HHsearch alignment for GI: 254780795 and conserved domain: cd05058

>cd05058 PTKc_Met_Ron Catalytic Domain of the Protein Tyrosine Kinases, Met and Ron. Protein Tyrosine Kinase (PTK) family; Met and Ron; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Met and Ron are receptor tyr kinases (RTKs) composed of an alpha-beta heterodimer. The extracellular alpha chain is disulfide linked to the beta chain, which contains an extracellular ligand-binding region with a sema domain, a PSI domain and four IPT repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Met binds to the ligand, hepatocyte growth factor/scatter factor (HGF/SF), and is also ca
Probab=94.40  E-value=0.41  Score=26.79  Aligned_cols=30  Identities=20%  Similarity=0.320  Sum_probs=24.7

Q ss_pred             CCEEECCCCCCCEEECCCCCEEEECCCCCC
Q ss_conf             744402234642256279604873162135
Q gi|254780795|r  184 TGIIHADLFPDNVLFYNNKIMGLIDFYFSC  213 (316)
Q Consensus       184 ~g~IHgDl~~~NiL~~~~~i~giIDF~~~~  213 (316)
T Consensus       117 ~~ivHrDlK~~NiLld~~~~~Kl~DFGla~  146 (262)
T cd05058         117 KKFVHRDLAARNCMLDESFTVKVADFGLAR  146 (262)
T ss_pred             CCCCCCCCCCCEEEECCCCCEEEEECCCCC
T ss_conf             994757578240888899968997646551