RPSBLAST alignment for GI: 254780794 and conserved domain: cd00395

>gnl|CDD|173893 cd00395, Tyr_Trp_RS_core, catalytic core domain of tyrosinyl-tRNA and tryptophanyl-tRNA synthetase. Tyrosinyl-tRNA synthetase (TyrRS)/Tryptophanyl-tRNA synthetase (TrpRS) catalytic core domain. These enzymes attach Tyr or Trp, respectively, to the appropriate tRNA. These class I enzymes are homodimers, which aminoacylate the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the class I characteristic HIGH and KMSKS motifs, which are involved in ATP binding. Length = 273
 Score =  108 bits (270), Expect = 3e-24
 Identities = 70/321 (21%), Positives = 106/321 (33%), Gaps = 76/321 (23%)

Query: 10  SGVQPTG-VLHLGNYLGMIRNVIRRQETCNHLGMYFIADLHAITNN----------IVQE 58
            G+ PT   LH+G+ +G +    R Q    H  ++ I     I  +             E
Sbjct: 4   CGIDPTADSLHIGHLIG-LLTFRRFQHA-GHRPIFLIGGQTGIIGDPSGKKSERTLNDPE 61

Query: 59  NLRYQSRLFVASFLAAGVD--PSRNIIFKQSDV---GYHADLSWILSCVARMGWMNNMIQ 113
            +R   R   A +LA G+   P++  +F  SD      H      L     + +M     
Sbjct: 62  EVRQNIRRIAAQYLAVGIFEDPTQATLFNNSDWPGPLAHIQFLRDLGKHVYVNYMERKTS 121

Query: 114 FKEKSKENKEETASLGLFMYPVLMAADILLYRATH----VPVGEDQRQHLEITRLIAQRF 169
           F+ +S    EE  S   F YP L AAD LL   T      P G DQ  ++ + R +A+RF
Sbjct: 122 FQSRS----EEGISATEFTYPPLQAADFLLLNTTEGCDIQPGGSDQWGNITLGRELARRF 177

Query: 170 NTEFERKIKEVAQKYAQEEQYSKGFFPIIEGLIDSSASRIRSLRDASKKMSKSDSSDFSR 229
           N                        F I EGL       +  L     K  KS+S     
Sbjct: 178 N-----------------------GFTIAEGLT---IPLVTKLDG--PKFGKSESGPKWL 209

Query: 230 INLLDNPDIIAKKIQKAKTDGDVLPSEVSGLENRLEAKNLIEIFATMRQIKIEE----AL 285
                +P    +    A                     ++I I      +  EE      
Sbjct: 210 DTEKTSPYEFYQFWINA------------------VDSDVINILKYFTFLSKEEIERLEQ 251

Query: 286 KQFGGKNFSQFKLALADAVIE 306
           +Q+    +   +  LA+ V +
Sbjct: 252 EQYEAPGYRVAQKTLAEEVTK 272