEKSTIFVQSHVPEHTQLSWILNCYAYFGELSRMTQFKDKSA-RYEENI 120

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           + GLF YPVLMAADILLY+   VPVGEDQ+QHLE++R IA RFN  +             
Sbjct: 121 NAGLFDYPVLMAADILLYQTNQVPVGEDQKQHLELSRDIAHRFNAIY------------- 167

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F + E  I  S +R+ SL + +KKMSKSD +  + I LL++P  + KKI++A
Sbjct: 168 -----GDIFRVPEPFIPKSGARVMSLLEPTKKMSKSDDNRNNVIGLLEDPKAVVKKIKRA 222

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
            TD +  P     ++ +    NL++I + +    I E  ++F GK +   K A+ADAV  
Sbjct: 223 VTDSEEPPVVRYDIKEKAGVSNLLDILSGVTGKTIAELEQEFEGKMYGHLKGAVADAVSG 282

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            +  + ++      D++ L+ ++ +GA +AR +AQET+K V + VG 
Sbjct: 283 MLSELQERYHRFRNDEALLEQVMRDGAAKARAQAQETLKKVYQAVGF 329


>gi|269103988|ref|ZP_06156685.1| tryptophanyl-tRNA synthetase [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268163886|gb|EEZ42382.1| tryptophanyl-tRNA synthetase [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 340

 Score =  235 bits (599), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 136/351 (38%), Positives = 200/351 (56%), Gaps = 18/351 (5%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  + +SGVQP+G L +GNYLG +R   + Q+  ++   Y + DLHAIT     + L   
Sbjct: 2   SKPIVLSGVQPSGELSIGNYLGALRQWEQMQD--DYDCQYCVVDLHAITVRQDPKALHEA 59

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           +   +A  LA GVDP ++ +F QS V  HA L W+L+C  +MG ++ M QFK+KS  +  
Sbjct: 60  TLDALAICLAVGVDPQKSTLFVQSHVPEHAQLGWLLNCYTQMGELSRMTQFKDKSARHAN 119

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
           +  ++GLF YPVLMAADILLY A  VPVG DQ+QHLE+ R IA RFN             
Sbjct: 120 DV-NVGLFDYPVLMAADILLYGAHQVPVGSDQKQHLELARDIATRFNN-----------I 167

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
           Y  EE      F I E  I +  +R+ SL+DA+KKMSKSD +  + I LL+ P  I KKI
Sbjct: 168 YGSEE---SPIFQIPEPYIPTVGARVMSLQDATKKMSKSDDNRKNVITLLEEPKSIIKKI 224

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGG-KNFSQFKLALAD 302
            KA+TD +  P     +EN+    NL+ +++        E   Q+ G + +  FK  + +
Sbjct: 225 NKAQTDAETPPRIAFDIENKAGISNLMGLYSAATGKTFAEIEAQYAGVEMYGPFKKDVGE 284

Query: 303 AVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           A++  + P+  +   +  D++YLD+++ +GA +A  RA E +K   + VG 
Sbjct: 285 ALVAMLEPVQAEYHRIRSDRAYLDSVMKQGAEKASARAAEVLKKAYQAVGF 335


>gi|126654182|ref|ZP_01725989.1| tryptophanyl-tRNA synthetase [Bacillus sp. B14905]
 gi|126589353|gb|EAZ83506.1| tryptophanyl-tRNA synthetase [Bacillus sp. B14905]
          Length = 329

 Score =  235 bits (599), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 137/345 (39%), Positives = 200/345 (57%), Gaps = 25/345 (7%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQPTG++ LGNYLG  +     Q+  +   +Y I D HAIT     + LR   R   A
Sbjct: 6   SGVQPTGIVTLGNYLGAFKQFPALQDEGD--AIYCIVDQHAITVAQDPKELRESIRKLAA 63

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           +++A G+DP ++ +F QS+V  HA   W+L CVA +G +  M QFK+KS  + +E+ S  
Sbjct: 64  TYIATGIDPKKSTLFIQSEVPAHAQAGWMLQCVASIGELERMTQFKDKS--HGKESVSAA 121

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L  YP LMAADILLY    VPVG+DQ+QH+E+TR +A+RFN           ++Y     
Sbjct: 122 LLTYPPLMAADILLYNTNIVPVGDDQKQHIELTRDLAERFN-----------KRYGD--- 167

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                  I E  +  + +RI+SL++ +KKMSKSD +  + I LLD    I KKI+ A TD
Sbjct: 168 ----VLTIPEIQLPKAGARIKSLQEPTKKMSKSDPNTKATIRLLDTAKDIEKKIKSAVTD 223

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            D + +    +EN+    NL+ I + +  I I++ +K++ G  +  FK  +A AVI+ + 
Sbjct: 224 SDGIVA--FDVENKPGVSNLLTIESAISGISIDDLVKKYEGIGYGGFKQGVATAVIDHLT 281

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
           PI +K  HL+ + S LD IL EGA +A   A  T+K + E +GL 
Sbjct: 282 PIQEKFYHLV-ESSELDVILDEGAEKANAIASATLKRMEEAMGLG 325


>gi|260774704|ref|ZP_05883608.1| tryptophanyl-tRNA synthetase [Vibrio coralliilyticus ATCC BAA-450]
 gi|260609360|gb|EEX35511.1| tryptophanyl-tRNA synthetase [Vibrio coralliilyticus ATCC BAA-450]
          Length = 345

 Score =  235 bits (599), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 135/357 (37%), Positives = 202/357 (56%), Gaps = 24/357 (6%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  + +SGVQP+G L +GNYLG +R   + Q+  ++   Y + DLHAIT     + L   
Sbjct: 2   SKPIVLSGVQPSGELSIGNYLGALRQWQQMQD--DYDCQYCVVDLHAITVRQEPKALHEA 59

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           +   +A  LA GVDP ++ +F QS V  HA L W+L+C  +MG ++ M QFK+KS    +
Sbjct: 60  TLDALAICLAVGVDPQKSTLFVQSHVPEHAQLGWLLNCYTQMGELSRMTQFKDKSARYSK 119

Query: 124 ETAS------LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKI 177
           +++S      +GLF YPVLMAADILLY A  VPVG DQ+QHLE+ R IA RFN  +  + 
Sbjct: 120 DSSSQFGDVNVGLFDYPVLMAADILLYGAHQVPVGSDQKQHLELARDIANRFNNIYSPE- 178

Query: 178 KEVAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPD 237
                         +  F + E  I +  +R+ SL+DA+KKMSKSD +  + I LL+ P 
Sbjct: 179 --------------QPIFQVPEPYIPTVNARVMSLQDATKKMSKSDDNRKNVITLLEEPK 224

Query: 238 IIAKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGG-KNFSQF 296
            I KKI KA+TD +  P      +N+    NL+ +++       EE   Q+ G + +  F
Sbjct: 225 SIIKKINKAQTDAETPPRIAHDWDNKAGISNLMGLYSAATGKSFEEIEAQYQGVEMYGPF 284

Query: 297 KLALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           K  + +A++  + PI  +   +  D++Y+D ++ +GA +A  RA ET+K   E VG 
Sbjct: 285 KKDVGEAIVAMLEPIQAEYHRIRADRAYMDQVMKQGAEKASARAAETLKKAYEAVGF 341


>gi|157372831|ref|YP_001480820.1| tryptophanyl-tRNA synthetase [Serratia proteamaculans 568]
 gi|157324595|gb|ABV43692.1| tryptophanyl-tRNA synthetase [Serratia proteamaculans 568]
          Length = 334

 Score =  235 bits (599), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 134/350 (38%), Positives = 198/350 (56%), Gaps = 21/350 (6%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  +  SG QP+G L +GNY+G +R   + Q+  ++  +Y I DLHAIT     E LR  
Sbjct: 2   SKPIVFSGAQPSGELTIGNYMGALRQWEKMQD--DYDCIYCIVDLHAITVRQDAEKLRKA 59

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           +   +A +LA G+DP ++ IF QS V  H  LSW+L+C    G ++ M QFK+KS    E
Sbjct: 60  TLDTLALYLACGIDPQKSTIFVQSHVPEHTQLSWVLNCYTYFGELSRMTQFKDKSTRYAE 119

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
              + GLF YPVLMAADILLY+   VPVGEDQ+QHLE++R I QRFN  +          
Sbjct: 120 NINA-GLFSYPVLMAADILLYQTNQVPVGEDQKQHLELSRDIGQRFNALY---------- 168

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
                      F + E  I  S +R+ SL++ +KKMSKSD +  + I LL++P  +AKKI
Sbjct: 169 --------GDVFKVPEPFIPKSGARVMSLQEPTKKMSKSDDNRNNVIGLLEDPKAVAKKI 220

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           ++A TD +  P     + N+    NL++I + +    I +   +F G+ +   K A+ADA
Sbjct: 221 KRAMTDSEEPPVVRYDVVNKAGVSNLLDILSGVTGKSIPQLEAEFEGQMYGHLKGAVADA 280

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           V   +  + ++      D++ L  ++ +GA +AR RAQET+  V + VG 
Sbjct: 281 VSGMLGELQERYHRFRNDEALLQQVMRDGAAKARARAQETLAKVYQAVGF 330


>gi|167745709|ref|ZP_02417836.1| hypothetical protein ANACAC_00401 [Anaerostipes caccae DSM 14662]
 gi|167655021|gb|EDR99150.1| hypothetical protein ANACAC_00401 [Anaerostipes caccae DSM 14662]
          Length = 349

 Score =  235 bits (599), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 139/356 (39%), Positives = 204/356 (57%), Gaps = 29/356 (8%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVI---RRQETCNHLGMYFIADLHAITNNIVQ 57
           ML       SG+Q TG + LGNYLG ++N +   + Q  C     Y + D+H+IT     
Sbjct: 15  MLDGKKSLFSGMQATGTITLGNYLGALKNWVDIDKDQYMC----FYSVVDMHSITVRQEP 70

Query: 58  ENLRYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEK 117
             LR ++R  +A ++AAG+DP  N I+ QS V  HA+L WIL+C   MG MN M QFK+K
Sbjct: 71  SELRKRARSLLALYIAAGLDPVENCIYYQSHVSAHAELMWILNCFTYMGEMNRMTQFKDK 130

Query: 118 SKENKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKI 177
           S+++ E   + GLF YPVLMAADILL+++  VPVG+DQ QHLEITR IA+RFN  +    
Sbjct: 131 SQKHPENINT-GLFTYPVLMAADILLFQSDVVPVGKDQMQHLEITRDIAERFNKIY---- 185

Query: 178 KEVAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPD 237
                            F I E  I     +I SL++  KKMSKSD +  + I LLD+PD
Sbjct: 186 --------------GDVFTIPEAYIGKVGQKIMSLQEPEKKMSKSDENANAHILLLDDPD 231

Query: 238 IIAKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFK 297
            I +K +KA TD +     ++  E +   KNL++I+  +   K EEA+ +F G  + + K
Sbjct: 232 TIMRKFKKAVTDSEAC---IAYSEEKPGIKNLLDIYCAINGKKPEEAVAEFEGMGYGKLK 288

Query: 298 LALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
             + + V+EE+ PI ++   ++K+K YL+ I+ +   +A   A +T++ V   VG 
Sbjct: 289 ERVGEVVVEELRPIQERYNDIMKNKDYLNKIIKDNGEKASYYAAKTLRKVQHKVGF 344


>gi|90580851|ref|ZP_01236653.1| tryptophanyl-tRNA synthetase [Vibrio angustum S14]
 gi|90437922|gb|EAS63111.1| tryptophanyl-tRNA synthetase [Vibrio angustum S14]
          Length = 339

 Score =  234 bits (598), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 136/351 (38%), Positives = 200/351 (56%), Gaps = 18/351 (5%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  + +SGVQP+G L +GNYLG +R   + Q+  ++   Y + DLHAIT     + L   
Sbjct: 2   SKPIVLSGVQPSGELSIGNYLGALRQWEQMQD--DYDCQYCVVDLHAITVRQDPKALHEA 59

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           +   +A  LA GVDP ++ +F QS V  HA L W+L+C  +MG ++ M QFK+KS  +  
Sbjct: 60  TLDALAICLAVGVDPQKSTLFVQSHVPEHAQLGWLLNCYTQMGELSRMTQFKDKSARHAN 119

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
           +  ++GLF YPVLMAADILLY A  VPVG DQ+QHLE+ R IA RFN             
Sbjct: 120 DV-NVGLFGYPVLMAADILLYGAHQVPVGSDQKQHLELARDIATRFNN-----------L 167

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
           Y  EE      F I E  I S  +R+ SL+DA+KKMSKSD +  + I LL++P  I KK+
Sbjct: 168 YGTEE---SSIFQIPEPYIPSVGARVMSLQDATKKMSKSDDNRKNVITLLEDPKSILKKV 224

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGG-KNFSQFKLALAD 302
            KA+TD +  P      EN+    NL+ +++        E   Q+ G + +  FK  + +
Sbjct: 225 NKAQTDAETPPRIAFDTENKAGISNLMGLYSGATGKTYAEIEAQYAGVEMYGPFKKDVGE 284

Query: 303 AVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           A++  + P+  +   +  D++YLD+++ +GA +A  RA E +K   + VG 
Sbjct: 285 ALVAMLEPVQAEYHRIRADRAYLDSVMKQGAEKASARAAEVLKKAYQAVGF 335


>gi|292669382|ref|ZP_06602808.1| tryptophan-tRNA ligase [Selenomonas noxia ATCC 43541]
 gi|292649017|gb|EFF66989.1| tryptophan-tRNA ligase [Selenomonas noxia ATCC 43541]
          Length = 348

 Score =  234 bits (598), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 135/351 (38%), Positives = 200/351 (56%), Gaps = 24/351 (6%)

Query: 3   SSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRY 62
           S   + +SG+QPTG   LGNYLG ++N  + QE  +    YF+ADLHA+T        R 
Sbjct: 21  SRRRIILSGIQPTGTFTLGNYLGAVKNWRQLQEEYD--CYYFVADLHALTVYHDPAARRK 78

Query: 63  QSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENK 122
            SR   A  LA G+DP+++++F QS V  HA ++W+LSC++  G ++ M QFK+KS ++ 
Sbjct: 79  ASREAFALLLACGLDPTKSLVFIQSHVPAHAQMAWMLSCLSPFGDLSRMTQFKDKSAKHP 138

Query: 123 EETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQ 182
           E+  + GLF YP LMA DILLY+A +VPVG DQ QHLE TR IA RFN            
Sbjct: 139 EDI-NAGLFTYPALMAGDILLYQADYVPVGADQTQHLEFTRNIAARFN-----------H 186

Query: 183 KYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKK 242
            Y +  +  +G+FP        + +R+ SL + + KMSKSD +  + I +LD+   I KK
Sbjct: 187 IYGETFRLPEGYFP-------KTGARVMSLAEPTAKMSKSDENAKATIFILDDEKTILKK 239

Query: 243 IQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALAD 302
            + A TD + L   V+  E +    NL+ I++ +    +E    +F GK +  FK A+  
Sbjct: 240 FKSAVTDSEAL---VAFREGKDGINNLMTIYSAVTGKSMEAIADEFSGKGYGDFKTAVGT 296

Query: 303 AVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            V EE+  I +    LLKD +YLD  +++G  RA   A++T++     +GL
Sbjct: 297 VVAEELREIRENYARLLKDAAYLDAAIMDGTERASQIAEKTLRKTMRKMGL 347


>gi|15615433|ref|NP_243736.1| tryptophanyl-tRNA synthetase [Bacillus halodurans C-125]
 gi|20139932|sp|Q9K8Y2|SYW_BACHD RecName: Full=Tryptophanyl-tRNA synthetase; AltName:
           Full=Tryptophan--tRNA ligase; Short=TrpRS
 gi|10175491|dbj|BAB06589.1| tryptophanyl-tRNA synthetase [Bacillus halodurans C-125]
          Length = 330

 Score =  234 bits (598), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 140/345 (40%), Positives = 199/345 (57%), Gaps = 27/345 (7%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYF-IADLHAITNNIVQENLRYQSRLFV 68
           SG+QP+G L LGNYLG +++ +  QE  N    YF I D HAIT    +  LR   R   
Sbjct: 7   SGIQPSGTLTLGNYLGAMKHFVSLQEDYN---CYFCIVDQHAITVPQDRLKLRENIRSLA 63

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+DPS+  +F QS+V  HA L W++ CV+ +G +  M QFK+KS  + +E  S 
Sbjct: 64  ALYLAVGIDPSKATLFIQSEVPAHAQLGWMMQCVSYIGELERMTQFKDKS--DGKEAVSA 121

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
            L  YP LMAADILLY    VPVGEDQ+QHLE+TR +A+RFN ++               
Sbjct: 122 SLLTYPPLMAADILLYHTNIVPVGEDQKQHLELTRDLAERFNKKY--------------- 166

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                 F I E  I    +RI SL D SKKMSKS+ +  S I++LD+   I KKI+ A T
Sbjct: 167 ---NDIFTIPEVQIPKVGARIMSLNDPSKKMSKSNPNPKSYISMLDDEKTITKKIKSAVT 223

Query: 249 DGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
           D D +       EN+    NL+ I++  +   IEE   QF GK + +FK +LA  V++ +
Sbjct: 224 DSDGIVK--FDKENKPAISNLLSIYSLCKGASIEEVEAQFVGKGYGEFKESLAQVVVDTL 281

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            PI ++ + L++ +  LD IL +GA++A   A++T++     +GL
Sbjct: 282 KPIQERYEQLIQSEE-LDHILDQGADKANRVARKTLEKAERAMGL 325


>gi|27364707|ref|NP_760235.1| tryptophanyl-tRNA synthetase [Vibrio vulnificus CMCP6]
 gi|31077003|sp|Q8DCT6|SYW_VIBVU RecName: Full=Tryptophanyl-tRNA synthetase; AltName:
           Full=Tryptophan--tRNA ligase; Short=TrpRS
 gi|27360852|gb|AAO09762.1| tryptophanyl-tRNA synthetase [Vibrio vulnificus CMCP6]
          Length = 338

 Score =  234 bits (598), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 134/351 (38%), Positives = 203/351 (57%), Gaps = 19/351 (5%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  + +SGVQP+G L +GNYLG +R   + Q+  ++   Y + DLHAIT     + L   
Sbjct: 2   SKPIVLSGVQPSGELSIGNYLGALRQWQQMQD--DYDCQYCVVDLHAITVRQDPKALHEA 59

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           +   +A  LA GVDP ++ +F QS V  HA L W+L+C  +MG ++ M QFK+KS     
Sbjct: 60  TLDALAICLAVGVDPKKSTLFVQSHVPEHAQLGWLLNCYTQMGELSRMTQFKDKSARYAN 119

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
           +  ++GLF YPVLMAADILLY A  VPVG DQ+QHLE+ R IA RFN  +  +       
Sbjct: 120 DV-NVGLFGYPVLMAADILLYGAHQVPVGSDQKQHLELARDIATRFNNIYSPE------- 171

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
                      F I E  I +  +R+ SL+DA+KKMSKSD +  + I LL++P  I KKI
Sbjct: 172 --------NPIFTIPEPYIPTVNARVMSLQDATKKMSKSDDNRKNVITLLEDPKSIIKKI 223

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGG-KNFSQFKLALAD 302
            KA+TD +  P      +N+    NL+ +++    +  EE   ++ G + +  FK  + +
Sbjct: 224 NKAQTDTETPPRIAHDWDNKAGISNLMGLYSAATGMSFEEIEAKYQGVEMYGPFKKDVGE 283

Query: 303 AVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           A++  + PI  +   + +D+ Y++ ++ +GA++A  RA ET+K V E+VG 
Sbjct: 284 ALVSMLEPIQAEYHRIREDRGYMNEVMRQGADKASARAAETLKKVYEVVGF 334


>gi|154500357|ref|ZP_02038395.1| hypothetical protein BACCAP_04024 [Bacteroides capillosus ATCC
           29799]
 gi|150270862|gb|EDM98145.1| hypothetical protein BACCAP_04024 [Bacteroides capillosus ATCC
           29799]
          Length = 359

 Score =  234 bits (598), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 132/353 (37%), Positives = 201/353 (56%), Gaps = 23/353 (6%)

Query: 1   MLSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENL 60
           M ++  + +SG+QP+G LHLGNYLG I+N   R +  +    YF+AD+H IT      +L
Sbjct: 27  METTKKVMLSGIQPSGDLHLGNYLGAIKNWGARADEFD--CYYFMADMHTITVRQTPADL 84

Query: 61  RYQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKE 120
           R ++   +A ++A G+DP +N +F QS V  HA+L+W+LSC    G ++ M QFK+KS +
Sbjct: 85  RRRTLEQLAQYIACGLDPEKNTLFVQSHVHQHAELAWVLSCYTMFGELSRMTQFKDKSAK 144

Query: 121 NKEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEV 180
           + +   + GLF YP LMAADILLY+   VPVGEDQ+QH+E+TR IAQRFN  +   +K  
Sbjct: 145 HADNINA-GLFTYPCLMAADILLYQPDFVPVGEDQKQHVELTRNIAQRFNHVYGDVLK-- 201

Query: 181 AQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIA 240
                           + E  I    +R+ SL     KMSKS       + L++ P+ I 
Sbjct: 202 ----------------MPEPYIPKMGARVMSLNQPDTKMSKSIPEGC--VFLMEKPEDIM 243

Query: 241 KKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLAL 300
           +K ++A TD D         EN+    NL+ I++ +     EE   +F GK +  FK  +
Sbjct: 244 RKFKRAITDSDTEHCVRYDRENKPGVANLMSIYSAVTGKTFEEIEAEFDGKGYGAFKPVV 303

Query: 301 ADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            +AV+E + PI ++ + LL DK+YL+ +   GA +A   A++T++ V + VG 
Sbjct: 304 GEAVVEMLRPIQEETRRLLSDKAYLENVYRAGAEKASYVAEKTLRKVYKKVGF 356


>gi|146313429|ref|YP_001178503.1| tryptophanyl-tRNA synthetase [Enterobacter sp. 638]
 gi|145320305|gb|ABP62452.1| tryptophanyl-tRNA synthetase [Enterobacter sp. 638]
          Length = 334

 Score =  234 bits (598), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 132/347 (38%), Positives = 196/347 (56%), Gaps = 21/347 (6%)

Query: 7   LFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRL 66
           +  SG QP+G L +GNY+G +R  +  Q+  ++  +Y I DLHAIT     E LR  +  
Sbjct: 5   IVFSGAQPSGELTIGNYMGALRQWVGMQD--DYHCIYCIVDLHAITARQDPEKLRKATLD 62

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
            +A +LA G+DP ++ IF QS V  HA L W L+C    G ++ M QFK+KS    E   
Sbjct: 63  TLALYLACGIDPEKSTIFVQSHVPEHAQLGWALNCYTYFGELSRMTQFKDKSARYSENIN 122

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           + GLF YPVLMAADILLY+   VPVGEDQ+QHLE++R IAQRFN  +             
Sbjct: 123 A-GLFDYPVLMAADILLYQTNQVPVGEDQKQHLELSRDIAQRFNAIY------------- 168

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F + E  I  S +R+ SL + +KKMSKSD +  + I LL++P  + KK+++A
Sbjct: 169 -----GDVFKVPEPFIPKSGARVMSLLEPTKKMSKSDDNRNNVIGLLEDPKAVVKKLKRA 223

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
            TD D  P     ++N+    NL++I + +    I E  + F GK +   K  +ADAV  
Sbjct: 224 VTDSDEPPVVRYDVQNKAGVSNLLDILSGVTGQSIPELEQHFEGKMYGHLKGEVADAVSG 283

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            +  + ++      D++ L+ ++ +GA++A  RA ET+K V + +G 
Sbjct: 284 MLTELQERYNRFRNDEALLNQVMRDGADKASARAAETLKAVYQAIGF 330


>gi|110005205|emb|CAK99531.1| tryptophanyl-trna synthetase protein [Spiroplasma citri]
          Length = 340

 Score =  234 bits (598), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 142/356 (39%), Positives = 212/356 (59%), Gaps = 34/356 (9%)

Query: 8   FVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
            VSG+  TG L LGNY+G I+N I  QE  N +   F+A+LHAIT  I +E LR   +  
Sbjct: 8   IVSGITATGQLTLGNYIGAIKNFIELQEDNNLI--IFVANLHAITIPISKEELRNNIKNM 65

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSK----ENKE 123
           +A + A+G+DP + IIF QSDV     L+ IL C   +G ++ M QFK+KS     EN  
Sbjct: 66  IALYYASGLDPQKAIIFVQSDVLEVTLLAHILLCNTTIGELSRMTQFKDKSSKMKAENGT 125

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
           E    GL  YP LMAADILLY A  VPVG+DQ+QH+E+TR IA+R N  +++ + ++   
Sbjct: 126 EFIPTGLLTYPTLMAADILLYDADLVPVGKDQKQHIELTRNIAERMNNRYQQNLFKIPT- 184

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
                     F P I G       +I  L++ +KKMSKS +   S I+LLD+P++I KKI
Sbjct: 185 ---------DFIPPIGG-------KIMDLQNPTKKMSKSSNDPKSFISLLDSPELIQKKI 228

Query: 244 QKAKTD--GDVL--PSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLA 299
           + A TD  G +   P +  G+       NL+ I+A +++I IE A+K+F  +++ Q K  
Sbjct: 229 RSAVTDSEGKIAYNPDQKPGVS------NLLTIYAVLKKITIEAAVKEFVQQDYGQLKEQ 282

Query: 300 LADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLSH 355
           +A+A+IE + PI +K   L++D++ +D ++  GA +AR  A + +  V  +VGL++
Sbjct: 283 VANAIIETLEPIQKKYHKLMQDQT-IDELINLGATKARAIANKKITKVKNVVGLNY 337


>gi|327278120|ref|XP_003223810.1| PREDICTED: tryptophanyl-tRNA synthetase, mitochondrial-like [Anolis
           carolinensis]
          Length = 380

 Score =  234 bits (598), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 133/345 (38%), Positives = 200/345 (57%), Gaps = 25/345 (7%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SG+QPTG+ HLGNYLG I N ++ QE C+ + +Y I DLH++T       LR   +   A
Sbjct: 59  SGIQPTGIPHLGNYLGAIINWVKLQEECSSV-LYSIVDLHSLTTPREPAVLRTNIQDIAA 117

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
             LA G++P + I+F+QS V  H  L+WIL C + +  + +   +K K+     E  + G
Sbjct: 118 VLLACGLNPQKCILFQQSQVPEHTQLAWILGCFSSVPRLQHFPHWKIKNATQMNE-GTAG 176

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           LF YPVL AADILLY++THVPVGEDQ  HLE+T+  A+RFN           +KY     
Sbjct: 177 LFTYPVLQAADILLYKSTHVPVGEDQVLHLELTQDTARRFN-----------KKYGD--- 222

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
               FFP+ + ++ ++  +++SLRD S KMSKSD    + + + D+P+ I KK +KA TD
Sbjct: 223 ----FFPVPKAIL-TTTKKVKSLRDPSSKMSKSDPQKLATVCVTDSPEEIHKKFRKAVTD 277

Query: 250 GDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEI 308
                SEV+   E R    NL+ I + +  +  EE + Q  G + + +K  +A+AVIE+ 
Sbjct: 278 ---FTSEVTYDPEGRPGVSNLVAIHSAITGLSTEEVVHQSVGIDTAHYKAVVAEAVIEKF 334

Query: 309 VPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            PI  + + L +D++YL+ +L  GA +A+  A      +  +VGL
Sbjct: 335 SPIRNEFKRLKEDRAYLEKVLCTGAEKAKELASPVYLEIKRLVGL 379


>gi|89075215|ref|ZP_01161646.1| tryptophanyl-tRNA synthetase [Photobacterium sp. SKA34]
 gi|89049037|gb|EAR54604.1| tryptophanyl-tRNA synthetase [Photobacterium sp. SKA34]
          Length = 339

 Score =  234 bits (598), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 136/351 (38%), Positives = 200/351 (56%), Gaps = 18/351 (5%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  + +SGVQP+G L +GNYLG +R   + Q+  ++   Y + DLHAIT     + L   
Sbjct: 2   SKPIVLSGVQPSGELSIGNYLGALRQWEQMQD--DYDCQYCVVDLHAITVRQDPKALHEA 59

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           +   +A  LA GVDP ++ +F QS V  HA L W+L+C  +MG ++ M QFK+KS  +  
Sbjct: 60  TLDALAICLAVGVDPQKSTLFVQSHVPEHAQLGWLLNCYTQMGELSRMTQFKDKSARHAN 119

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
           +  ++GLF YPVLMAADILLY A  VPVG DQ+QHLE+ R IA RFN             
Sbjct: 120 DV-NVGLFGYPVLMAADILLYGAHQVPVGSDQKQHLELARDIATRFNN-----------L 167

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
           Y  EE      F I E  I S  +R+ SL+DA+KKMSKSD +  + I LL++P  I KK+
Sbjct: 168 YGTEE---SPIFQIPEPYIPSVGARVMSLQDATKKMSKSDDNRKNVITLLEDPKSILKKV 224

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGG-KNFSQFKLALAD 302
            KA+TD +  P      EN+    NL+ +++        E   Q+ G + +  FK  + +
Sbjct: 225 NKAQTDAETPPRIAFDTENKAGISNLMGLYSGATGKTYAEIEAQYAGVEMYGPFKKDVGE 284

Query: 303 AVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           A++  + P+  +   +  D++YLD+++ +GA +A  RA E +K   + VG 
Sbjct: 285 ALVAMLEPVQAEYHRIRADRAYLDSVMKQGAEKASARAAEVLKKAYQAVGF 335


>gi|25027252|ref|NP_737306.1| tryptophanyl-tRNA synthetase [Corynebacterium efficiens YS-314]
 gi|259506611|ref|ZP_05749513.1| tryptophan--tRNA ligase [Corynebacterium efficiens YS-314]
 gi|39932212|sp|Q8FRR3|SYW_COREF RecName: Full=Tryptophanyl-tRNA synthetase; AltName:
           Full=Tryptophan--tRNA ligase; Short=TrpRS
 gi|23492533|dbj|BAC17506.1| putative tryptophanyl-tRNA synthetase [Corynebacterium efficiens
           YS-314]
 gi|259165809|gb|EEW50363.1| tryptophan--tRNA ligase [Corynebacterium efficiens YS-314]
          Length = 346

 Score =  234 bits (598), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 135/347 (38%), Positives = 194/347 (55%), Gaps = 25/347 (7%)

Query: 9   VSGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SG+QPT    HLGNYLG ++  I  Q + +    YFI DLHAIT +   E LR ++   
Sbjct: 17  LSGIQPTADSYHLGNYLGAVKQWIDLQNSYD--AFYFIPDLHAITVDQNPEELRARTVSG 74

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A  LA G+DP R+ +F QS +  HA+LSW+L+C+   G  + M QFK+KS +   E  S
Sbjct: 75  AAQLLALGIDPERSTLFVQSHIPAHAELSWVLTCLTGFGEASRMTQFKDKSTKQGAERTS 134

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
            GLF YP+LMAADILLYR   VPVGEDQRQHLE+TR +A+RFN  F              
Sbjct: 135 AGLFTYPMLMAADILLYRPQLVPVGEDQRQHLELTRTLAERFNNRFGT------------ 182

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                  F + EG I   AS+I  L++ + KMSKS  +    INLLD+P + +K+I+ A 
Sbjct: 183 ------VFEVPEGFIPEGASKIYDLQNPTAKMSKSGENPKGLINLLDDPKVSSKRIKSAV 236

Query: 248 TDGD-VLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIE 306
           TD D V+  +V+   N+    NL+ I + +    +++ +  + GK +   K   ADA+  
Sbjct: 237 TDNDGVIAFDVA---NKPGVSNLLVIQSALTGESVDKLVAGYEGKGYGALKTDTADALEA 293

Query: 307 EIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
              P+  K    + D++ L+ +L  GA RA   A + +  V + +G 
Sbjct: 294 FTTPLRAKYDEYMSDRAELERVLAIGAERAGEIATKVLAEVYDKIGF 340


>gi|239995403|ref|ZP_04715927.1| tryptophanyl-tRNA synthetase [Alteromonas macleodii ATCC 27126]
          Length = 335

 Score =  234 bits (597), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 140/358 (39%), Positives = 206/358 (57%), Gaps = 33/358 (9%)

Query: 2   LSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLR 61
           +S+  + +SG QP+G L LGNY+G ++  +  Q+  +H  +Y I DLHAIT     + L 
Sbjct: 1   MSNKPVVLSGCQPSGQLTLGNYMGALKQWVSMQD--DHDCLYMIVDLHAITVRQDPKQLA 58

Query: 62  YQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKEN 121
                 ++ +LA G+DP ++ +F QS V  HA LSW+L+C A+MG +N M QFK+KS +N
Sbjct: 59  EACLDGLSLYLACGIDPQKSTLFLQSHVPEHAQLSWVLNCYAQMGELNRMTQFKDKSAKN 118

Query: 122 KEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVA 181
            E   ++GL+ YPVL AADILLY+A  VPVGEDQ+QHLE+TR IA R N  +        
Sbjct: 119 -ENNINVGLYSYPVLQAADILLYQADKVPVGEDQKQHLELTRDIATRVNNLY-------- 169

Query: 182 QKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAK 241
                        F + +  I    +RI SL++  KKMSKSD++  + I LL++P  +AK
Sbjct: 170 ----------GDVFRLPDPYIPDFGARIMSLQEPEKKMSKSDNNPNNFIGLLEDPKKLAK 219

Query: 242 KIQKAKTDGD------VLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQ 295
           KI++A TD D        P+E  G+ N L   +L    AT + IK  E   ++  K +  
Sbjct: 220 KIKRAVTDSDEQANIYFNPTEKPGVSNLLTLLSL----ATGKSIK--ELEPEYTDKMYGH 273

Query: 296 FKLALADAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
            K  +ADAV+  + PI  +   +  D++YLD ++ +GA +A  RA ET+  V + VG 
Sbjct: 274 LKGDVADAVVALLEPIQARYAEIRADRAYLDDVMSQGAEKASARAAETLAKVYKAVGF 331


>gi|37681242|ref|NP_935851.1| tryptophanyl-tRNA synthetase [Vibrio vulnificus YJ016]
 gi|39932017|sp|Q7MH15|SYW_VIBVY RecName: Full=Tryptophanyl-tRNA synthetase; AltName:
           Full=Tryptophan--tRNA ligase; Short=TrpRS
 gi|37199993|dbj|BAC95822.1| tryptophanyl-tRNA synthetase [Vibrio vulnificus YJ016]
          Length = 338

 Score =  234 bits (597), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 134/351 (38%), Positives = 203/351 (57%), Gaps = 19/351 (5%)

Query: 4   SDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQ 63
           S  + +SGVQP+G L +GNYLG +R   + Q+  ++   Y + DLHAIT     + L   
Sbjct: 2   SKPIVLSGVQPSGELSIGNYLGALRQWQQMQD--DYDCQYCVVDLHAITVRQDPKALHEA 59

Query: 64  SRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKE 123
           +   +A  LA GVDP ++ +F QS V  HA L W+L+C  +MG ++ M QFK+KS     
Sbjct: 60  TLDALAICLAVGVDPKKSTLFVQSHVPEHAQLGWLLNCYTQMGELSRMTQFKDKSARYAN 119

Query: 124 ETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQK 183
           +  ++GLF YPVLMAADILLY A  VPVG DQ+QHLE+ R IA RFN  +  +       
Sbjct: 120 DV-NVGLFGYPVLMAADILLYGAHQVPVGSDQKQHLELARDIATRFNNIYSPE------- 171

Query: 184 YAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKI 243
                      F I E  I +  +R+ SL+DA+KKMSKSD +  + I LL++P  I KKI
Sbjct: 172 --------NPIFTIPEPYIPTVNARVMSLQDATKKMSKSDDNRKNVITLLEDPKSIIKKI 223

Query: 244 QKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGG-KNFSQFKLALAD 302
            KA+TD +  P      +N+    NL+ +++    +  EE   ++ G + +  FK  + +
Sbjct: 224 NKAQTDTETPPRIAHDWDNKAGISNLMGLYSAATGMSFEEIEAKYQGVEMYGPFKKDVGE 283

Query: 303 AVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           A++  + PI  +   + +D+ Y++ ++ +GA++A  RA ET+K V E+VG 
Sbjct: 284 ALVAMLEPIQAEYHRIREDRGYMNEVMRQGADKASARAAETLKKVYEVVGF 334


>gi|332653422|ref|ZP_08419167.1| tryptophan--tRNA ligase [Ruminococcaceae bacterium D16]
 gi|332518568|gb|EGJ48171.1| tryptophan--tRNA ligase [Ruminococcaceae bacterium D16]
          Length = 355

 Score =  234 bits (597), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 131/351 (37%), Positives = 199/351 (56%), Gaps = 23/351 (6%)

Query: 3   SSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRY 62
           +   + +SG+QP+G LHLGNYLG I+N   R E  +    YF+AD+H IT      +LR 
Sbjct: 25  TKKKVMLSGIQPSGDLHLGNYLGAIKNWGARAEEFDCY--YFMADMHTITVRQTPADLRR 82

Query: 63  QSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENK 122
           ++   +A ++A G+DP +N +F QS +  HA+L W+L+C    G ++ M QFK+KS ++ 
Sbjct: 83  RTLTQLAQYIACGLDPEKNTLFIQSHIPAHAELGWVLNCYTMFGELSRMTQFKDKSAKHA 142

Query: 123 EETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQ 182
           +     GLF YP LMAADILLY+   VPVG DQ+QH+E+TR +AQRFN  +         
Sbjct: 143 DNING-GLFTYPALMAADILLYQPDFVPVGNDQKQHVELTRNVAQRFNNIY--------- 192

Query: 183 KYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKK 242
                       F + E  I  + +RI SL     KMSKS       + L++ P+ I +K
Sbjct: 193 ---------GDVFKVPEPYIPKTGARIMSLNAPDSKMSKSIPE--GCVFLMEKPEDIQRK 241

Query: 243 IQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALAD 302
            ++A TD D         EN+    NL+ I+A +    +EE   +F G+ +  FK A+ +
Sbjct: 242 FKRAITDSDTERCVRFDPENKPGVSNLMSIYAAVTGKSMEEIEAEFDGQGYGAFKPAVGE 301

Query: 303 AVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           AVIE + PI ++ + +LKDK+YL+++   GA +A   A +T++ V + VG 
Sbjct: 302 AVIECLRPIREETERILKDKAYLESVYKAGAEKASYVANKTLRKVYKKVGF 352


>gi|288553422|ref|YP_003425357.1| tryptophanyl-tRNA synthetase [Bacillus pseudofirmus OF4]
 gi|288544582|gb|ADC48465.1| tryptophanyl-tRNA synthetase [Bacillus pseudofirmus OF4]
          Length = 329

 Score =  234 bits (597), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 140/346 (40%), Positives = 197/346 (56%), Gaps = 29/346 (8%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYF-IADLHAITNNIVQENLRYQSRLFV 68
           SG+QP+G L LGNYLG +++ +  Q   N    YF I D HAIT    +  LR   R   
Sbjct: 6   SGIQPSGTLTLGNYLGAMKHFVDMQ---NEANCYFCIVDQHAITVPQDRLKLRENIRSLA 62

Query: 69  ASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASL 128
           A +LA G+DP+++ +F QS+V  HA L W++ CVA +G +  M QFK+KS  + +E  S 
Sbjct: 63  ALYLAVGIDPNKSTLFIQSEVPAHAQLGWMMQCVAYIGELERMTQFKDKS--DGKEAVSA 120

Query: 129 GLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEE 188
            L  YP LMAADILLY+   VPVGEDQ+QHLE+TR +A+RFN ++               
Sbjct: 121 SLLTYPPLMAADILLYKTDIVPVGEDQKQHLELTRDLAERFNKKY--------------- 165

Query: 189 QYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKT 248
                 F I E  I    +RI SL D SKKMSKS+ +  S I++LD+P  I KKI+ A T
Sbjct: 166 ---NDIFTIPEVRIPKVGARIMSLNDPSKKMSKSNPNAKSYISMLDDPKTITKKIKSAVT 222

Query: 249 DGDVLPSEVS-GLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEE 307
           D D    E+    E++    NL+ I++    I IEE  +++ G  + +FK  LAD V+  
Sbjct: 223 DTD---GEIKFNREDKPAVSNLLSIYSLCSGISIEELERKYQGAGYGEFKQDLADVVVST 279

Query: 308 IVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           + PI Q+   L++ +  LD IL EGA +A   A + ++     +GL
Sbjct: 280 LEPIQQRYHELIESEE-LDRILDEGAEKANRTASKMVEKAERAMGL 324


>gi|254393466|ref|ZP_05008605.1| tryptophanyl-tRNA synthetase [Streptomyces clavuligerus ATCC 27064]
 gi|197707092|gb|EDY52904.1| tryptophanyl-tRNA synthetase [Streptomyces clavuligerus ATCC 27064]
          Length = 344

 Score =  234 bits (597), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 139/334 (41%), Positives = 188/334 (56%), Gaps = 31/334 (9%)

Query: 9   VSGVQPT-GVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLF 67
           +SG+QPT G  HLGNYLG IR  +  QET  H   Y + DLHAIT       LR  +RL 
Sbjct: 16  LSGIQPTAGSFHLGNYLGAIRQYVALQET--HDAFYMVVDLHAITVPQDPAELRANTRLA 73

Query: 68  VASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETAS 127
            A  LAAG+DP R  +F QS V  HA L W+++C+   G  + M QFK+KS +   + A+
Sbjct: 74  AAQLLAAGLDPDRCTLFIQSHVPEHAQLGWVMNCLTGFGEASRMTQFKDKSAKQGADRAT 133

Query: 128 LGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQE 187
           +GLF YPVL  ADILLY+A  VPVGEDQRQH+E+TR +A+RFNT F       A    +E
Sbjct: 134 VGLFTYPVLQVADILLYQADAVPVGEDQRQHIELTRDLAERFNTRFGDTFSVPAPHIVKE 193

Query: 188 EQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAK 247
                              ++I  L+D + KMSKS S+    INLLD P   AKK++ A 
Sbjct: 194 ------------------VAKIYDLQDPAVKMSKSASTPKGLINLLDEPKATAKKVKSAV 235

Query: 248 TDGDVL----PSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADA 303
           TD D +    P E  G+       NL+ I++T+    + E  K++ GK +   K  LA+ 
Sbjct: 236 TDTDTVIRFDPVEKPGV------SNLLTIYSTLTGRTVAELEKEYEGKMYGALKTDLAEV 289

Query: 304 VIEEIVPISQKIQHLLKDKSYLDTILVEGANRAR 337
           ++E + P   + Q  L D + LD IL +GA++AR
Sbjct: 290 MVEFVTPFRTRTQEFLDDPAALDAILAQGAHKAR 323


>gi|309811198|ref|ZP_07704990.1| tryptophan--tRNA ligase [Dermacoccus sp. Ellin185]
 gi|308434810|gb|EFP58650.1| tryptophan--tRNA ligase [Dermacoccus sp. Ellin185]
          Length = 347

 Score =  234 bits (597), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 141/348 (40%), Positives = 196/348 (56%), Gaps = 26/348 (7%)

Query: 9   VSGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYF-IADLHAITNNIVQENLRYQSRL 66
           +SG+QPT   LHLGNYLG   N +R QE       YF + DLHA+T +     LR +S  
Sbjct: 18  LSGMQPTSDSLHLGNYLGAQINWVRMQEGFTP---YFCVVDLHALTVSPDPALLRERSYA 74

Query: 67  FVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETA 126
             A +LA GVDP+R+ +F QS V  HA+L+W+L+C+   G    M QFK+K+ +   +  
Sbjct: 75  TAAQYLAGGVDPARSAVFVQSHVREHAELAWVLNCITGFGEAGRMTQFKDKAGKRGNDNT 134

Query: 127 SLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQ 186
           S+GLF YP+LMAADILLY A +VPVGEDQRQHLE+TR +AQRFN+ F             
Sbjct: 135 SVGLFTYPILMAADILLYDAQYVPVGEDQRQHLELTRNLAQRFNSRFGET---------- 184

Query: 187 EEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKA 246
                   F + E  I    +R+ SL+D +KKMSKSD +  + IN+LD      KKI+ A
Sbjct: 185 --------FVVPEPYIPEGTARVMSLQDPTKKMSKSDENANASINMLDETKKNTKKIKSA 236

Query: 247 KTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKN-FSQFKLALADAVI 305
            TD D   +    +EN+    NL+ I + +    IE  +++F G+N +   K  +A+ V 
Sbjct: 237 VTDLDNFVA--FDVENKPGIANLLRIHSAISGESIETLVERFAGENRYGALKTEVAEVVA 294

Query: 306 EEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
               P  ++    + D+  LD IL +GA RAR  A  T+    + VGL
Sbjct: 295 SVQGPFRERYLEFMADRGELDRILADGAARAREIAAPTLARAYDAVGL 342


>gi|169826795|ref|YP_001696953.1| tryptophanyl-tRNA synthetase [Lysinibacillus sphaericus C3-41]
 gi|168991283|gb|ACA38823.1| Tryptophanyl-tRNA synthetase [Lysinibacillus sphaericus C3-41]
          Length = 329

 Score =  234 bits (597), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 136/345 (39%), Positives = 197/345 (57%), Gaps = 25/345 (7%)

Query: 10  SGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLRYQSRLFVA 69
           SGVQPTG++ LGNYLG  +     Q+  +   +Y I D HAIT     + LR   R   A
Sbjct: 6   SGVQPTGIVTLGNYLGAFKQFPALQDEGD--AIYCIVDQHAITVAQDPKELRESIRKLAA 63

Query: 70  SFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKENKEETASLG 129
           +++A G+DP ++ +F QS+V  HA   W+L CVA +G +  M QFK+KS  + +E+ S  
Sbjct: 64  TYIATGIDPKKSTLFIQSEVPAHAQAGWMLQCVASIGELERMTQFKDKS--HGKESVSAA 121

Query: 130 LFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVAQKYAQEEQ 189
           L  YP LMAADILLY    VPVG+DQ+QH+E+TR +A+RFN  +                
Sbjct: 122 LLTYPPLMAADILLYNTNIVPVGDDQKQHIELTRDLAERFNKRY---------------- 165

Query: 190 YSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAKKIQKAKTD 249
                  I E  +  + +RI+SL++ +KKMSKSD +  + I LLD    I KKI+ A TD
Sbjct: 166 --GNVLTIPEIQLPKAGARIKSLQEPTKKMSKSDPNTKATIRLLDTAKDIEKKIKSAVTD 223

Query: 250 GDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALADAVIEEIV 309
            D + +    +EN+    NL+ I + +  I I + +K++ G  +  FK  +A AVI+ + 
Sbjct: 224 SDGIVA--FDVENKPGVSNLLTIESAISGISIADLVKKYEGIGYGGFKQGVATAVIDHLT 281

Query: 310 PISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGLS 354
           PI +K  HL+ + S LD IL EGA +A   A  T+K + E +GL 
Sbjct: 282 PIQEKFYHLV-ESSELDVILDEGAEKANAIASATLKRMEEAMGLG 325


>gi|253987549|ref|YP_003038905.1| tryptophanyl-tRNA synthetase [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253778999|emb|CAQ82159.1| tryptophanyl-tRNA synthetase (tryptophan--tRNA ligase (trprs)
           [Photorhabdus asymbiotica]
          Length = 345

 Score =  234 bits (597), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 134/351 (38%), Positives = 198/351 (56%), Gaps = 21/351 (