PSIBLAST alignment of GI: 254780794 and protein with PDB id: 3n9i

gi|301016057|pdb|3N9I|A Chain A, Crystal Structure Of Tryptophanyl-Trna Synthetase From Yersinia Pestis Co92 Length = 346
>gi|301016058|pdb|3N9I|B Chain B, Crystal Structure Of Tryptophanyl-Trna Synthetase From Yersinia Pestis Co92 Length = 346
 Score =  343 bits (881), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 136/352 (38%), Positives = 200/352 (56%), Gaps = 21/352 (5%)

Query: 2   LSSDNLFVSGVQPTGVLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNNIVQENLR 61
           +SS  +  SG QP+G L +GNY+G +R  ++ Q+  ++  +Y I DLHAIT       LR
Sbjct: 12  VSSKPIVFSGAQPSGELTIGNYMGALRQWVQMQD--DYDCIYCIVDLHAITARQDPALLR 69

Query: 62  YQSRLFVASFLAAGVDPSRNIIFKQSDVGYHADLSWILSCVARMGWMNNMIQFKEKSKEN 121
            ++   +A +LA G+DP ++ IF QS V  H+ LSW L+C    G ++ M QFK+KS   
Sbjct: 70  KRTLDTLALYLACGIDPKKSTIFVQSHVPEHSQLSWALNCYTYFGELSRMTQFKDKSARY 129

Query: 122 KEETASLGLFMYPVLMAADILLYRATHVPVGEDQRQHLEITRLIAQRFNTEFERKIKEVA 181
             E  + GLF YPVLMAADILLY+   VPVGEDQ+QHLE++R IA RFN  +        
Sbjct: 130 A-ENINAGLFDYPVLMAADILLYQTNQVPVGEDQKQHLELSRDIASRFNNLYG------- 181

Query: 182 QKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSRINLLDNPDIIAK 241
                        F I E  I  + +R+ SL+D +KKMSKSD +  + I LL++P  + K
Sbjct: 182 -----------DIFKIPEPFIPKAGARVMSLQDPTKKMSKSDDNRNNVIELLEDPKSVVK 230

Query: 242 KIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEEALKQFGGKNFSQFKLALA 301
           KI++A TD D        +E +    NL++I + +    I E   QF G+ +   K A+A
Sbjct: 231 KIKRAMTDSDEPALIRYDVEKKAGVSNLLDILSGVTGQSIPELEAQFTGQMYGHLKGAVA 290

Query: 302 DAVIEEIVPISQKIQHLLKDKSYLDTILVEGANRARCRAQETMKYVNEIVGL 353
           DAV   +  + ++ +   +D++ L  ++ EGA +AR RAQ T+  V E +G 
Sbjct: 291 DAVSGMLSELQERYRTYREDEALLQDVMREGAAKARARAQVTLAKVYEAIGF 342